BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006M24

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAM12952.1|  auxin-regulated protein                                 226   1e-68   Zinnia elegans [garden zinnia]
gb|ABI36491.1|  AUX/IAA8A                                               216   2e-67   Malus domestica [apple tree]
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      223   2e-67   Sesamum indicum [beniseed]
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      223   3e-67   Cicer arietinum [garbanzo]
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             222   1e-66   Prunus persica
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                219   1e-66   Erythranthe guttata [common monkey flower]
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           222   2e-66   Prunus mume [ume]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             221   2e-66   Phaseolus vulgaris [French bean]
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    219   3e-66   
gb|AGV54485.1|  auxin-responsive protein                                220   3e-66   Phaseolus vulgaris [French bean]
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 219   6e-66   Medicago truncatula
gb|ABY48132.1|  GH1 protein                                             219   7e-66   Medicago truncatula
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             219   7e-66   Phaseolus vulgaris [French bean]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           219   9e-66   Pyrus x bretschneideri [bai li]
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    219   9e-66   Cicer arietinum [garbanzo]
gb|ADL36578.1|  ARF domain class transcription factor                   219   1e-65   Malus domestica [apple tree]
gb|KHN46011.1|  Auxin-responsive protein IAA9                           218   1e-65   Glycine soja [wild soybean]
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           219   2e-65   Fragaria vesca subsp. vesca
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    219   2e-65   Nelumbo nucifera [Indian lotus]
gb|KHN04889.1|  Auxin-responsive protein IAA8                           216   3e-65   Glycine soja [wild soybean]
gb|ACJ84551.1|  unknown                                                 217   4e-65   Medicago truncatula
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    219   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    219   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      217   4e-65   Sesamum indicum [beniseed]
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           217   5e-65   Glycine max [soybeans]
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             217   7e-65   
gb|ABW24025.1|  aux/IAA protein                                         210   7e-65   Eucommia ulmoides
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    217   7e-65   
gb|AAB70005.1|  GH1 protein                                             216   8e-65   Glycine max [soybeans]
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    217   1e-64   Eucalyptus grandis [rose gum]
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             216   2e-64   Citrus clementina [clementine]
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      216   2e-64   Citrus sinensis [apfelsine]
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    215   2e-64   Glycine max [soybeans]
gb|KHN22187.1|  Auxin-responsive protein IAA9                           215   2e-64   Glycine soja [wild soybean]
gb|ABM53871.1|  IAA3                                                    208   3e-64   Cestrum elegans
gb|AFK38170.1|  unknown                                                 214   3e-64   Lotus japonicus
gb|AFK49626.1|  unknown                                                 214   4e-64   Medicago truncatula
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      215   6e-64   Nelumbo nucifera [Indian lotus]
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      214   7e-64   Populus euphratica
emb|CAC84706.1|  aux/IAA protein                                        214   8e-64   Populus tremula x Populus tremuloides
ref|XP_007047689.1|  Transcription factor, putative isoform 3           214   8e-64   
gb|AFZ78618.1|  hypothetical protein                                    214   8e-64   Populus tomentosa [Chinese white poplar]
ref|XP_002302351.1|  auxin-responsive family protein                    214   9e-64   Populus trichocarpa [western balsam poplar]
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      213   1e-63   Nicotiana tomentosiformis
ref|XP_007047687.1|  Transcription factor, putative isoform 1           214   2e-63   Theobroma cacao [chocolate]
emb|CDP00957.1|  unnamed protein product                                213   2e-63   Coffea canephora [robusta coffee]
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg                211   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      212   3e-63   Nicotiana sylvestris
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                212   3e-63   Erythranthe guttata [common monkey flower]
emb|CBI19314.3|  unnamed protein product                                211   5e-63   Vitis vinifera
gb|ABB55368.1|  Aux/IAA protein-like                                    211   6e-63   Solanum tuberosum [potatoes]
ref|NP_001275473.1|  Aux/IAA protein                                    211   6e-63   Solanum tuberosum [potatoes]
ref|NP_001268170.1|  Aux/IAA protein                                    211   1e-62   Vitis vinifera
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              211   1e-62   Vitis vinifera
gb|AAL92850.1|  Aux/IAA protein                                         211   1e-62   Vitis vinifera
emb|CAI77628.1|  Aux/IAA protein                                        209   2e-62   Solanum lycopersicum
emb|CAD10639.1|  IAA9 protein                                           210   2e-62   Nicotiana tabacum [American tobacco]
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    209   3e-62   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 209   3e-62   
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like      210   5e-62   Cucumis sativus [cucumbers]
gb|KDP32156.1|  hypothetical protein JCGZ_12617                         210   5e-62   Jatropha curcas
gb|KJB18136.1|  hypothetical protein B456_003G035700                    209   1e-61   Gossypium raimondii
gb|ABM53870.1|  IAA2                                                    201   2e-61   Cestrum elegans
gb|ACJ84768.1|  unknown                                                 202   2e-61   Medicago truncatula
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     207   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          208   3e-61   Amborella trichopoda
gb|KHG08155.1|  Auxin-responsive IAA9 -like protein                     207   4e-61   Gossypium arboreum [tree cotton]
ref|NP_001240013.1|  uncharacterized protein LOC100804423               204   1e-60   Glycine max [soybeans]
gb|ABR17764.1|  unknown                                                 205   1e-60   Picea sitchensis
ref|XP_003543635.1|  PREDICTED: auxin-responsive protein IAA27-like     204   1e-60   Glycine max [soybeans]
gb|ABI36495.1|  AUX/IAA27 A                                             197   1e-60   Malus domestica [apple tree]
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          205   1e-60   Nelumbo nucifera [Indian lotus]
emb|CBI36106.3|  unnamed protein product                                204   2e-60   Vitis vinifera
gb|AFK41338.1|  unknown                                                 200   2e-60   Medicago truncatula
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           205   2e-60   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         205   2e-60   Jatropha curcas
ref|XP_002528895.1|  transcription factor, putative                     205   3e-60   Ricinus communis
ref|XP_003597715.1|  Auxin-responsive protein IAA                       204   3e-60   Medicago truncatula
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     204   4e-60   Elaeis guineensis
emb|CBI28036.3|  unnamed protein product                                198   4e-60   Vitis vinifera
gb|KHN32629.1|  Auxin-responsive protein IAA27                          202   5e-60   Glycine soja [wild soybean]
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     204   6e-60   Vitis vinifera
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                     204   7e-60   Gossypium arboreum [tree cotton]
ref|XP_010105114.1|  Auxin-responsive protein IAA9                      204   8e-60   
gb|KJB71165.1|  hypothetical protein B456_011G109000                    203   8e-60   Gossypium raimondii
gb|KJB71166.1|  hypothetical protein B456_011G109000                    203   1e-59   Gossypium raimondii
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      203   1e-59   Pyrus x bretschneideri [bai li]
gb|KJB58781.1|  hypothetical protein B456_009G226000                    203   1e-59   Gossypium raimondii
gb|KJB58777.1|  hypothetical protein B456_009G226000                    203   1e-59   Gossypium raimondii
gb|ABR16139.1|  unknown                                                 206   1e-59   Picea sitchensis
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 203   2e-59   Malus domestica [apple tree]
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             203   2e-59   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               202   2e-59   Glycine max [soybeans]
ref|XP_010555426.1|  PREDICTED: auxin-responsive protein IAA8-like      202   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_007150643.1|  hypothetical protein PHAVU_005G169600g             202   2e-59   Phaseolus vulgaris [French bean]
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      202   2e-59   
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like      203   3e-59   Cucumis melo [Oriental melon]
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           202   3e-59   Ricinus communis
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    202   3e-59   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           202   3e-59   Glycine soja [wild soybean]
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 202   3e-59   Cucumis sativus [cucumbers]
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      202   3e-59   Prunus mume [ume]
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      202   4e-59   Cucumis melo [Oriental melon]
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           200   4e-59   Ricinus communis
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             203   4e-59   Prunus persica
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    200   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002303297.1|  auxin-responsive protein IAA27                     201   4e-59   Populus trichocarpa [western balsam poplar]
emb|CDP02673.1|  unnamed protein product                                202   5e-59   Coffea canephora [robusta coffee]
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             200   5e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    202   5e-59   Citrus sinensis [apfelsine]
gb|KJB64033.1|  hypothetical protein B456_010G031600                    200   7e-59   Gossypium raimondii
gb|AFK35603.1|  unknown                                                 193   7e-59   Lotus japonicus
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             201   1e-58   Phaseolus vulgaris [French bean]
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     199   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     199   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             201   1e-58   
gb|AEI70507.1|  auxin-responsive protein                                200   1e-58   Gossypium hirsutum [American cotton]
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     200   2e-58   Gossypium arboreum [tree cotton]
gb|KJB64027.1|  hypothetical protein B456_010G031600                    200   2e-58   Gossypium raimondii
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   200   2e-58   Citrus sinensis [apfelsine]
gb|ABK24636.1|  unknown                                                 201   2e-58   Picea sitchensis
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          199   2e-58   Vitis vinifera
emb|CDY25617.1|  BnaA04g13090D                                          197   2e-58   Brassica napus [oilseed rape]
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8           197   2e-58   Brassica rapa
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          199   3e-58   Amborella trichopoda
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             197   3e-58   Citrus clementina [clementine]
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    198   3e-58   Phoenix dactylifera
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg             198   4e-58   
gb|AFK38538.1|  unknown                                                 198   4e-58   Lotus japonicus
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         197   5e-58   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         198   5e-58   
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    199   5e-58   Populus euphratica
gb|KDP37265.1|  hypothetical protein JCGZ_06321                         198   5e-58   Jatropha curcas
gb|AEV89263.1|  IAA9                                                    197   6e-58   Musa acuminata AAA Group [Cavendish banana]
ref|NP_179852.1|  auxin-responsive protein IAA8                         197   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg             198   7e-58   Eutrema salsugineum [saltwater cress]
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   198   7e-58   Citrus sinensis [apfelsine]
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    198   7e-58   Citrus sinensis [apfelsine]
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          199   7e-58   
ref|NP_001189579.1|  auxin-responsive protein IAA8                      198   7e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like      197   8e-58   Camelina sativa [gold-of-pleasure]
gb|AFK41855.1|  unknown                                                 190   9e-58   Medicago truncatula
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     197   1e-57   Phoenix dactylifera
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             197   2e-57   Citrus clementina [clementine]
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     196   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           197   2e-57   Glycine max [soybeans]
emb|CDX89499.1|  BnaC04g35180D                                          195   2e-57   
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like     196   2e-57   Elaeis guineensis
gb|AEQ94167.1|  auxin induced family protein                            190   2e-57   Elaeis guineensis
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...    197   2e-57   
ref|XP_011009359.1|  PREDICTED: auxin-responsive protein IAA27-like     197   3e-57   Populus euphratica
ref|XP_009612337.1|  PREDICTED: auxin-responsive protein IAA27-like     196   3e-57   Nicotiana tomentosiformis
gb|KHN09036.1|  Auxin-responsive protein IAA8                           197   3e-57   Glycine soja [wild soybean]
emb|CDP03299.1|  unnamed protein product                                196   3e-57   Coffea canephora [robusta coffee]
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             196   3e-57   Phaseolus vulgaris [French bean]
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8           196   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007047688.1|  Transcription factor, putative isoform 2           197   3e-57   Theobroma cacao [chocolate]
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      197   3e-57   Glycine max [soybeans]
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like      196   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...    197   4e-57   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     196   4e-57   Phoenix dactylifera
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     196   4e-57   Elaeis guineensis
ref|XP_008462174.1|  PREDICTED: auxin-responsive protein IAA27-like     196   5e-57   Cucumis melo [Oriental melon]
ref|XP_004141756.1|  PREDICTED: auxin-responsive protein IAA8-like      196   5e-57   Cucumis sativus [cucumbers]
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...    195   6e-57   Fragaria vesca subsp. vesca
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     193   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...    196   8e-57   Fragaria vesca subsp. vesca
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         195   9e-57   Theobroma cacao [chocolate]
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          194   1e-56   Glycine max [soybeans]
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     194   1e-56   Elaeis guineensis
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             193   1e-56   Phaseolus vulgaris [French bean]
ref|XP_009771095.1|  PREDICTED: auxin-responsive protein IAA8-like      193   1e-56   Nicotiana sylvestris
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          194   1e-56   Cucumis melo [Oriental melon]
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...    195   1e-56   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     193   2e-56   Nicotiana tomentosiformis
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      195   2e-56   Cicer arietinum [garbanzo]
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8           195   2e-56   Tarenaya hassleriana [spider flower]
emb|CAN77436.1|  hypothetical protein VITISV_007399                     195   2e-56   Vitis vinifera
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     192   2e-56   Nicotiana sylvestris
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    193   2e-56   Gossypium arboreum [tree cotton]
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    192   3e-56   Citrus sinensis [apfelsine]
ref|XP_002878628.1|  indoleacetic acid-induced protein 8                193   3e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    193   4e-56   Phoenix dactylifera
gb|AFK49596.1|  unknown                                                 192   4e-56   Medicago truncatula
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     193   4e-56   Eucalyptus grandis [rose gum]
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 192   4e-56   Medicago truncatula
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like     191   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH27147.1|  auxin response factor                                   190   6e-56   Medicago truncatula
ref|XP_009130522.1|  PREDICTED: auxin-responsive protein IAA9-lik...    188   8e-56   Brassica rapa
gb|AFK45766.1|  unknown                                                 190   8e-56   Medicago truncatula
ref|XP_003615390.1|  Auxin-responsive protein IAA5                      193   8e-56   Medicago truncatula
gb|KHN16618.1|  Auxin-responsive protein IAA27                          191   9e-56   Glycine soja [wild soybean]
ref|NP_001239808.1|  uncharacterized protein LOC100778529               191   1e-55   Glycine max [soybeans]
gb|KHN41649.1|  Auxin-responsive protein IAA27                          191   1e-55   Glycine soja [wild soybean]
ref|XP_002298231.1|  hypothetical protein POPTR_0001s18680g             192   1e-55   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     191   1e-55   Nicotiana sylvestris
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    189   2e-55   Gossypium arboreum [tree cotton]
ref|NP_569017.2|  auxin-responsive protein IAA9                         191   2e-55   
ref|NP_850028.1|  auxin-responsive protein IAA8                         191   2e-55   
gb|KJB54240.1|  hypothetical protein B456_009G026700                    191   3e-55   Gossypium raimondii
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...    192   3e-55   Glycine max [soybeans]
gb|AEI70506.1|  auxin-responsive protein                                191   3e-55   Gossypium hirsutum [American cotton]
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     189   3e-55   Solanum tuberosum [potatoes]
gb|KJB18638.1|  hypothetical protein B456_003G064200                    188   3e-55   Gossypium raimondii
ref|XP_007047690.1|  Transcription factor, putative isoform 4           192   3e-55   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    191   4e-55   Gossypium arboreum [tree cotton]
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg             191   4e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          190   4e-55   Tarenaya hassleriana [spider flower]
gb|KJB18140.1|  hypothetical protein B456_003G035700                    192   4e-55   Gossypium raimondii
gb|KJB56779.1|  hypothetical protein B456_009G135900                    191   4e-55   Gossypium raimondii
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like     191   4e-55   Prunus mume [ume]
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like     189   5e-55   Nicotiana tomentosiformis
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     189   5e-55   Cucumis sativus [cucumbers]
gb|ABI36497.1|  AUX/IAA27 B                                             183   6e-55   Malus domestica [apple tree]
ref|NP_001266034.1|  IAA6 protein                                       188   8e-55   Solanum lycopersicum
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     189   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004503453.1|  PREDICTED: auxin-responsive protein IAA27-like     189   1e-54   Cicer arietinum [garbanzo]
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...    187   1e-54   Tarenaya hassleriana [spider flower]
gb|ABI36496.1|  AUX/IAA26                                               182   1e-54   Malus domestica [apple tree]
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     189   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     189   2e-54   Morus notabilis
gb|KJB18635.1|  hypothetical protein B456_003G064200                    189   2e-54   Gossypium raimondii
gb|KJB18637.1|  hypothetical protein B456_003G064200                    189   2e-54   Gossypium raimondii
ref|XP_002864969.1|  auxin-induced protein IAA9                         189   3e-54   
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     186   3e-54   Elaeis guineensis
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          188   4e-54   Eucalyptus grandis [rose gum]
ref|NP_001280937.1|  auxin-responsive protein IAA27                     187   4e-54   Malus domestica [apple tree]
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...    187   4e-54   Brassica rapa
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          188   5e-54   Sesamum indicum [beniseed]
ref|XP_006584591.1|  PREDICTED: uncharacterized protein LOC100804...    187   6e-54   Glycine max [soybeans]
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     187   6e-54   Pyrus x bretschneideri [bai li]
ref|XP_010463453.1|  PREDICTED: auxin-responsive protein IAA9-lik...    187   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009130521.1|  PREDICTED: auxin-responsive protein IAA9-lik...    183   6e-54   Brassica rapa
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...    188   6e-54   Tarenaya hassleriana [spider flower]
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg             189   7e-54   Citrus clementina [clementine]
emb|CDY68170.1|  BnaCnng57860D                                          187   7e-54   Brassica napus [oilseed rape]
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...    188   8e-54   Tarenaya hassleriana [spider flower]
ref|NP_001241183.1|  uncharacterized protein LOC100804782               187   8e-54   Glycine max [soybeans]
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     184   8e-54   Phoenix dactylifera
emb|CDY37837.1|  BnaAnng04980D                                          186   1e-53   Brassica napus [oilseed rape]
ref|XP_009380571.1|  PREDICTED: auxin-responsive protein IAA21-li...    186   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     186   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    184   1e-53   Elaeis guineensis
gb|AAM64650.1|  auxin-induced protein IAA9                              187   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851275.1|  auxin-responsive protein IAA9                         187   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...    187   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like      187   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     184   2e-53   Phoenix dactylifera
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     186   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006279648.1|  hypothetical protein CARUB_v10026736mg             186   2e-53   Capsella rubella
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    184   2e-53   Elaeis guineensis
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like      186   3e-53   
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg             186   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...    186   3e-53   Phoenix dactylifera
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9           186   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          184   3e-53   Sorghum bicolor [broomcorn]
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     184   4e-53   Setaria italica
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    186   4e-53   
ref|XP_008783242.1|  PREDICTED: auxin-responsive protein IAA17-li...    185   4e-53   Phoenix dactylifera
emb|CDY18679.1|  BnaA09g07160D                                          185   5e-53   Brassica napus [oilseed rape]
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    184   5e-53   Arabis alpina [alpine rockcress]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     182   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002867425.1|  phytochrome-associated protein 2                   184   6e-53   
ref|NP_194637.1|  phytochrome-associated protein 2                      184   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg             185   7e-53   
gb|AAP44405.1|  auxin-induced protein 2                                 184   7e-53   Pinus taeda
ref|XP_009377833.1|  PREDICTED: auxin-responsive protein IAA21-like     185   8e-53   Pyrus x bretschneideri [bai li]
ref|XP_008348505.1|  PREDICTED: auxin-responsive protein IAA21-li...    184   1e-52   Malus domestica [apple tree]
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27          184   1e-52   Fragaria vesca subsp. vesca
ref|XP_008348504.1|  PREDICTED: auxin-responsive protein IAA21-li...    184   1e-52   Malus domestica [apple tree]
ref|XP_004302884.1|  PREDICTED: auxin-responsive protein IAA27-like     184   1e-52   Fragaria vesca subsp. vesca
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     181   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          181   1e-52   Amborella trichopoda
gb|ACV31210.1|  auxin/indole-3-acetic acid 4                            180   2e-52   Solanum tuberosum [potatoes]
gb|EYU21477.1|  hypothetical protein MIMGU_mgv1a011145mg                183   2e-52   Erythranthe guttata [common monkey flower]
gb|EEE53551.1|  hypothetical protein OsJ_36765                          179   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like      183   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_003530133.1|  PREDICTED: auxin-responsive protein IAA27-like     183   3e-52   Glycine max [soybeans]
dbj|BAJ84870.1|  predicted protein                                      181   3e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADL36587.1|  ARF domain class transcription factor                   178   3e-52   
ref|XP_009129008.1|  PREDICTED: auxin-responsive protein IAA27          182   3e-52   
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          183   3e-52   
dbj|BAK01326.1|  predicted protein                                      181   3e-52   
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative           184   3e-52   
ref|XP_009353580.1|  PREDICTED: auxin-responsive protein IAA21-like     183   3e-52   
emb|CBI35213.3|  unnamed protein product                                178   3e-52   
gb|ABI36493.1|  AUX/IAA16 A                                             177   4e-52   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     182   4e-52   
gb|KJB71172.1|  hypothetical protein B456_011G109000                    183   4e-52   
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg             182   4e-52   
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             182   5e-52   
gb|ACF88333.1|  unknown                                                 181   5e-52   
gb|ACF87179.1|  unknown                                                 181   6e-52   
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like      183   6e-52   
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             180   6e-52   
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   180   6e-52   
gb|KDP33705.1|  hypothetical protein JCGZ_07276                         181   6e-52   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         180   8e-52   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     180   9e-52   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    181   9e-52   
dbj|BAJ33683.1|  unnamed protein product                                181   9e-52   
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     179   9e-52   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             181   1e-51   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          181   1e-51   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     179   1e-51   
ref|NP_001268036.1|  uncharacterized protein LOC100250231               179   1e-51   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               179   1e-51   
ref|XP_006465642.1|  PREDICTED: auxin-responsive protein IAA8-lik...    182   1e-51   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           179   2e-51   
gb|ADN34477.1|  auxin influx carrier                                    174   2e-51   
emb|CDY06836.1|  BnaC01g09350D                                          179   2e-51   
ref|NP_001067209.1|  Os12g0601300                                       179   2e-51   
ref|XP_007135656.1|  hypothetical protein PHAVU_010G147200g             181   2e-51   
ref|XP_006412880.1|  hypothetical protein EUTSA_v10025542mg             182   2e-51   
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     179   2e-51   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          179   2e-51   
ref|XP_010438351.1|  PREDICTED: auxin-responsive protein IAA27-like     180   2e-51   
ref|XP_008342663.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    181   3e-51   
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    178   3e-51   
ref|XP_006353472.1|  PREDICTED: auxin-responsive protein IAA27          179   3e-51   
emb|CDO98008.1|  unnamed protein product                                181   3e-51   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        180   3e-51   
ref|XP_006426927.1|  hypothetical protein CICLE_v10025988mg             181   4e-51   
gb|KJB42200.1|  hypothetical protein B456_007G141900                    177   4e-51   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             178   4e-51   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    178   4e-51   
emb|CDX97478.1|  BnaC08g13430D                                          173   5e-51   
ref|XP_007024228.1|  Phytochrome-associated protein 2 isoform 1         181   5e-51   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     177   6e-51   
ref|XP_002864971.1|  hypothetical protein ARALYDRAFT_358770             182   7e-51   
gb|ABD98054.1|  auxin-regulated protein                                 179   7e-51   
gb|AEE25654.1|  auxin-responsive protein                                177   7e-51   
gb|KJB82525.1|  hypothetical protein B456_013G200700                    177   8e-51   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        178   8e-51   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     177   9e-51   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              177   9e-51   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     177   1e-50   
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             177   1e-50   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        176   1e-50   
gb|KJB11141.1|  hypothetical protein B456_001G242900                    176   2e-50   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          176   2e-50   
ref|XP_010107373.1|  Auxin-responsive protein IAA27                     182   2e-50   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    175   3e-50   
gb|ABH01143.1|  auxin-regulated protein                                 176   4e-50   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     175   4e-50   
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     176   4e-50   
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     175   4e-50   
ref|XP_002302075.1|  auxin-induced protein aux28                        174   5e-50   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          175   5e-50   
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     175   6e-50   
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             175   7e-50   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       175   7e-50   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       174   7e-50   
ref|NP_001266049.1|  IAA9 protein                                       174   8e-50   
gb|KJB54244.1|  hypothetical protein B456_009G026700                    176   8e-50   
ref|NP_001266052.1|  IAA8                                               176   1e-49   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like     176   1e-49   
ref|NP_001280973.1|  auxin-responsive protein IAA16                     174   1e-49   
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                174   1e-49   
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     174   1e-49   
gb|KHG04941.1|  Auxin-induced AUX28                                     173   1e-49   
ref|XP_006383686.1|  auxin-induced protein aux28                        174   1e-49   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     174   1e-49   
gb|KHN31465.1|  Auxin-responsive protein IAA16                          173   2e-49   
ref|XP_006656052.1|  PREDICTED: auxin-responsive protein IAA21-like     170   2e-49   
gb|KHN22078.1|  Auxin-responsive protein IAA16                          173   2e-49   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     173   2e-49   
ref|NP_001239753.1|  uncharacterized protein LOC100781847               173   2e-49   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        173   2e-49   
gb|AFK44192.1|  unknown                                                 173   2e-49   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    174   2e-49   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   172   3e-49   
gb|KJB44871.1|  hypothetical protein B456_007G276900                    170   3e-49   
gb|KJB54243.1|  hypothetical protein B456_009G026700                    174   3e-49   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             174   4e-49   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        173   4e-49   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            171   4e-49   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             172   4e-49   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     172   4e-49   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            172   5e-49   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 172   5e-49   
gb|ABI36487.1|  AUX/IAA7 A                                              169   5e-49   
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        172   5e-49   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        172   6e-49   
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      172   6e-49   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          172   6e-49   
dbj|BAJ97201.1|  predicted protein                                      172   7e-49   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          172   7e-49   
gb|KJB56782.1|  hypothetical protein B456_009G135900                    174   7e-49   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             171   8e-49   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        172   8e-49   
dbj|BAB10673.1|  auxin-induced protein IAA9                             174   9e-49   
gb|ACU19136.1|  unknown                                                 172   9e-49   
gb|ABR16302.1|  unknown                                                 174   1e-48   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             172   1e-48   
gb|AEE25650.1|  auxin-responsive protein                                172   1e-48   
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...    174   1e-48   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        171   1e-48   
gb|ABM53872.1|  IAA4                                                    168   2e-48   
ref|NP_001242283.1|  uncharacterized protein LOC100795749               172   2e-48   
gb|KJB18639.1|  hypothetical protein B456_003G064200                    174   2e-48   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       168   2e-48   
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       168   2e-48   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             170   2e-48   
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       168   2e-48   
gb|KJB44873.1|  hypothetical protein B456_007G276900                    171   2e-48   
gb|EEC80532.1|  hypothetical protein OsI_22819                          169   2e-48   
emb|CDO99148.1|  unnamed protein product                                170   2e-48   
ref|NP_001057554.1|  Os06g0335500                                       171   2e-48   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       168   2e-48   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        171   2e-48   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         170   2e-48   
ref|NP_001266070.1|  IAA14                                              170   3e-48   
ref|XP_004153443.1|  PREDICTED: auxin-responsive protein IAA16-like     167   3e-48   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     170   4e-48   
gb|KJB56783.1|  hypothetical protein B456_009G135900                    174   4e-48   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       167   4e-48   
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       167   4e-48   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       167   4e-48   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     170   4e-48   
gb|AAV50046.1|  auxin-induced protein                                   168   4e-48   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          170   5e-48   
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     169   6e-48   
gb|KHN05057.1|  Auxin-responsive protein IAA14                          169   6e-48   
emb|CDY41894.1|  BnaC05g47100D                                          169   7e-48   
ref|XP_009389389.1|  PREDICTED: auxin-responsive protein IAA17-like     171   7e-48   
ref|XP_007215616.1|  hypothetical protein PRUPE_ppa007893mg             172   7e-48   
ref|NP_187124.1|  auxin-responsive protein IAA16                        169   8e-48   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       169   8e-48   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          169   8e-48   
emb|CDY45607.1|  BnaCnng13150D                                          171   9e-48   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    169   9e-48   
gb|AFK36086.1|  unknown                                                 169   1e-47   
ref|XP_002311658.1|  aux/IAA family protein                             169   1e-47   
gb|KJB11145.1|  hypothetical protein B456_001G242900                    169   1e-47   
ref|NP_001241599.1|  uncharacterized protein LOC100803065               169   1e-47   
gb|AFZ78617.1|  hypothetical protein                                    169   1e-47   
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...    171   1e-47   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    168   1e-47   
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   169   1e-47   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             168   2e-47   
ref|XP_002315736.1|  aux/IAA family protein                             169   2e-47   
dbj|BAJ34138.1|  unnamed protein product                                168   2e-47   
gb|ABM53874.1|  IAA6                                                    165   2e-47   
gb|KHN18836.1|  Auxin-induced protein AUX28                             168   2e-47   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    167   2e-47   
gb|AAM96891.1|  auxin-responsive protein IAA1                           166   2e-47   
gb|AFK42876.1|  unknown                                                 168   2e-47   
gb|KCW69644.1|  hypothetical protein EUGRSUZ_F03050                     171   3e-47   
emb|CBI26357.3|  unnamed protein product                                167   3e-47   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    167   3e-47   
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    167   3e-47   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      167   3e-47   
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     168   3e-47   
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          167   4e-47   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     168   4e-47   
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             167   4e-47   
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     167   4e-47   
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        167   4e-47   
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     167   4e-47   
gb|ACU18407.1|  unknown                                                 167   5e-47   
gb|ADJ68049.1|  auxin responsive protein                                167   5e-47   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     166   5e-47   
gb|AGV54230.1|  auxin-induced protein AUX28                             167   5e-47   
emb|CDY40881.1|  BnaCnng09720D                                          165   5e-47   
gb|ACL81167.1|  auxin-responsive protein IAA1                           167   6e-47   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590          167   6e-47   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     167   6e-47   
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        167   6e-47   
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          166   6e-47   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     167   6e-47   
emb|CAN63268.1|  hypothetical protein VITISV_013635                     166   6e-47   
gb|ACJ84642.1|  unknown                                                 167   6e-47   
emb|CAH59413.1|  auxin resistance protein                               166   7e-47   
gb|AAC49055.1|  IAA14                                                   164   7e-47   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          167   7e-47   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          166   7e-47   
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    167   8e-47   
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                167   8e-47   
gb|AEE25653.1|  auxin-responsive protein                                167   8e-47   
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             166   9e-47   
gb|KJB38280.1|  hypothetical protein B456_006G246000                    167   9e-47   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    166   9e-47   
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     166   1e-46   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    166   1e-46   
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     169   1e-46   
ref|NP_001288939.1|  auxin-responsive protein IAA16                     166   1e-46   
ref|NP_001240213.1|  auxin-induced protein ali50                        166   1e-46   
emb|CDY50750.1|  BnaAnng10570D                                          167   1e-46   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    165   2e-46   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             166   2e-46   
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             165   2e-46   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    165   2e-46   
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     166   2e-46   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     165   2e-46   
gb|AFK44393.1|  unknown                                                 166   2e-46   
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               165   2e-46   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             166   2e-46   
gb|AFK37379.1|  unknown                                                 165   2e-46   
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     165   2e-46   



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y++YQ+LSSA+EKMFSCFTIGQCGSQGAPGRE+LSESKLRD LHGS
Sbjct  238  MDGAPYLRKVDLRSYSTYQQLSSAIEKMFSCFTIGQCGSQGAPGRESLSESKLRDLLHGS  297

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMFI SCKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  298  EYVLTYEDKDGDWMLVGDVPWDMFIGSCKRLKIMKGSDAIGLAPRAMEKSKNRN  351



>gb|ABI36491.1| AUX/IAA8A [Malus domestica]
 gb|ABI36492.1| AUX/IAA8 [Malus domestica]
Length=151

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS GAPGRE LSESKLRD LHGS
Sbjct  38   MDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGSHGAPGRERLSESKLRDLLHGS  97

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  98   EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKNRN  151



>ref|XP_011073641.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=346

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCG QGAP RE LSESKLRD LHGS
Sbjct  233  MDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGPQGAPSREMLSESKLRDLLHGS  292

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  293  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAVEKSKNRN  346



>ref|XP_004512542.1| PREDICTED: auxin-responsive protein IAA8-like [Cicer arietinum]
Length=348

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY +YQELSSALEKMFSCFT+GQCGS GAPGRE LSESKLRD LHGS
Sbjct  235  MDGAPYLRKVDLRTYTTYQELSSALEKMFSCFTLGQCGSHGAPGREMLSESKLRDLLHGS  294

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  295  EYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKGSDAIGLAPRAMEKSKSRS  348



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKLRD LHGS
Sbjct  265  MDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQYGSHGAPGRERLSESKLRDLLHGS  324

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  325  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKNRN  378



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRT A+YQELSSALEKMFSCFTIGQCG +GAP RE LSESKLRD LHGS
Sbjct  193  MDGAPYLRKVDLRTCATYQELSSALEKMFSCFTIGQCGPEGAPSREVLSESKLRDILHGS  252

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  253  EYVLTYEDKDGDWMLVGDVPWEMFISSCKRLKIMKGSDAIGLAPRALEKSKNRN  306



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKLRD LHGS
Sbjct  265  MDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQYGSHGAPGRERLSESKLRDLLHGS  324

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  325  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKNRN  378



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS GAPGRE LSESKLRD LHGS
Sbjct  237  MDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGSHGAPGREMLSESKLRDLLHGS  296

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSKSR 
Sbjct  297  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRT  350



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS GAPGRE LSESKL+DFLHGS
Sbjct  213  MDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGAPGREMLSESKLKDFLHGS  272

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKSKSR
Sbjct  273  EYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSR  325



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS GAPGRE LSESKLRD LHGS
Sbjct  239  MDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGSHGAPGREMLSESKLRDLLHGS  298

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSKSR 
Sbjct  299  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRT  352



>ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AES95891.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=335

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTYA+YQ+LSSALEKMFSCFT+GQCGS GAPG+E +SESKLRD LHGS
Sbjct  222  MDGAPYLRKVDLRTYATYQQLSSALEKMFSCFTLGQCGSHGAPGKEMMSESKLRDLLHGS  281

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++C+RLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  282  EYVLTYEDKDGDWMLVGDVPWEMFIDTCRRLKIMKGSDAIGLAPRAMEKSKSRS  335



>gb|ABY48132.1| GH1 protein [Medicago truncatula]
Length=335

 Score =   219 bits (557),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTYA+YQ+LSSALEKMFSCFT+GQCGS GAPG+E +SESKLRD LHGS
Sbjct  222  MDGAPYLRKVDLRTYATYQQLSSALEKMFSCFTLGQCGSHGAPGKEMMSESKLRDLLHGS  281

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++C+RLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  282  EYVLTYEDKDGDWMLVGDVPWEMFIDTCRRLKIMKGSDAIGLAPRAMEKSKSRS  335



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y +YQELSSALEKMFSCFT+GQCGS G PGRE LSESKL+D LHGS
Sbjct  235  MDGAPYLRKVDLRNYTTYQELSSALEKMFSCFTLGQCGSHGVPGREMLSESKLKDLLHGS  294

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKS+SR+
Sbjct  295  EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSRSRS  348



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS GAPGRE LSESKLRD LHGS
Sbjct  260  MDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGSHGAPGRERLSESKLRDLLHGS  319

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  320  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKNRN  373



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS GAPGRE LSESKL+DFLHGS
Sbjct  240  MDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGAPGREMLSESKLKDFLHGS  299

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKSKSR
Sbjct  300  EYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSR  352



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS GAPGRE LSESKLRD LHGS
Sbjct  260  MDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGSHGAPGRERLSESKLRDLLHGS  319

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  320  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKNRN  373



>gb|KHN46011.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y  YQELSSALEKMFSCFT+GQCGS GAPGRE LSESKL+D LHGS
Sbjct  237  MDGAPYLRKVDLRNYTMYQELSSALEKMFSCFTLGQCGSHGAPGREMLSESKLKDLLHGS  296

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKS+SR
Sbjct  297  EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSRSR  349



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY +YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKLRD LHGS
Sbjct  257  MDGAPYLRKVDLRTYGTYQELSSALEKMFSCFTIGQYGSHGAPGRERLSESKLRDLLHGS  316

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPR+ EKSK RN
Sbjct  317  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRSMEKSKIRN  370



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS GAPGRE LSESKLRD LHGS
Sbjct  275  MDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGAPGREMLSESKLRDLLHGS  334

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  335  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGLAPRAMEKCRNRN  388



>gb|KHN04889.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=289

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQGAPGRENLSESKLRDFLHG  530
            MDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS GAPGRE LSESKLRD LHG
Sbjct  175  MDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDLLHG  234

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  235  SEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRS  289



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS G PG+E LSESKL+DFLHGS
Sbjct  235  MDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGGPGKEMLSESKLKDFLHGS  294

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  295  EYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRS  348



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS GAPGRE LSESKLRD LHGS
Sbjct  297  MDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGAPGREMLSESKLRDLLHGS  356

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  357  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGLAPRAMEKCRNRN  410



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS GAPGRE LSESKLRD LHGS
Sbjct  296  MDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGAPGREMLSESKLRDLLHGS  355

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  356  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGLAPRAMEKCRNRN  409



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++YQELSSALEKMFSCF IGQCGS+GAP RE LSESKL+D +HGS
Sbjct  246  MDGAPYLRKVDLKTYSTYQELSSALEKMFSCFIIGQCGSEGAPSRETLSESKLKDLIHGS  305

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDAIGLAPRA EKSK RN
Sbjct  306  EYVLTYEDKDGDWMLVGDVPWEMFIASCKRLKIMKGSDAIGLAPRAVEKSKVRN  359



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQGAPGRENLSESKLRDFLHG  530
            MDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS GAPGRE LSESKLRD LHG
Sbjct  240  MDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDLLHG  299

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            SEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMKGSDAIGLAPRA EKSKSR
Sbjct  300  SEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKGSDAIGLAPRAMEKSKSR  353



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS G PG+E LSESKL+DFLHGS
Sbjct  243  MDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGGPGKEMLSESKLKDFLHGS  302

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  303  EYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRS  356



>gb|ABW24025.1| aux/IAA protein [Eucommia ulmoides]
Length=156

 Score =   210 bits (534),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL TY +YQELSSALEKMFSCF IGQC SQGA  +E LSESKLRD LHGS
Sbjct  43   MDGAPYLRKVDLGTYTTYQELSSALEKMFSCFIIGQCASQGASAKEKLSESKLRDLLHGS  102

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSK++N
Sbjct  103  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKNKN  156



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQGAPGRENLSESKLRDFLHG  530
            MDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS GAPGRE LSESKLRD LHG
Sbjct  245  MDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDLLHG  304

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  305  SEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRS  359



>gb|AAB70005.1| GH1 protein [Glycine max]
Length=339

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQGAPGRENLSESKLRDFLHG  530
            MDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS GAPGRE LSESKLRD LHG
Sbjct  225  MDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDLLHG  284

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGLAPRA EKSKSR+
Sbjct  285  SEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGLAPRAMEKSKSRS  339



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSS+LEKMFS FTIGQCGS G PGRE L+ESKLRDFLHGS
Sbjct  264  MDGAPYLRKVDLRNYSTYQELSSSLEKMFSGFTIGQCGSNGTPGREMLNESKLRDFLHGS  323

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIESCKRLKIMKG+DAIGLAPRA EKSK+RN
Sbjct  324  EYVLTYEDKDGDWMLVGDVPWEMFIESCKRLKIMKGADAIGLAPRALEKSKARN  377



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY +Y ELSSALEKMFSCFTIGQCGS  APGRE LSESKL+D LHGS
Sbjct  263  MDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGS  322

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSK RN
Sbjct  323  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKIRN  376



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY +Y ELSSALEKMFSCFTIGQCGS  APGRE LSESKL+D LHGS
Sbjct  263  MDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGS  322

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSK RN
Sbjct  323  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKIRN  376



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS GAPGRE LSESKL+D LHGS
Sbjct  237  MDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGSHGAPGREMLSESKLKDLLHGS  296

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKS+SR
Sbjct  297  EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSRSR  349



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS GAPGRE LSESKL+D LHGS
Sbjct  237  MDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGSHGAPGREMLSESKLKDLLHGS  296

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGLAPRA EKS+SR
Sbjct  297  EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGLAPRAMEKSRSR  349



>gb|ABM53871.1| IAA3 [Cestrum elegans]
Length=153

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++Y+ELSSALEKMFSCFTIGQ GS GAPG+E LSESKL+D LHGS
Sbjct  40   MDGAPYLRKVDLRNYSAYRELSSALEKMFSCFTIGQYGSHGAPGKEMLSESKLKDLLHGS  99

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  100  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  153



>gb|AFK38170.1| unknown [Lotus japonicus]
Length=347

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS GAPGRE LSESKLRD LHGS
Sbjct  234  MDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGSHGAPGRELLSESKLRDLLHGS  293

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVL+YEDKDGDWMLVGDVPW+MF E+C+RLKIMKGSDAIGLAPRA EKSK R+
Sbjct  294  EYVLSYEDKDGDWMLVGDVPWEMFTETCRRLKIMKGSDAIGLAPRAMEKSKIRS  347



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS G PG+E LSESKL+DFLHGS
Sbjct  235  MDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGGPGKEMLSESKLKDFLHGS  294

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKG DAIGLAPRA EKSKSR+
Sbjct  295  EYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGFDAIGLAPRAMEKSKSRS  348



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS G PGRE LSESKLRD LHGS
Sbjct  273  MDGAPYLRKVDLRTYSNYQELSSALEKMFSCFTIGQCGSHGPPGREMLSESKLRDLLHGS  332

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK SDAIGLAPRA EK + RN
Sbjct  333  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSDAIGLAPRAMEKCRKRN  386



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  253  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  312

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLAPRA EK K+RN
Sbjct  313  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAMEKCKNRN  366



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  252  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  311

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLAPRA EK K+RN
Sbjct  312  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAMEKCKNRN  365



>ref|XP_007047689.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX91846.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
Length=345

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+PG+E LSESKL+D LHGS
Sbjct  232  MDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGSPGKEILSESKLKDLLHGS  291

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGLAPRA EKSK+ N
Sbjct  292  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGLAPRAMEKSKNSN  345



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  252  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  311

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLAPRA EK K+RN
Sbjct  312  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAMEKCKNRN  365



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  253  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  312

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLAPRA EK K+RN
Sbjct  313  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAMEKCKNRN  366



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPG+E LSESKL+D LHGS
Sbjct  233  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGKEMLSESKLKDLLHGS  292

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  293  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  346



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+PG+E LSESKL+D LHGS
Sbjct  263  MDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGSPGKEILSESKLKDLLHGS  322

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGLAPRA EKSK+ N
Sbjct  323  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGLAPRAMEKSKNSN  376



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS G  G+E LSESKL+D LHGS
Sbjct  253  MDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQCGSHGVEGKEVLSESKLKDLLHGS  312

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK SDAIGLAPRA EK++SRN
Sbjct  313  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSSDAIGLAPRAVEKNRSRN  366



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 107/126 (85%), Gaps = 12/126 (10%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRT A+YQELSSALEKMFSCFTIGQCG +GAP RE LSESKLRD LHGS
Sbjct  193  MDGAPYLRKVDLRTCATYQELSSALEKMFSCFTIGQCGPEGAPSREVLSESKLRDILHGS  252

Query  526  EYVLTYEDKDGDWMLVGDVPWD------------MFIESCKRLKIMKGSDAIGLAPRAKE  383
            EYVLTYEDKDGDWMLVGDVPWD            MFI SCKRLKIMKGSDAIGLAPRA E
Sbjct  253  EYVLTYEDKDGDWMLVGDVPWDIDYVTDNCCCLRMFISSCKRLKIMKGSDAIGLAPRALE  312

Query  382  KSKSRN  365
            KSK+RN
Sbjct  313  KSKNRN  318



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPG+E LSESKL+D LHGS
Sbjct  233  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGKELLSESKLKDLLHGS  292

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  293  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  346



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSS LEKMFSCFT+GQCG  GA  RE +SESKLRD LHGS
Sbjct  231  MDGAPYLRKVDLRTYSTYQELSSGLEKMFSCFTLGQCGPAGAQTREMMSESKLRDLLHGS  290

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFI SCKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  291  EYVLTYEDKDGDWMLVGDVPWQMFIASCKRLKIMKGSDAIGLAPRAVEKSKNRN  344



>emb|CBI19314.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  205  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  264

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGLAPRA EK K+RN
Sbjct  265  EYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGLAPRAVEKCKNRN  318



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALE MFSCFTIGQ GS GAPG++ LSESKL+D LHGS
Sbjct  236  MDGAPYLRKVDLRTYSAYQELSSALETMFSCFTIGQYGSHGAPGKDMLSESKLKDLLHGS  295

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  296  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  349



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALE MFSCFTIGQ GS GAPG++ LSESKL+D LHGS
Sbjct  236  MDGAPYLRKVDLRTYSAYQELSSALETMFSCFTIGQYGSHGAPGKDMLSESKLKDLLHGS  295

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  296  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  349



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  246  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  305

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGLAPRA EK K+RN
Sbjct  306  EYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGLAPRAVEKCKNRN  359



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  246  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  305

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGLAPRA EK K+RN
Sbjct  306  EYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGLAPRAVEKCKNRN  359



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  246  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  305

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGLAPRA EK K+RN
Sbjct  306  EYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGLAPRAVEKCKNRN  359



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS GAPG++ LSESKL+D LHGS
Sbjct  195  MDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGAPGKDMLSESKLKDLLHGS  254

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  255  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  308



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GAPG+E LSES+L+D LHGS
Sbjct  233  MDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAPGKEMLSESQLKDLLHGS  292

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMKGSDAIGLAPR  EK +SRN
Sbjct  293  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKGSDAIGLAPRGMEKCRSRN  346



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS GAPG++ LSESKL+D LHGS
Sbjct  236  MDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGAPGKDMLSESKLKDLLHGS  295

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  296  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  349



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS GAPG++ LSESKL+D LHGS
Sbjct  236  MDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGAPGKDMLSESKLKDLLHGS  295

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGLAPRA EK +SRN
Sbjct  296  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  349



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 ref|XP_004160925.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS GA GR+ LSESKLRD LHGS
Sbjct  267  MEGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSHGASGRDKLSESKLRDHLHGS  326

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYED+DGDWMLVG++PW+MFI+SCKRLKI+KGSDAIGLAPRA E++K+R
Sbjct  327  EYVLTYEDRDGDWMLVGEIPWEMFIDSCKRLKIVKGSDAIGLAPRATERTKNR  379



>gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELS ALEKMFSCFTIGQCGS GAPG+E LSE KLRD L+GS
Sbjct  267  MDGAPYLRKVDLRTYSTYQELSCALEKMFSCFTIGQCGSHGAPGKEKLSEIKLRDLLNGS  326

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSK  374
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMK SDAIGLAPRA EKSK
Sbjct  327  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKSSDAIGLAPRAMEKSK  377



>gb|KJB18136.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18137.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18138.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18139.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18141.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18144.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=377

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G  G+E LSES+L+D LHGS
Sbjct  256  MDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSNGTAGKETLSESRLKDLLHGS  315

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGLAPRA EKSK+ N
Sbjct  316  EYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGLAPRAMEKSKANN  369



>gb|ABM53870.1| IAA2 [Cestrum elegans]
Length=152

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y +YQELSSALE MFSCFTIG+CGS GAPG+E+LSESKL+D   GS
Sbjct  39   MDGAPYLRKVDLRNYFAYQELSSALENMFSCFTIGECGSHGAPGKESLSESKLKDLFRGS  98

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW++FI +CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  99   EYVLTYEDKDGDWMLVGDVPWELFINTCKRLRIMKSSDAIGLAPRAMEKCRARN  152



>gb|ACJ84768.1| unknown [Medicago truncatula]
Length=190

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S G PG++ LSES LRD LHGS
Sbjct  77   MDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNSPGLPGKDGLSESSLRDLLHGS  136

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGSDAIGLAPRA EKS+S+N
Sbjct  137  EYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGSDAIGLAPRAMEKSRSQN  190



>ref|XP_010254042.1| PREDICTED: auxin-responsive protein IAA27-like [Nelumbo nucifera]
Length=340

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY+ELS+ALEKMFSCFTIGQCGS G PGR+ LSES+L D LHGS
Sbjct  227  MDGAPYLRKVDLKTYGSYKELSAALEKMFSCFTIGQCGSHGVPGRDGLSESRLMDLLHGS  286

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  287  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNRN  340



>ref|XP_006850381.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++YQELS+ALEKMFSCFTIGQCGS G  GR+ LSESKL+D L+GS
Sbjct  280  MDGAPYLRKVDLKTYSAYQELSTALEKMFSCFTIGQCGSHGVSGRDGLSESKLKDLLNGS  339

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGSDAIGLAPRA EK ++RN
Sbjct  340  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSDAIGLAPRAMEKCRNRN  393



>gb|KHG08155.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
 gb|KHG17373.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=376

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G  G+E LSES+L+D LHGS
Sbjct  255  MDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSHGTAGKEILSESRLKDLLHGS  314

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGLAPRA EKSK+ N
Sbjct  315  EYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGLAPRAVEKSKANN  368



>ref|NP_001240013.1| uncharacterized protein LOC100804423 [Glycine max]
 gb|ACU18729.1| unknown [Glycine max]
 gb|KHM98738.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=319

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S G PG++ LSES LRD LHGS
Sbjct  206  MDGAPYLRKVDLKTYNNYMELSSALEKMFSCFTIGQCNSPGLPGKDGLSESSLRDLLHGS  265

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EKS+S+N
Sbjct  266  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKSRSQN  319



>gb|ABR17764.1| unknown [Picea sitchensis]
Length=324

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y  Y +LSSALEKMFSCFTIGQCGS G PGR+ LSESKL D LHGS
Sbjct  211  MDGAPYLRKVDLKLYNCYLDLSSALEKMFSCFTIGQCGSHGVPGRDGLSESKLMDLLHGS  270

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGS+AIGLAPRA EK K+RN
Sbjct  271  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAMEKCKNRN  324



>ref|XP_003543635.1| PREDICTED: auxin-responsive protein IAA27-like [Glycine max]
Length=307

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S G PG++ LSES LRD LHGS
Sbjct  194  MDGAPYLRKVDLKTYNNYMELSSALEKMFSCFTIGQCNSPGLPGKDGLSESSLRDLLHGS  253

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EKS+S+N
Sbjct  254  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKSRSQN  307



>gb|ABI36495.1| AUX/IAA27 A [Malus domestica]
Length=115

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYL+KVDL+ Y++YQELSSALEKMF CFT+GQ GS GAPGRE +SESKL+D LHGS
Sbjct  3    MDGAPYLKKVDLKNYSAYQELSSALEKMFRCFTLGQYGSHGAPGRE-ISESKLKDLLHGS  61

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  62   EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDAIGLAPRAMEKCRNRN  115



>ref|XP_010249636.1| PREDICTED: auxin-responsive protein IAA27 [Nelumbo nucifera]
Length=343

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY ELS+ALEKMFSCFTIGQCGS G PGR+ LS S+L D LHGS
Sbjct  230  MDGAPYLRKVDLKTYGSYTELSAALEKMFSCFTIGQCGSHGVPGRDGLSASRLMDLLHGS  289

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGS+AIGLAPRA EK KSRN
Sbjct  290  EYVLTYEDKDGDWMLVGDVPWQMFTDSCRRLRIMKGSEAIGLAPRAMEKCKSRN  343



>emb|CBI36106.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y ELSSALEKMFSCFTIGQCGS G PGR+ L+ES L D LHGS
Sbjct  179  MDGAPYLRKVDLKIYCNYMELSSALEKMFSCFTIGQCGSHGLPGRDGLTESHLMDLLHGS  238

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMKGS+AIGLAPRA EK K+RN
Sbjct  239  EYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEAIGLAPRAMEKCKNRN  292



>gb|AFK41338.1| unknown [Medicago truncatula]
Length=190

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S G PG++ LSES LRD LHGS
Sbjct  77   MDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNSPGLPGKDGLSESSLRDLLHGS  136

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKG DAIGLAPRA EKS+S+N
Sbjct  137  EYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGFDAIGLAPRAMEKSRSQN  190



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 103/114 (90%), Gaps = 7/114 (6%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR YA+YQELSS LEKMFSCFT+GQCGS       N+SE+KLRD LHGS
Sbjct  233  MDGAPYLRKVDLRAYATYQELSSGLEKMFSCFTLGQCGS-------NMSETKLRDLLHGS  285

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSKSRN
Sbjct  286  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKSRN  339



>gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS G  GRE LSESKL+D LHGS
Sbjct  255  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGGLGREMLSESKLKDLLHGS  314

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK SDAIGLAPRA EK K+RN
Sbjct  315  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSSDAIGLAPRAVEKCKNRN  368



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRT+++YQELS ALEKMFSCFTIGQCGS GAP RE LSESKLRD L+GS
Sbjct  269  MDGAPYLRKVDLRTHSTYQELSRALEKMFSCFTIGQCGSHGAPEREKLSESKLRDLLNGS  328

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSK  374
            EY LTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGLAPRA EK K
Sbjct  329  EYALTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGLAPRAMEKFK  379



>ref|XP_003597715.1| Auxin-responsive protein IAA [Medicago truncatula]
 gb|AES67966.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=326

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S G PG++ LSES LRD LHGS
Sbjct  213  MDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNSPGLPGKDGLSESSLRDLLHGS  272

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGSDAIGLAPRA EKS+S+N
Sbjct  273  EYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGSDAIGLAPRAMEKSRSQN  326



>ref|XP_010915883.1| PREDICTED: auxin-responsive protein IAA17-like [Elaeis guineensis]
Length=332

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS G PGR+ LSES+L D L+GS
Sbjct  219  MDGAPYLRKVDLKTYNNYKELSSALEKMFSCFTIGQCGSHGIPGRDGLSESRLMDLLNGS  278

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLAPRA EK K+RN
Sbjct  279  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAMEKCKNRN  332



>emb|CBI28036.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS G P R+ LSES+L D LHGS
Sbjct  57   MDGAPYLRKVDLKLYSTYMELSSALEKMFSCFTIGQCGSNGVPIRDGLSESRLMDLLHGS  116

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIGLAPRA EK KSRN
Sbjct  117  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGLAPRAMEKCKSRN  170



>gb|KHN32629.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=307

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMFSCF+IGQC S G PG++ LSES LRD LHGS
Sbjct  194  MDGAPYLRKVDLKTYNNYMELSSALEKMFSCFSIGQCNSPGLPGKDGLSESSLRDLLHGS  253

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EKS+S+N
Sbjct  254  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKSRSQN  307



>ref|XP_002284282.1| PREDICTED: auxin-responsive protein IAA27-like [Vitis vinifera]
Length=343

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y ELSSALEKMFSCFTIGQCGS G PGR+ L+ES L D LHGS
Sbjct  230  MDGAPYLRKVDLKIYCNYMELSSALEKMFSCFTIGQCGSHGLPGRDGLTESHLMDLLHGS  289

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMKGS+AIGLAPRA EK K+RN
Sbjct  290  EYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEAIGLAPRAMEKCKNRN  343



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+ G PG+E LSESKL+D LHGS
Sbjct  238  MDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGTPGKEILSESKLKDLLHGS  297

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSK  374
            EYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DAIGLAP+A +KSK
Sbjct  298  EYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADAIGLAPKAMDKSK  348



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTYA+YQELSSALEKMFSCFTIGQCGS GAPG+E +SESKLRD LHGS
Sbjct  256  MDGAPYLRKVDLRTYATYQELSSALEKMFSCFTIGQCGSHGAPGKEKMSESKLRDLLHGS  315

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKE  383
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCK+LKIMKGSDAIGL  ++ +
Sbjct  316  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKKLKIMKGSDAIGLGSKSND  363



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+ G PG+E LSESKL+D LHGS
Sbjct  239  MDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGTPGKEILSESKLKDLLHGS  298

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSK  374
            EYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DAIGLAP+A +KSK
Sbjct  299  EYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADAIGLAPKAMDKSK  349



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+ G PG+E LSESKL+D LHGS
Sbjct  238  MDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGTPGKEILSESKLKDLLHGS  297

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSK  374
            EYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DAIGLAP+A +KSK
Sbjct  298  EYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADAIGLAPKAMDKSK  348



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GAPGRE +SESKL+D LHGS
Sbjct  251  LDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAPGRE-ISESKLKDLLHGS  309

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMF ++CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  310  EYVLTYEDKDGDWMLVGDVPWDMFTDTCKRMRIMKSSDAIGLAPRAMEKCRNRN  363



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+ YQ+LSSALEKMFSCFTIGQCGS G  GRE LSESKL+D LHGS
Sbjct  255  MDGAPYLRKVDLKNYSKYQDLSSALEKMFSCFTIGQCGSHGPLGRELLSESKLKDLLHGS  314

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  315  EYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLAPRAVEKCRNRN  368



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+ YQ+LSSALEKMFSCFTIGQCGS G  GRE LSESKL+D LHGS
Sbjct  254  MDGAPYLRKVDLKNYSKYQDLSSALEKMFSCFTIGQCGSHGPLGRELLSESKLKDLLHGS  313

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  314  EYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLAPRAVEKCRNRN  367



>gb|ABR16139.1| unknown [Picea sitchensis]
Length=461

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y  Y +LSSALEKMFSCFTIGQCGS G PGR+ LSESKL D LHGS
Sbjct  348  MDGAPYLRKVDLKLYNCYLDLSSALEKMFSCFTIGQCGSHGVPGRDGLSESKLMDLLHGS  407

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGS+AIGLAPRA EK K+RN
Sbjct  408  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAMEKCKNRN  461



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS GAPGRE +SESKL+D LHGS
Sbjct  251  LDGAPYLRKVDLKNYSAYQELSSALEKMFRCFTIGQYGSHGAPGRE-ISESKLKDLLHGS  309

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  310  EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDAIGLAPRAMEKCRNRN  363



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 106/114 (93%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GAPGRE +SESKL+D LHGS
Sbjct  254  LDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAPGRE-ISESKLKDLLHGS  312

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDAIGLAPR+ EK ++RN
Sbjct  313  EYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDAIGLAPRSMEKCRNRN  366



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTI +CGS G  GRE L+E+KL+D LHGS
Sbjct  247  MDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTISKCGSHGILGREMLNETKLKDLLHGS  306

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLAPRA EKSKSR
Sbjct  307  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAVEKSKSR  359



>ref|XP_010555426.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
 ref|XP_010555427.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
Length=360

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY  Y+ELSSALEKMFSCFT+GQCG+ G  GRE LSE KL+D LHGS
Sbjct  247  MDGAPYLRKVDLRTYTCYKELSSALEKMFSCFTLGQCGTHGIQGRERLSEIKLKDLLHGS  306

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MFI++C +LKIMKGSDAIGLAPRA EKSK++
Sbjct  307  EYVLTYEDKDGDWMLVGDVPWEMFIDTCCKLKIMKGSDAIGLAPRAMEKSKNK  359



>ref|XP_007150643.1| hypothetical protein PHAVU_005G169600g [Phaseolus vulgaris]
 gb|ESW22637.1| hypothetical protein PHAVU_005G169600g [Phaseolus vulgaris]
Length=334

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRK+DL+TY +Y ELSSALEKMFSCFTIGQC S G PG++ LSES LRD LHGS
Sbjct  221  MDGAPYLRKIDLKTYNNYMELSSALEKMFSCFTIGQCNSPGLPGKDGLSESSLRDLLHGS  280

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPR  EKS+S+N
Sbjct  281  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRTMEKSRSQN  334



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y++YQELSSALEKMF CFT GQ GS GAPGRE +SESKL+D LHGS
Sbjct  251  LDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTJGQYGSHGAPGRE-ISESKLKDLLHGS  309

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  310  EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDAIGLAPRAMEKCRNRN  363



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G  GR+ LSESKLRD LHGS
Sbjct  267  MEGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSHGVSGRDKLSESKLRDHLHGS  326

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSK  374
            EYVLTYED+DGDWMLVG++PW+MFI+SCKRLKI+KGSDAIGLAPRA E  K
Sbjct  327  EYVLTYEDRDGDWMLVGEIPWEMFIDSCKRLKIVKGSDAIGLAPRATEIQK  377



>ref|XP_002516003.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
 gb|EEF46423.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
Length=373

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y ELSS LEKMFSCFTIGQCGS G PGR+ LSE+ L+D LHGS
Sbjct  260  MDGAPYLRKVDLKTYSNYVELSSGLEKMFSCFTIGQCGSHGLPGRDGLSETCLKDLLHGS  319

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKD DWMLVGDVPW+MF E+C+RL+IMKGS+AIGLAPRA EK KSRN
Sbjct  320  EYVLTYEDKDSDWMLVGDVPWEMFTETCRRLRIMKGSEAIGLAPRAMEKCKSRN  373



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS GAPGRE +SESKL+D LHGS
Sbjct  251  LDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTIGQYGSHGAPGRE-ISESKLKDLLHGS  309

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMF ++CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  310  EYVLTYEDKDGDWMLVGDVPWDMFTDTCKRLRIMKSSDAIGLAPRAMEKCRNRN  363



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTI +CGS G  GRE L+E+KL+D LHGS
Sbjct  247  MDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTISKCGSHGILGREMLNETKLKDLLHGS  306

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYED++GDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLAPRA EKSKSRN
Sbjct  307  EYVLTYEDREGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAVEKSKSRN  360



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+ GA G E +SESKL+D LHGS
Sbjct  242  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGAHGALGMEKMSESKLKDLLHGS  301

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGLAPRA EK ++R
Sbjct  302  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGLAPRAVEKCRNR  354



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 106/114 (93%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRK+DL+ Y++YQELSSALEKMFSCFTIGQ GS GAPGRE +SESKL+D LHGS
Sbjct  254  LDGAPYLRKIDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAPGRE-ISESKLKDLLHGS  312

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDAIGLAPR+ EK ++RN
Sbjct  313  EYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDAIGLAPRSMEKCRNRN  366



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+ GA G E +SESKL+D LHGS
Sbjct  242  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGAHGALGMEKMSESKLKDLLHGS  301

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGLAPRA EK ++R
Sbjct  302  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGLAPRAVEKCRNR  354



>ref|XP_002514266.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
 gb|EEF48220.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
Length=297

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY+SY ELSS LEKMFSCFTIGQCGS G P R+ LSES+L D LHGS
Sbjct  184  MDGAPYLRKVDLKTYSSYMELSSGLEKMFSCFTIGQCGSHGVPSRDGLSESRLMDLLHGS  243

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MF ++C+RL+IMK S+AIGLAPRA EK K+RN
Sbjct  244  EYVLTYEDKDGDWMLVGDVPWKMFTDTCRRLRIMKSSEAIGLAPRAMEKCKNRN  297



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 106/114 (93%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GAPGRE +SESKL+D LHGS
Sbjct  285  LDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAPGRE-ISESKLKDLLHGS  343

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDAIGLAPR+ EK ++RN
Sbjct  344  EYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDAIGLAPRSMEKCRNRN  397



>ref|XP_009380572.1| PREDICTED: auxin-responsive protein IAA21-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=292

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL+TY  Y+ELSSALEKMFSCFTIGQC SQG P R+ LSES+L D L+GS
Sbjct  179  MEGAPYLRKVDLKTYKDYRELSSALEKMFSCFTIGQCNSQGIPSRDGLSESRLMDLLNGS  238

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAIGLAPRA EK KSRN
Sbjct  239  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLAPRAMEKCKSRN  292



>ref|XP_002303297.1| auxin-responsive protein IAA27 [Populus trichocarpa]
 gb|EEE78276.1| auxin-responsive protein IAA27 [Populus trichocarpa]
Length=349

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS G  G++ L+ES+L+D LHGS
Sbjct  236  MDGAPYLRKVDLKTYSNYLELSSALEKMFSCFTIGQCGSHGLRGQDGLTESRLKDILHGS  295

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMF  SC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  296  EYVLTYEDKDGDWMLVGDVPWDMFTNSCRRLRIMKGSEAIGLAPRAMEKCKNRN  349



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M GAPYLRKVDL+TY++YQELSSALEKMFSCFT+GQCG++   G+E LSE+KLRD LHGS
Sbjct  261  MAGAPYLRKVDLKTYSAYQELSSALEKMFSCFTLGQCGAEEVSGKEMLSETKLRDLLHGS  320

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFIE+C++LKIMKGSDAIGLAPR+ EK K+R+
Sbjct  321  EYVLTYEDKDGDWMLVGDVPWEMFIETCRKLKIMKGSDAIGLAPRSVEKCKNRD  374



>ref|XP_006381732.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
 gb|ERP59529.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
Length=307

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+T+ SY ELSSALEKMFSCFTIGQCGS   PG++ LSES+L D LHGS
Sbjct  194  MDGAPYLRKVDLKTFGSYMELSSALEKMFSCFTIGQCGSHVVPGQDGLSESRLMDLLHGS  253

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKD DWMLVGDVPW MF +SC+RL+IMKGS+AIGLAPRA EK KSRN
Sbjct  254  EYVLTYEDKDNDWMLVGDVPWKMFTDSCRRLRIMKGSEAIGLAPRAMEKCKSRN  307



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS GA GRE LSESKL+D LHGS
Sbjct  252  MDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGS  311

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK +DAIGLAPRA EK ++RN
Sbjct  312  EFVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSTDAIGLAPRAVEKCRNRN  365



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score =   200 bits (509),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G  GRE LSESKL+D LHGS
Sbjct  217  MDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGTSGRELLSESKLKDLLHGS  276

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  277  EYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLAPRAMEKCRNRN  330



>gb|AFK35603.1| unknown [Lotus japonicus]
Length=114

 Score =   193 bits (491),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL ++++Y+ELSSALEKMFSCFTI QCG+ G   RENLSES+L D LHGS
Sbjct  1    MEGAPYLRKVDLNSFSTYRELSSALEKMFSCFTISQCGAYGVSSRENLSESRLMDLLHGS  60

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGLAPRA EK KSR 
Sbjct  61   EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRAMEKCKSRT  114



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL  Y++Y ELSSALEKMFSCFTI QCGS G  GRE L+E+KL+D LHGS
Sbjct  253  MDGAPYLRKVDLNNYSTYPELSSALEKMFSCFTISQCGSHGILGREMLNETKLKDLLHGS  312

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF E+CKRL+IMK SDAIGLAPR  EKSKSR
Sbjct  313  EYVLTYEDKDGDWMLVGDVPWEMFTETCKRLRIMKSSDAIGLAPRTVEKSKSR  365



>ref|XP_009388718.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS G PGR+ LSES+L D L+GS
Sbjct  197  MDGAPYLRKVDLKAYNNYKELSSALEKMFSCFTIGQCGSHGIPGRDGLSESRLTDLLNGS  256

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF  SCKR++IMKGSDAIGLAPRA EK K+R
Sbjct  257  EYVLTYEDKDGDWMLVGDVPWEMFTNSCKRMRIMKGSDAIGLAPRAMEKCKNR  309



>ref|XP_009421456.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=311

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS G P ++ LSES+L D L+GS
Sbjct  198  MDGAPYLRKVDLKIYKNYKELSSALEKMFSCFTIGQCGSHGIPSKDGLSESRLMDLLNGS  257

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAIGLAPRA EK K+RN
Sbjct  258  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLAPRAMEKCKNRN  311



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS GA GRE LSESKL+D LHGS
Sbjct  252  MDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGS  311

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW+MFI +CKRL+IMK +DAIGLAPRA EK ++RN
Sbjct  312  EFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDAIGLAPRAVEKCRNRN  365



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G  GRE LSESKL+D LHGS
Sbjct  244  MDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGTSGRELLSESKLKDLLHGS  303

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  304  EYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLAPRAMEKCRNRN  357



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G  GRE LSESKL+D LHGS
Sbjct  244  MDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGTSGRELLSESKLKDLLHGS  303

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  304  EYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLAPRAMEKCRNRN  357



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G  GRE LSESKL+D LHGS
Sbjct  244  MDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGTSGRELLSESKLKDLLHGS  303

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  304  EYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLAPRAMEKCRNRN  357



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS GA GRE LSESKL+D LHGS
Sbjct  252  MDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGS  311

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW+MFI +CKRL+IMK +DAIGLAPRA EK ++RN
Sbjct  312  EFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDAIGLAPRAVEKCRNRN  365



>gb|ABK24636.1| unknown [Picea sitchensis]
Length=390

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y  YQELSSALEKMFS FTIGQ GS G PGR+ LSESKL D LHGS
Sbjct  277  MDGAPYLRKVDLKMYNRYQELSSALEKMFSGFTIGQYGSHGIPGRDGLSESKLMDLLHGS  336

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF++SCKRL+IMKGSDAIGLAPRA EK KSR+
Sbjct  337  EYVLTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSDAIGLAPRAMEKCKSRS  390



>ref|XP_002284118.1| PREDICTED: auxin-responsive protein IAA27 [Vitis vinifera]
Length=320

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS G P R+ LSES+L D LHGS
Sbjct  207  MDGAPYLRKVDLKLYSTYMELSSALEKMFSCFTIGQCGSNGVPIRDGLSESRLMDLLHGS  266

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIGLAPRA EK KSRN
Sbjct  267  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGLAPRAMEKCKSRN  320



>emb|CDY25617.1| BnaA04g13090D [Brassica napus]
Length=266

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  153  MDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGLHGAHGRERMSEVKLKDLLHGS  212

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMKGSD+IGLAP A EKSK+++
Sbjct  213  EFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKGSDSIGLAPSAVEKSKNKD  266



>ref|XP_009140376.1| PREDICTED: auxin-responsive protein IAA8 [Brassica rapa]
Length=266

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  153  MDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGLHGAHGRERMSEVKLKDLLHGS  212

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMKGSD+IGLAP A EKSK+++
Sbjct  213  EFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKGSDSIGLAPSAVEKSKNKD  266



>ref|XP_006833393.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
 gb|ERM98671.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
Length=347

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQ G  GAPGR+ L+ES+L D L+GS
Sbjct  234  MDGAPYLRKVDLKTYLTYTELSSALEKMFSCFTIGQYGPHGAPGRDGLTESRLMDLLNGS  293

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMFI SC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  294  EYVLTYEDKDGDWMLVGDVPWDMFIGSCRRLRIMKGSEAIGLAPRAMEKCKARN  347



>ref|XP_006451212.1| hypothetical protein CICLE_v10009070mg [Citrus clementina]
 ref|XP_006475666.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Citrus 
sinensis]
 gb|ESR64452.1| hypothetical protein CICLE_v10009070mg [Citrus clementina]
 gb|KDO66456.1| hypothetical protein CISIN_1g022618mg [Citrus sinensis]
Length=292

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY+SY +LSSALEKMFSCFTIGQC S   P R+ LSES+L D LHGS
Sbjct  179  MDGAPYLRKVDLKTYSSYIDLSSALEKMFSCFTIGQCSSHNVPSRDGLSESRLMDLLHGS  238

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK SDAIGLAPRA EK K+RN
Sbjct  239  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSDAIGLAPRAMEKCKNRN  292



>ref|XP_008783241.1| PREDICTED: auxin-responsive protein IAA17-like isoform X1 [Phoenix 
dactylifera]
Length=326

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS G PGR+ LSES+L D L+GS
Sbjct  213  MDGAPYLRKVDLKTYNNYKELSSALEKMFSCFTIGQCGSHGIPGRDGLSESRLMDLLNGS  272

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLAP A EK K+R+
Sbjct  273  EFVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLAPTAMEKCKNRS  326



>ref|XP_006294567.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27465.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=323

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  208  MDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGS  267

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGLAP A EKSK+++
Sbjct  268  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNKD  321



>gb|AFK38538.1| unknown [Lotus japonicus]
Length=318

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS G  GRE ++E+KL+D +HGS
Sbjct  205  MDGAPYLRKVDLKNYSTYAELSSALEKMFSCFTIGQCGSHGNMGREIMNETKLKDLIHGS  264

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E VLTYEDKDGDWMLVGDVPW MFI++C+RL+IMK SDAIGLAPRA EKSKSR+
Sbjct  265  ENVLTYEDKDGDWMLVGDVPWKMFIDTCRRLRIMKSSDAIGLAPRAVEKSKSRS  318



>ref|XP_007013106.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
 gb|EOY30725.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
Length=312

 Score =   197 bits (502),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS G P R+ LSES+L D LHGS
Sbjct  199  MDGAPYLRKVDLKFYGSYKELSSALEKMFSCFTIGQCGSHGVPSRDGLSESRLIDLLHGS  258

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGLAPRA EK K+R 
Sbjct  259  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRAMEKCKNRT  312



>ref|XP_007013107.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
 gb|EOY30726.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
Length=313

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS G P R+ LSES+L D LHGS
Sbjct  200  MDGAPYLRKVDLKFYGSYKELSSALEKMFSCFTIGQCGSHGVPSRDGLSESRLIDLLHGS  259

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGLAPRA EK K+R 
Sbjct  260  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRAMEKCKNRT  313



>ref|XP_011010527.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Populus 
euphratica]
Length=349

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS G  G++ L+ES+L+D LHGS
Sbjct  236  MDGAPYLRKVDLKTYSNYLELSSALEKMFSCFTIGQCGSNGLRGQDGLTESRLKDILHGS  295

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKD DWMLVGDVPWDMF +SC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  296  EYVLTYEDKDDDWMLVGDVPWDMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNRN  349



>gb|KDP37265.1| hypothetical protein JCGZ_06321 [Jatropha curcas]
Length=342

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS G PGR+ LSE+ L+D LHGS
Sbjct  230  MDGAPYLRKVDLKTYSNYVELSSALEKMFSCFTIGQCGS-GFPGRDGLSETCLKDLLHGS  288

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  289  EYVLTYEDKDGDWMLVGDVPWEMFTDTCRRLRIMKGSEAIGLAPRAMEKCKNRN  342



>gb|AEV89263.1| IAA9 [Musa acuminata AAA Group]
Length=314

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y+ELS ALEKMFSCFTIGQCGS G PGR+ LSES+L D L+GS
Sbjct  197  MDGAPYLRKVDLKAYNNYKELSPALEKMFSCFTIGQCGSHGIPGRDGLSESRLTDLLNGS  256

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF  SCKR++IMKGSDAIGLAPRA EK K+R
Sbjct  257  EYVLTYEDKDGDWMLVGDVPWEMFTNSCKRMRIMKGSDAIGLAPRAMEKCKNR  309



>ref|NP_179852.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 ref|NP_001077943.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 sp|Q38826.1|IAA8_ARATH RecName: Full=Auxin-responsive protein IAA8; AltName: Full=Indoleacetic 
acid-induced protein 8 [Arabidopsis thaliana]
 gb|AAG50092.1|AF334714_1 auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAC49049.1| IAA8 [Arabidopsis thaliana]
 gb|AAD15575.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL24387.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL49895.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM20092.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM47990.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM65174.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AEC07336.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07338.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=321

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  206  MDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGS  265

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGLAP A EKSK++
Sbjct  266  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNK  318



>ref|XP_006404728.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 ref|XP_006404729.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 dbj|BAJ33826.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46181.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 gb|ESQ46182.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
Length=334

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY SY +LSSALEKMFSCFT+GQCG  GA GRE LSE KL+D LHGS
Sbjct  215  MDGAPYLRKVDLRTYTSYPQLSSALEKMFSCFTLGQCGLHGAQGRERLSEIKLKDLLHGS  274

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIM GSD+IGLAPRA EKSK++
Sbjct  275  EFVLTYEDKDGDWMLVGDVPWEIFTETCRKLKIMTGSDSIGLAPRAMEKSKNK  327



>gb|KDO56957.1| hypothetical protein CISIN_1g019236mg [Citrus sinensis]
Length=344

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S G PG++ LSES+L D LHGS
Sbjct  231  MDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGS  290

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPWDMF E+C+RL+IMKGS+AIGLAPRA EK K+R
Sbjct  291  EYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNR  343



>ref|XP_006465643.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Citrus 
sinensis]
Length=346

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S G PG++ LSES+L D LHGS
Sbjct  233  MDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGS  292

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPWDMF E+C+RL+IMKGS+AIGLAPRA EK K+R
Sbjct  293  EYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNR  345



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS G  GRE LSESKL+D LHGS
Sbjct  255  MDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGTLGRELLSESKLKDLLHGS  314

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFI +CKRL+IMK SDAIGLAPRA EK ++RN
Sbjct  315  EYVLTYEDKDGDWMLVGDVPWVMFIGTCKRLRIMKSSDAIGLAPRAVEKCRNRN  368



>ref|NP_001189579.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07339.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=338

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  223  MDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGS  282

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGLAP A EKSK++
Sbjct  283  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNK  335



>ref|XP_010472259.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=326

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG  GA GRE +SE+KL+D LHGS
Sbjct  211  MDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSETKLKDLLHGS  270

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGLAP A EKSK+++
Sbjct  271  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNKD  324



>gb|AFK41855.1| unknown [Medicago truncatula]
Length=111

 Score =   190 bits (483),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y ELSS+LEKMFSCFTIGQC S G    + L+E+KLRD LHGS
Sbjct  1    MDGAPYLRKVDLKNYTAYSELSSSLEKMFSCFTIGQCESHG---NQMLNETKLRDLLHGS  57

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKDGDWMLVGDVPW+MFI++C+RL+IMK SDAIGLAPRA EKSKSRN
Sbjct  58   EYVITYEDKDGDWMLVGDVPWEMFIDTCRRLRIMKSSDAIGLAPRAVEKSKSRN  111



>ref|XP_008789309.1| PREDICTED: auxin-responsive protein IAA27-like [Phoenix dactylifera]
Length=318

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS G PGR+ LSES++ D L GS
Sbjct  205  LDGAPYLRKVDLKKYLNYKELSSALEKMFSCFTIGQCGSHGIPGRDGLSESRMMDLLQGS  264

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IM+GS+A+G+APRA EK KSRN
Sbjct  265  EYVLTYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEAVGIAPRAMEKCKSRN  318



>ref|XP_006426926.1| hypothetical protein CICLE_v10025988mg [Citrus clementina]
 gb|ESR40166.1| hypothetical protein CICLE_v10025988mg [Citrus clementina]
Length=344

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S G PG++ LSES+L D LHGS
Sbjct  231  MDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGS  290

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYED+DGDWMLVGDVPWDMF E+C+RL+IMKGS+AIGLAPRA EK K+R
Sbjct  291  EYVLTYEDRDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNR  343



>ref|XP_009381047.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y+E S ALEKMFS FTIGQCGS G PGR+ LSES+L DFL GS
Sbjct  196  MDGAPYLRKVDLKTYSNYKEFSLALEKMFSGFTIGQCGSHGIPGRDGLSESRLMDFLSGS  255

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYED+DGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLAPRA EK ++RN
Sbjct  256  EYVLTYEDRDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAMEKCRNRN  309



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALE MFSCFTIG CGS G  G E L+E+KL+D LHGS
Sbjct  254  MDGAPYLRKVDLKNYSAYAELSSALENMFSCFTIGSCGSHGNLGGEVLNETKLKDLLHGS  313

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTY+DKDGDWMLVGDVPW+MFIE+CKRL+IMK S+AIGLAPRA EKSK RN
Sbjct  314  EYVLTYKDKDGDWMLVGDVPWEMFIETCKRLRIMKSSEAIGLAPRAVEKSKRRN  367



>emb|CDX89499.1| BnaC04g35180D [Brassica napus]
Length=271

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  158  MDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGLHGAHGRERMSEVKLKDLLHGS  217

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMK SD+IGLAP A EKSK+++
Sbjct  218  EFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKSSDSIGLAPSAVEKSKNKD  271



>ref|XP_010917562.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS   PGR+ LSES++ D L GS
Sbjct  205  MDGAPYLRKVDLKTYLNYKELSSALEKMFSCFTIGQCGSHEIPGRDGLSESRMMDLLQGS  264

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IM+GS+A+G+APRA EK KSRN
Sbjct  265  EYVLTYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEAVGIAPRAMEKCKSRN  318



>gb|AEQ94167.1| auxin induced family protein [Elaeis guineensis]
Length=124

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS G P R+ L ES+L D L+GS
Sbjct  11   MDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSHGIPCRDGLFESRLMDLLNGS  70

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWML GDVPW+MF +SC+RL+IMKGSDAIGLAPRA EK K+R+
Sbjct  71   EYVLTYEDKDGDWMLFGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAMEKCKNRD  124



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS GAPGRE LSESKL+D LHGS
Sbjct  237  MDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGSHGAPGREMLSESKLKDLLHGS  296

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  401
            EYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  297  EYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  338



>ref|XP_011009359.1| PREDICTED: auxin-responsive protein IAA27-like [Populus euphratica]
Length=347

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMF CFTIGQCGS G P R+ L+ES L+D LHGS
Sbjct  235  MDGAPYLRKVDLKTYGNYVELSSALEKMFGCFTIGQCGSHGLPARDGLTESCLKD-LHGS  293

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMF +SC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  294  EYVLTYEDKDGDWMLVGDVPWDMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNRN  347



>ref|XP_009612337.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=315

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y SY +LSSALEKMFSCFTIGQCG++G P R+ L+ES+L D LHGS
Sbjct  203  MDGAPYLRKVDLKIYKSYNDLSSALEKMFSCFTIGQCGTEGIPIRDGLTESRLMDLLHGS  262

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF  SCKRLKIMK SDAIGLAPRA EK K+R
Sbjct  263  EYVLTYEDKDGDWMLVGDVPWEMFTGSCKRLKIMKSSDAIGLAPRAMEKYKNR  315



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFT+ +CGS G  GRE L+E+KL+D LHGS
Sbjct  248  MDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTMSKCGSHGILGREMLNETKLKDLLHGS  307

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYED++GDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLAPRA EK KSR
Sbjct  308  EYVLTYEDREGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAVEKCKSR  360



>emb|CDP03299.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++ Y+SY++LSSALEKMFSCFTIGQCGS G   R+ +SES+L D LHGS
Sbjct  224  MDGAPYLRKVDIKIYSSYKDLSSALEKMFSCFTIGQCGSHGVHIRDGMSESRLMDLLHGS  283

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF++SCKRL+IMK SDAIGLAPRA EK K+RN
Sbjct  284  EYVLTYEDKDGDWMLVGDVPWEMFMDSCKRLRIMKSSDAIGLAPRAMEKCKNRN  337



>ref|XP_007152862.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
 gb|ESW24856.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
Length=307

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ + +Y ELSSALEKMF+CFTI QCGS G  GR+ LSES+L D LHGS
Sbjct  194  MDGAPYLRKVDLKIFGTYMELSSALEKMFTCFTISQCGSHGVSGRDKLSESRLMDLLHGS  253

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGLAPRA EK KSRN
Sbjct  254  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRAMEKCKSRN  307



>ref|XP_010429195.1| PREDICTED: auxin-responsive protein IAA8 [Camelina sativa]
Length=326

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  211  MDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGS  270

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGLAP A EKSK+++
Sbjct  271  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNKD  324



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+PG+E LSESKL+D LHGS
Sbjct  263  MDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGSPGKEILSESKLKDLLHGS  322

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  398
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGLA
Sbjct  323  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGLA  365



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y +LSSALE MFSCFTIG CGS G  G E L+E+KL+D LHGS
Sbjct  253  MDGAPYLRKVDLKNYNAYADLSSALENMFSCFTIGSCGSHGNLGGEVLNETKLKDLLHGS  312

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF E+CKRL+IMK S+AIGLAPRA EKSKSRN
Sbjct  313  EYVLTYEDKDGDWMLVGDVPWEMFTETCKRLRIMKSSEAIGLAPRAVEKSKSRN  366



>ref|XP_010417025.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=327

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  212  MDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGS  271

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGLAP A EKSK+++
Sbjct  272  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNKD  325



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSS+LEKMFS FTIGQCGS G PGRE L+ESKLRDFLHGS
Sbjct  264  MDGAPYLRKVDLRNYSTYQELSSSLEKMFSGFTIGQCGSNGTPGREMLNESKLRDFLHGS  323

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  401
            EYVLTYEDKDGDWMLVGDVPW+MFIESCKRLKIMKG+DAIGL
Sbjct  324  EYVLTYEDKDGDWMLVGDVPWEMFIESCKRLKIMKGADAIGL  365



>ref|XP_008802939.1| PREDICTED: auxin-responsive protein IAA17-like [Phoenix dactylifera]
Length=320

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS G P R+ LSES+L D L+GS
Sbjct  207  MDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSHGIPCRDGLSESRLMDLLNGS  266

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLAPRA EK K+R+
Sbjct  267  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAMEKCKNRD  320



>ref|XP_010925905.1| PREDICTED: auxin-responsive protein IAA17-like [Elaeis guineensis]
Length=323

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS G P R+ LSES+L D L+GS
Sbjct  210  MDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSHGIPCRDGLSESRLMDLLNGS  269

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLAPRA EK K+R+
Sbjct  270  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAMEKCKNRD  323



>ref|XP_008462174.1| PREDICTED: auxin-responsive protein IAA27-like [Cucumis melo]
Length=356

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL+ Y++Y ELS ALEKMFSCFTIGQCG++G P +E LSES  +DFLHGS
Sbjct  243  MEGAPYLRKVDLKLYSNYSELSLALEKMFSCFTIGQCGTEGHPTKERLSESNSKDFLHGS  302

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLT EDKDGDWMLVGDVPW+MF ESC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  303  EYVLTCEDKDGDWMLVGDVPWEMFTESCRRLRIMKGSEAIGLAPRATEKCKNRN  356



>ref|XP_004141756.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 ref|XP_004158995.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 gb|KGN45391.1| hypothetical protein Csa_7G447060 [Cucumis sativus]
Length=356

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL+ Y++Y ELS ALEKMFSCFTIGQCG++G P +E LSES  +DFLHGS
Sbjct  243  MEGAPYLRKVDLKLYSNYSELSLALEKMFSCFTIGQCGTEGLPTKERLSESNSKDFLHGS  302

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLT EDKDGDWMLVGDVPW+MF ESC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  303  EYVLTCEDKDGDWMLVGDVPWEMFTESCRRLRIMKGSEAIGLAPRATEKCKNRN  356



>ref|XP_011464769.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ  S GA GRE +SESKL+D LHGS
Sbjct  219  MDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIGQYVSHGARGRE-ISESKLKDLLHGS  277

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI +CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  278  EYVLTYEDKDGDWMLVGDVPWEMFINTCKRMRIMKSSDAIGLAPRAMEKCRNRN  331



>ref|XP_009416499.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y+ELS ALEKMF+CFTIGQCGS G  GRE L+E ++ D L GS
Sbjct  161  MDGAPYLRKVDLKTYSNYKELSLALEKMFTCFTIGQCGSYGMTGREILTEGRVMDLLLGS  220

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIG+APRA EKSKSRN
Sbjct  221  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGIAPRAMEKSKSRN  274



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ  S GA GRE +SESKL+D LHGS
Sbjct  244  MDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIGQYVSHGARGRE-ISESKLKDLLHGS  302

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI +CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  303  EYVLTYEDKDGDWMLVGDVPWEMFINTCKRMRIMKSSDAIGLAPRAMEKCRNRN  356



>ref|XP_007024229.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
 gb|EOY26851.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
Length=339

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S G P R+ L+ES+L D LHGS
Sbjct  226  MDGAPYLRKVDLKTYKNYTELSSALEKMFSCFTIGQCSSHGLPVRDGLTESRLMDLLHGS  285

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EK K++
Sbjct  286  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNQ  338



>ref|XP_003534212.1| PREDICTED: auxin-responsive protein IAA27 [Glycine max]
 gb|KHN45622.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=307

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ + +Y ELSSALEKMFSCFTI QCGS G  GR+ L+E++L D LHGS
Sbjct  194  MDGAPYLRKVDLKNFGTYMELSSALEKMFSCFTISQCGSHGVCGRDKLTENRLMDLLHGS  253

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGLAPRA EK KSRN
Sbjct  254  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRAMEKCKSRN  307



>ref|XP_010924571.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS G PGR+ L ES++ D L GS
Sbjct  205  MDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGSHGIPGRDGLGESRMMDLLQGS  264

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+A G+APRA EK KSR+
Sbjct  265  EYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEATGIAPRAMEKCKSRS  318



>ref|XP_007160318.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
 gb|ESW32312.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
Length=291

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG-APGRENLSESKLRDFLHG  530
            M+GAPYLRKVDL ++ +Y+ELS ALEKMFSCFTI QCGS G + GRENLSES+L D LHG
Sbjct  177  MEGAPYLRKVDLNSFGTYKELSLALEKMFSCFTISQCGSYGVSSGRENLSESRLMDLLHG  236

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYVLTYED+DGDWMLVGDVPW+MF ESCKRL+IMK S+AIGLAPRA EK KSRN
Sbjct  237  SEYVLTYEDRDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAVEKCKSRN  291



>ref|XP_009771095.1| PREDICTED: auxin-responsive protein IAA8-like, partial [Nicotiana 
sylvestris]
Length=277

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MD APYLRKVDLR Y SY +LS ALEKMFSCFTIGQCG++G P R+ L+ES+L D LHGS
Sbjct  165  MDDAPYLRKVDLRIYKSYNDLSLALEKMFSCFTIGQCGTEGIPIRDGLTESRLMDLLHGS  224

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK SDAIGLAPRA EK K+R
Sbjct  225  EYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSDAIGLAPRAMEKYKNR  277



>ref|XP_008462746.1| PREDICTED: auxin-responsive protein IAA27 [Cucumis melo]
Length=307

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY +LSSALEKMFS FTIG CGS G P R+ L+ES+L D LHGS
Sbjct  194  MDGAPYLRKVDLKTYVSYVDLSSALEKMFSSFTIGHCGSNGVPNRDALNESRLMDLLHGS  253

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ESC R++IMK S+AIGLAPRA EK K+RN
Sbjct  254  EYVLTYEDKDGDWMLVGDVPWEMFTESCTRMRIMKSSEAIGLAPRAMEKCKNRN  307



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 103/117 (88%), Gaps = 4/117 (3%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            +DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS GAPGRE +SESKL+D LHGS
Sbjct  251  LDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTIGQYGSHGAPGRE-ISESKLKDLLHGS  309

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL---APRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPWDMF ++CKRL+IMK SDAIGL    PRA EK ++RN
Sbjct  310  EYVLTYEDKDGDWMLVGDVPWDMFTDTCKRLRIMKSSDAIGLGAHTPRAMEKCRNRN  366



>ref|XP_009617338.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=285

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++TY +Y ELSSALEKMFSCFTIGQC S G PGRE LSES+L D L+GS
Sbjct  170  MDGAPYLRKVDVKTYTNYAELSSALEKMFSCFTIGQCTSDGLPGREGLSESRLMDLLNGS  229

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRA  + K++
Sbjct  230  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRAISRCKNQ  282



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENL-SESKLRDFLHG  530
            MDGAPYLRKVDL+ Y +Y +LSSALEKMFSCFTIGQC S G  GRE + +E+KLRD LHG
Sbjct  248  MDGAPYLRKVDLKNYTAYSQLSSALEKMFSCFTIGQCESHGNLGREMMMNETKLRDLLHG  307

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYV+TYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDAIGLAPRA EK+KSRN
Sbjct  308  SEYVITYEDKDGDWMLVGDVPWVMFIDTCKRLRIMKSSDAIGLAPRAVEKNKSRN  362



>ref|XP_010527157.1| PREDICTED: auxin-responsive protein IAA8, partial [Tarenaya hassleriana]
Length=354

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY+ELSSALEKMFSCFT+GQ    G PGRE LSE KL+D LH S
Sbjct  241  MDGAPYLRKVDLKTYTSYKELSSALEKMFSCFTLGQYRPHGIPGRERLSEIKLKDLLHRS  300

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKS  371
            EYVLTYEDKDGDWMLVGDVPW+MF+E+C++LKIMKGSDAIGLAPR  EKSK+
Sbjct  301  EYVLTYEDKDGDWMLVGDVPWEMFMETCRKLKIMKGSDAIGLAPRETEKSKN  352



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAPGRE LSESKL+D LHGS
Sbjct  246  MDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGS  305

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  398
            EYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGLA
Sbjct  306  EYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGLA  348



>ref|XP_009786555.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=269

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++TY+ Y ELSSALEKMFSCF+IGQC S G PG+E LSES L D L+GS
Sbjct  156  MDGAPYLRKVDIKTYSDYGELSSALEKMFSCFSIGQCASDGLPGQEELSESHLMDLLNGS  215

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRA  K K++N
Sbjct  216  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRAIHKCKNKN  269



>gb|KHG03466.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=310

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS G  G + LSES+L D LHGS
Sbjct  197  MDGAPYLRKVDLKIYGSYKELSSALEKMFSCFTIGQCGSHGVSGGDGLSESRLIDLLHGS  256

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK ++AIGLAPRA EK K+R 
Sbjct  257  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSTEAIGLAPRAMEKCKNRT  310



>ref|XP_006475665.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Citrus 
sinensis]
 gb|KDO66455.1| hypothetical protein CISIN_1g022618mg [Citrus sinensis]
Length=294

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTI--GQCGSQGAPGRENLSESKLRDFLH  533
            MDGAPYLRKVDL+TY+SY +LSSALEKMFSCFTI  GQC S   P R+ LSES+L D LH
Sbjct  179  MDGAPYLRKVDLKTYSSYIDLSSALEKMFSCFTIVSGQCSSHNVPSRDGLSESRLMDLLH  238

Query  532  GSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK SDAIGLAPRA EK K+RN
Sbjct  239  GSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSDAIGLAPRAMEKCKNRN  294



>ref|XP_002878628.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54887.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQ G  GA GRE +SE KL+D LHGS
Sbjct  198  MDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQYGLHGAQGRERMSEIKLKDLLHGS  257

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGLAP A EKSK++
Sbjct  258  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNK  310



>ref|XP_008793078.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Phoenix 
dactylifera]
Length=318

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS G P R+ L ES++ D L GS
Sbjct  205  MDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGSHGIPSRDGLGESRMMDLLQGS  264

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+AIG+APR  EK KSR+
Sbjct  265  EYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEAIGIAPRVMEKCKSRS  318



>gb|AFK49596.1| unknown [Medicago truncatula]
Length=293

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRE-NLSESKLRDFLHG  530
            M+GAPYLRKVDL  ++SY+ELSSALEKMFSCFTI QCGS G   RE NLSES+L D LHG
Sbjct  179  MEGAPYLRKVDLNGFSSYRELSSALEKMFSCFTISQCGSYGVSCREKNLSESRLVDLLHG  238

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK S+AIGLAPRA EK KSRN
Sbjct  239  SEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSRN  293



>gb|KCW69643.1| hypothetical protein EUGRSUZ_F03050 [Eucalyptus grandis]
Length=340

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY SY ELS+ALEKMFSCFTIG C S+G  G+E+LSES+L D L+GS
Sbjct  227  MDGAPYLRKVDLRTYGSYSELSTALEKMFSCFTIGHCDSRGPLGQESLSESRLADLLNGS  286

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK S+AIGLAPRA EK KSR+
Sbjct  287  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSEAIGLAPRATEKCKSRD  340



>ref|XP_003630761.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AET05237.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=293

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRE-NLSESKLRDFLHG  530
            M+GAPYLRKVDL  ++SY+ELSSALEKMFSCFTI QCGS G   RE NLSES+L D LHG
Sbjct  179  MEGAPYLRKVDLNGFSSYRELSSALEKMFSCFTISQCGSYGVSCREKNLSESRLVDLLHG  238

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK S+AIGLAPRA EK KSRN
Sbjct  239  SEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSRN  293



>ref|XP_009406220.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=279

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TYA+Y+ELS AL KMF+CFTIGQCG+ G   RE L+E ++ D L GS
Sbjct  166  MDGAPYLRKVDLKTYANYKELSLALAKMFTCFTIGQCGAHGMSSRETLTEGRVMDLLQGS  225

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKD DWMLVGDVPWDMF +SC+RL+IMKGSDAIG+APRA EKSKS+N
Sbjct  226  EYVLTYEDKDSDWMLVGDVPWDMFTDSCRRLRIMKGSDAIGIAPRAMEKSKSQN  279



>gb|KEH27147.1| auxin response factor [Medicago truncatula]
Length=254

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ + +Y+ELSSALEKMFSCFTI Q GS G  G+ N+ ES+L D LHGS
Sbjct  141  MDGAPYLRKVDLKIFGTYKELSSALEKMFSCFTISQFGSHGVFGQGNVCESRLMDLLHGS  200

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFI+SCKRL+IMK S+AIGLAPRA EK KSRN
Sbjct  201  EYVLTYEDKDGDWMLVGDVPWKMFIDSCKRLRIMKSSEAIGLAPRAMEKCKSRN  254



>ref|XP_009130522.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=193

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELS ALEKMF+ FT+GQCG+ GA G++ L E+KL+D L+G 
Sbjct  80   MDGAPYLRKVDLRSYTNYMELSLALEKMFTTFTLGQCGANGAAGKDKLCETKLKDLLNGK  139

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDAIGLAPRA EKSK R
Sbjct  140  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDAIGLAPRAMEKSKMR  192



>gb|AFK45766.1| unknown [Medicago truncatula]
Length=254

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ + +Y+ELSSALEKMFSCFTI Q GS G  G+ N+ ES+L DFLHGS
Sbjct  141  MDGAPYLRKVDLKIFGTYKELSSALEKMFSCFTISQFGSHGVFGQGNVCESRLMDFLHGS  200

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFI+SCKRL+IMK  +AIGLAPRA EK KSRN
Sbjct  201  EYVLTYEDKDGDWMLVGDVPWKMFIDSCKRLRIMKSFEAIGLAPRAMEKCKSRN  254



>ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula]
 gb|AES98348.1| auxin response factor [Medicago truncatula]
Length=347

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y ELSS+LEKMFSCFTIGQC S G    + L+E+KLRD LHGS
Sbjct  237  MDGAPYLRKVDLKNYTAYSELSSSLEKMFSCFTIGQCESHG---NQMLNETKLRDLLHGS  293

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKDGDWMLVGDVPW+MFI++C+RL+IMK SDAIGLAPRA EKSKSRN
Sbjct  294  EYVITYEDKDGDWMLVGDVPWEMFIDTCRRLRIMKSSDAIGLAPRAVEKSKSRN  347



>gb|KHN16618.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=283

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G   RENLSES+L D LHGS
Sbjct  170  MEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGS  229

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK S+AIGLAPRA EK KSR
Sbjct  230  EYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSR  282



>ref|NP_001239808.1| uncharacterized protein LOC100778529 [Glycine max]
 gb|ACU23444.1| unknown [Glycine max]
Length=287

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G   RENLSES+L D LHGS
Sbjct  174  MEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGS  233

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK  +AIGLAPRA EK KSRN
Sbjct  234  EYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSFEAIGLAPRAMEKCKSRN  287



>gb|KHN41649.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=287

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G   RENLSES+L D LHGS
Sbjct  174  MEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGS  233

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK  +AIGLAPRA EK KSRN
Sbjct  234  EYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSFEAIGLAPRAMEKCKSRN  287



>ref|XP_002298231.1| hypothetical protein POPTR_0001s18680g [Populus trichocarpa]
 gb|EEE83036.1| hypothetical protein POPTR_0001s18680g [Populus trichocarpa]
Length=335

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMF CFTIGQCGS G   R+ L+ES L+D LHGS
Sbjct  223  MDGAPYLRKVDLKTYGNYLELSSALEKMFGCFTIGQCGSHGLAARDGLTESCLKD-LHGS  281

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLT+EDKDGDWMLVGDVPWDMF +SC+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  282  EYVLTFEDKDGDWMLVGDVPWDMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNRN  335



>ref|XP_009793769.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=298

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++ Y +Y ELSSALEKMFSCFTIGQC S G PGRE LSES L D L+GS
Sbjct  183  MDGAPYLRKVDVKIYTNYAELSSALEKMFSCFTIGQCTSDGLPGREGLSESHLMDLLNGS  242

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRA  K K++
Sbjct  243  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRAISKCKNQ  295



>gb|KHG27397.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=237

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELSSALEKMF+CFT+G C S G   R+ LSES+L D LHGS
Sbjct  124  MDGAPYLRKVDLKTYKTYMELSSALEKMFTCFTLGHCSSNGLAVRDGLSESRLMDLLHGS  183

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI SCKRL+I+KGS+AIGLAPRA EK K+++
Sbjct  184  EYVLTYEDKDGDWMLVGDVPWEMFINSCKRLRIVKGSEAIGLAPRAMEKCKNQS  237



>ref|NP_569017.2| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 gb|AED98085.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=336

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  223  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  282

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGLAPRA EKSK R
Sbjct  283  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAPRAMEKSKMR  335



>ref|NP_850028.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07337.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=319

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA GRE +SE KL+D LHGS
Sbjct  206  MDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGS  265

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            E+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL    K K+K R
Sbjct  266  EFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLGAVEKSKNKER  318



>gb|KJB54240.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
 gb|KJB54245.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
Length=310

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS G    + L+ES+L D LHGS
Sbjct  197  MDGAPYLRKVDLKIYGSYKELSSALEKMFSCFTIGQCGSHGVSSGDGLTESRLVDLLHGS  256

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK ++AIGLAPRA EK K+R 
Sbjct  257  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSTEAIGLAPRAMEKCKNRT  310



>ref|XP_006584572.1| PREDICTED: uncharacterized protein LOC100795749 isoform X1 [Glycine 
max]
Length=357

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G   RENLSES+L D LHGS
Sbjct  244  MEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGS  303

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK S+AIGLAPRA EK KSR
Sbjct  304  EYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSR  356



>gb|AEI70506.1| auxin-responsive protein [Gossypium hirsutum]
Length=332

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 4/114 (4%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+E SSALEKMFSCFTIGQCGS G    + LSES+L D LHGS
Sbjct  223  MDGAPYLRKVDLKTYNNYREFSSALEKMFSCFTIGQCGSNG----DGLSESRLMDLLHGS  278

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EK K++N
Sbjct  279  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNQN  332



>ref|XP_006343091.1| PREDICTED: auxin-responsive protein IAA27-like [Solanum tuberosum]
Length=278

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++TY++Y ELSSALEKMFSCF+IGQC S   PG+E LSES L D L+GS
Sbjct  165  MDGAPYLRKVDIKTYSNYAELSSALEKMFSCFSIGQCASDRLPGQEKLSESHLMDLLNGS  224

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRA  K K++N
Sbjct  225  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRAINKCKNQN  278



>gb|KJB18638.1| hypothetical protein B456_003G064200 [Gossypium raimondii]
Length=237

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+E+SSALEKMF+CFT+G C S G   R+ LSES+L D LHGS
Sbjct  124  MDGAPYLRKVDLKTYKTYKEISSALEKMFTCFTLGHCSSNGLAVRDGLSESRLMDLLHGS  183

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+I+KGS+AIGLAPRA EK K+++
Sbjct  184  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIVKGSEAIGLAPRAMEKCKNQS  237



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+PG+E LSESKL+D LHGS
Sbjct  263  MDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGSPGKEILSESKLKDLLHGS  322

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  407
            EYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAI
Sbjct  323  EYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAI  362



>gb|KHG09793.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=332

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 4/114 (4%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+E SSALEKMFSCFTIGQCGS G    + LSES+L D LHGS
Sbjct  223  MDGAPYLRKVDLKTYNNYREFSSALEKMFSCFTIGQCGSNG----DGLSESRLMDLLHGS  278

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EK K++N
Sbjct  279  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNQN  332



>ref|XP_006394000.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31286.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=337

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+ GA G++ LSE+KL+D L+G 
Sbjct  224  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGTNGATGKDMLSETKLKDLLNGK  283

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGLAPRA EKSK R
Sbjct  284  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAPRAMEKSKMR  336



>ref|XP_010526458.1| PREDICTED: auxin-responsive protein IAA27 [Tarenaya hassleriana]
Length=296

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRK+DL+ Y SY ELSSALEKMFSCF IGQ GS G  GR+ L+ES+L D L GS
Sbjct  183  MEGAPYLRKIDLKMYKSYVELSSALEKMFSCFKIGQFGSHGGSGRDGLNESRLSDLLRGS  242

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRA EKS+SRN
Sbjct  243  EYVVTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRAMEKSRSRN  296



>gb|KJB18140.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=403

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G  G+E LSES+L+D LHGS
Sbjct  256  MDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSNGTAGKETLSESRLKDLLHGS  315

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL      +S  +N
Sbjct  316  EYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGLGNYLVSRSLPKN  369



>gb|KJB56779.1| hypothetical protein B456_009G135900 [Gossypium raimondii]
Length=332

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 4/114 (4%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+E SSALEKMFSCFTIGQCGS G    + LSES+L D LHGS
Sbjct  223  MDGAPYLRKVDLKTYNNYREFSSALEKMFSCFTIGQCGSNG----DGLSESRLMDLLHGS  278

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EK K++N
Sbjct  279  EYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNQN  332



>ref|XP_008228477.1| PREDICTED: auxin-responsive protein IAA27-like [Prunus mume]
Length=343

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y ELS ALEKMFSCFTIGQC S G P R+ LS S+L D LHGS
Sbjct  230  MDGAPYLRKVDLKTYNNYTELSMALEKMFSCFTIGQCSSNGIPERDGLSASRLMDLLHGS  289

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            E+VLTYEDKD DWMLVGDVPW MF E+C+RL+IMKGS+AIGLAPRA EK K+RN
Sbjct  290  EFVLTYEDKDDDWMLVGDVPWKMFTETCRRLRIMKGSEAIGLAPRAVEKCKNRN  343



>ref|XP_009614298.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=269

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++TY++Y ELSSALEKMFSCF+IGQC S   PG+E LSES L D ++GS
Sbjct  156  MDGAPYLRKVDIKTYSNYGELSSALEKMFSCFSIGQCTSDRLPGQEELSESHLMDLVNGS  215

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRAK K K++
Sbjct  216  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRAKNKCKNQ  268



>ref|XP_004150556.1| PREDICTED: auxin-responsive protein IAA27-like [Cucumis sativus]
 gb|KGN65095.1| hypothetical protein Csa_1G207820 [Cucumis sativus]
Length=306

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY +LSSALEKMFS FTIG  GS G P R+ L+ES+L D LHGS
Sbjct  193  MDGAPYLRKVDLKTYVSYVDLSSALEKMFSSFTIGHYGSNGVPNRDALNESRLMDLLHGS  252

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ESC R++IMK S+AIGLAPRA EK K+RN
Sbjct  253  EYVLTYEDKDGDWMLVGDVPWEMFTESCTRMRIMKSSEAIGLAPRAMEKCKNRN  306



>gb|ABI36497.1| AUX/IAA27 B [Malus domestica]
 gb|ABI36498.1| AUX/IAA27 C [Malus domestica]
 gb|ABI36499.1| AUX/IAA27 D [Malus domestica]
 gb|ABI36500.1| AUX/IAA27 E [Malus domestica]
Length=115

 Score =   183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAP+LRKVDL+TY SY ELS ALEKMFSCFTIG CGS GA  R+ LSES+L D LHG+
Sbjct  3    MDGAPFLRKVDLKTYGSYLELSLALEKMFSCFTIGHCGSHGAS-RDGLSESRLMDLLHGA  61

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+A+GLAPRA +K K+ N
Sbjct  62   EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAMGLAPRAMQKCKNSN  115



>ref|NP_001266034.1| IAA6 protein [Solanum lycopersicum]
 gb|AEX00366.1| IAA27 [Solanum lycopersicum]
Length=278

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++TY++Y  LSSALEKMFSCF+IGQC S   PG+E LSES L D L+GS
Sbjct  165  MDGAPYLRKVDIKTYSNYAALSSALEKMFSCFSIGQCASDKIPGQEKLSESHLMDLLNGS  224

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRA  K K++N
Sbjct  225  EYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRAINKCKNQN  278



>ref|XP_009390697.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIG CGS G P  + LSES L D L+GS
Sbjct  199  MDGAPYLRKVDLKMYDNYKELSSALEKMFSCFTIGPCGSHGIPNSDGLSESHLMDLLNGS  258

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGSDAIGLAPRA EK K+ N
Sbjct  259  EYVLTYEDKDGDWMLVGDVPWEMFTDTCRRLRIMKGSDAIGLAPRAMEKCKNWN  312



>ref|XP_004503453.1| PREDICTED: auxin-responsive protein IAA27-like [Cicer arietinum]
Length=302

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRE-NLSESKLRDFLHG  530
            M+GAPYLRKVDL  ++SY+ELSSALEKMFSCFTI QC S G   RE NLSES+L D LHG
Sbjct  188  MEGAPYLRKVDLNNFSSYRELSSALEKMFSCFTISQCSSYGISCREKNLSESRLIDLLHG  247

Query  529  SEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            SEYVLTYEDKDGDWMLVGDVPW+MF ESCK+L+IMK S+AIGLAPRA EK KSRN
Sbjct  248  SEYVLTYEDKDGDWMLVGDVPWEMFTESCKKLRIMKSSEAIGLAPRAMEKCKSRN  302



>ref|XP_010521483.1| PREDICTED: auxin-responsive protein IAA27-like isoform X3 [Tarenaya 
hassleriana]
Length=239

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS    G+  ++E  L+D LHGS
Sbjct  126  MDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGSHETSGKGAINEGNLKDLLHGS  185

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDAIGLAPRA EK +SRN
Sbjct  186  EYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDAIGLAPRAMEKCRSRN  239



>gb|ABI36496.1| AUX/IAA26 [Malus domestica]
Length=115

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAP+LRKVDL+TY SY ELS ALEKMFSCFTIG CGS GA  R+ LSES+L D LHG+
Sbjct  3    MDGAPFLRKVDLKTYGSYLELSLALEKMFSCFTIGHCGSHGAS-RDGLSESRLMDLLHGA  61

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MF +SCKR++IMK S+A+GLAPRA +K K+ N
Sbjct  62   EYVLTYEDKDGDWMLVGDVPWXMFTDSCKRMRIMKSSEAMGLAPRAMQKCKNSN  115



>ref|XP_009409066.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y E S ALEKMFS FTIGQCGS   P R+ LSES+L D L GS
Sbjct  209  MDGAPYLRKVDLKTYNNYNEFSVALEKMFSGFTIGQCGSHAIPSRDGLSESRLMDLLSGS  268

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLT EDKDGDWMLVGDVPW+MFI+SC+RL+IMKGSDAIGLAPRA EK K+RN
Sbjct  269  EYVLTCEDKDGDWMLVGDVPWEMFIDSCRRLRIMKGSDAIGLAPRAMEKCKNRN  322



>ref|XP_010098105.1| Auxin-responsive protein IAA27 [Morus notabilis]
 gb|EXB74542.1| Auxin-responsive protein IAA27 [Morus notabilis]
Length=344

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+T  +Y+ELS ALEKMFSCFTIGQCG+ G P R+ L+ES+L D LHGS
Sbjct  231  MDGAPYLRKVDLKTCTNYRELSLALEKMFSCFTIGQCGASGLPERKGLTESRLMDLLHGS  290

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKD DWMLVGDVPWDMF ++C+RL+IMKGS+AIGLAPRA EK K++N
Sbjct  291  EYVVTYEDKDEDWMLVGDVPWDMFTDTCRRLRIMKGSEAIGLAPRAMEKCKNQN  344



>gb|KJB18635.1| hypothetical protein B456_003G064200 [Gossypium raimondii]
Length=330

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+E+SSALEKMF+CFT+G C S G   R+ LSES+L D LHGS
Sbjct  217  MDGAPYLRKVDLKTYKTYKEISSALEKMFTCFTLGHCSSNGLAVRDGLSESRLMDLLHGS  276

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+I+KGS+AIGLAPRA EK K+++
Sbjct  277  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIVKGSEAIGLAPRAMEKCKNQS  330



>gb|KJB18637.1| hypothetical protein B456_003G064200 [Gossypium raimondii]
Length=344

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY +Y+E+SSALEKMF+CFT+G C S G   R+ LSES+L D LHGS
Sbjct  231  MDGAPYLRKVDLKTYKTYKEISSALEKMFTCFTLGHCSSNGLAVRDGLSESRLMDLLHGS  290

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+I+KGS+AIGLAPRA EK K+++
Sbjct  291  EYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIVKGSEAIGLAPRAMEKCKNQS  344



>ref|XP_002864969.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41228.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+YA+Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  223  MDGAPYLRKVDLRSYANYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  282

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL  APRA EKSK R
Sbjct  283  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMR  337



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+SY+ELS ALEKMFS FT G CGSQG  GR+ ++ESKL D L+GS
Sbjct  138  MDGAPYLRKVDLKMYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGS  197

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV TYEDKDGDWMLVGDVPW+MF++SCKRL+IMKGS+AIGLAPRA EK K+R+
Sbjct  198  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  251



>ref|XP_010062501.1| PREDICTED: auxin-responsive protein IAA27 [Eucalyptus grandis]
 gb|KCW69642.1| hypothetical protein EUGRSUZ_F03050 [Eucalyptus grandis]
Length=342

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTI--GQCGSQGAPGRENLSESKLRDFLH  533
            MDGAPYLRKVDLRTY SY ELS+ALEKMFSCFTI  G C S+G  G+E+LSES+L D L+
Sbjct  227  MDGAPYLRKVDLRTYGSYSELSTALEKMFSCFTIVSGHCDSRGPLGQESLSESRLADLLN  286

Query  532  GSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK S+AIGLAPRA EK KSR+
Sbjct  287  GSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSEAIGLAPRATEKCKSRD  342



>ref|NP_001280937.1| auxin-responsive protein IAA27 [Malus domestica]
 gb|ADL36581.1| ARF domain class transcription factor [Malus domestica]
Length=319

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY +LS ALEKMFSCFTIGQCGS GA  R+ LSES+L D LHG+
Sbjct  207  MDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGSHGA-SRDGLSESRLMDLLHGA  265

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIGLAPRA +K K+ N
Sbjct  266  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGLAPRAMQKCKNSN  319



>ref|XP_009112193.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=312

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ L E+KL+DFL+G 
Sbjct  197  MDGAPYLRKVDLRSYGNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLRETKLKDFLNGK  256

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG+DAIGL  APRA EKSK R
Sbjct  257  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGADAIGLAAAPRAMEKSKMR  311



>ref|XP_011072390.1| PREDICTED: auxin-responsive protein IAA27 [Sesamum indicum]
Length=327

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRK+DL+TY  Y ELSSALEKMFSCFTIGQ G QG  G+E LSES L D LHGS
Sbjct  215  MEGAPYLRKIDLKTYRCYAELSSALEKMFSCFTIGQYG-QGLAGQERLSESHLMDLLHGS  273

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAIGLAPR  +K KS+N
Sbjct  274  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLAPRTMQKCKSQN  327



>ref|XP_006584591.1| PREDICTED: uncharacterized protein LOC100804782 isoform X1 [Glycine 
max]
 gb|KHN05349.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=305

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQC S+  PG++ LSES  RD + GS
Sbjct  192  MDGAPYLRKVDLKTYSNYIELSSALEKMFSCFTIGQCNSRALPGKDGLSESAFRDLVDGS  251

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDK+GDWMLVGDVPW MF ESCK+L+IMKGS+AIGLAPR  EK +S+
Sbjct  252  EYVLTYEDKEGDWMLVGDVPWKMFTESCKKLRIMKGSEAIGLAPRGMEKFRSQ  304



>ref|XP_009336858.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=319

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY +LS ALEKMFSCFTIGQCGS GA  R+ LSES+L D LHG+
Sbjct  207  MDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGSHGA-SRDGLSESRLMDLLHGA  265

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIGLAPRA +K K+ N
Sbjct  266  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGLAPRAMQKCKNGN  319



>ref|XP_010463453.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Camelina 
sativa]
Length=304

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  189  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  248

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL  APRA EKSK R
Sbjct  249  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAVEKSKMR  303



>ref|XP_009130521.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=195

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELS ALEKMF+ FT+GQCG+ GA G++ L E+KL+D L+G 
Sbjct  80   MDGAPYLRKVDLRSYTNYMELSLALEKMFTTFTLGQCGANGAAGKDKLCETKLKDLLNGK  139

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDAIGL  APRA EKSK R
Sbjct  140  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDAIGLAAAPRAMEKSKMR  194



>ref|XP_010521482.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Tarenaya 
hassleriana]
Length=352

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS    G+  ++E  L+D LHGS
Sbjct  239  MDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGSHETSGKGAINEGNLKDLLHGS  298

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDAIGLAPRA EK +SRN
Sbjct  299  EYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDAIGLAPRAMEKCRSRN  352



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 103/132 (78%), Gaps = 18/132 (14%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTI------------------GQCGSQGA  581
            MDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTI                  GQ GS GA
Sbjct  252  MDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIDAHSGLYGFSCCCFHLLSGQYGSHGA  311

Query  580  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  401
             GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MFI +CKRL+IMK +DAIGL
Sbjct  312  LGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDAIGL  371

Query  400  APRAKEKSKSRN  365
            APRA EK ++RN
Sbjct  372  APRAVEKCRNRN  383



>emb|CDY68170.1| BnaCnng57860D [Brassica napus]
Length=311

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  196  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  255

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL  APRA EKSK R
Sbjct  256  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGPDAIGLAAAPRAMEKSKMR  310



>ref|XP_010521481.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Tarenaya 
hassleriana]
Length=352

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS    G+  ++E  L+D LHGS
Sbjct  239  MDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGSHETSGKGAINEGNLKDLLHGS  298

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDAIGLAPRA EK +SRN
Sbjct  299  EYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDAIGLAPRAMEKCRSRN  352



>ref|NP_001241183.1| uncharacterized protein LOC100804782 [Glycine max]
 gb|ACU20310.1| unknown [Glycine max]
Length=322

 Score =   187 bits (475),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQC S+  PG++ LSES  RD + GS
Sbjct  209  MDGAPYLRKVDLKTYSNYIELSSALEKMFSCFTIGQCNSRALPGKDGLSESAFRDLVDGS  268

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  368
            EYVLTYEDK+GDWMLVGDVPW MF ESCK+L+IMKGS+AIGLAPR  EK +S+
Sbjct  269  EYVLTYEDKEGDWMLVGDVPWKMFTESCKKLRIMKGSEAIGLAPRGMEKFRSQ  321



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+ Y+SY+ELS ALEKMFS FT G CGSQG  GR+ ++ESKL D L+GS
Sbjct  128  MDGAPYLRKVDLKIYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGS  187

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV TYEDKDGDWMLVGDVPW+MF++SCKRL++MKGS+AIGLAPRA EK K+R+
Sbjct  188  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRMMKGSEAIGLAPRAMEKCKNRS  241



>emb|CDY37837.1| BnaAnng04980D [Brassica napus]
Length=296

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+ GA G++ L E+KL+D L+G 
Sbjct  181  MDGAPYLRKVDLRSYTNYMELSSALEKMFTTFTLGQCGANGAAGKDKLCETKLKDLLNGK  240

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDAIGL  APRA EKSK R
Sbjct  241  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDAIGLAAAPRAMEKSKMR  295



>ref|XP_009380571.1| PREDICTED: auxin-responsive protein IAA21-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=317

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 103/139 (74%), Gaps = 25/139 (18%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRKVDL+TY  Y+ELSSALEKMFSCFTIGQC SQG P R+ LSES+L D L+GS
Sbjct  179  MEGAPYLRKVDLKTYKDYRELSSALEKMFSCFTIGQCNSQGIPSRDGLSESRLMDLLNGS  238

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIM-------------------------K  422
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IM                         K
Sbjct  239  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLGKFRQTEILNNLQSELLK  298

Query  421  GSDAIGLAPRAKEKSKSRN  365
            GSDAIGLAPRA EK KSRN
Sbjct  299  GSDAIGLAPRAMEKCKSRN  317



>ref|XP_009352507.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=318

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDL+TY SY ELS ALEKMFSCFTIG CGS GA  R+ LSES+L D LHG+
Sbjct  206  MDGAPYLRKVDLKTYGSYLELSLALEKMFSCFTIGHCGSHGA-SRDGLSESRLMDLLHGA  264

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+A+GLAPRA +K K+ N
Sbjct  265  EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAMGLAPRAMQKCKNSN  318



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRK+DL+ Y SYQELS ALEKMFS FTIG C SQG  GR+ ++ESKL D ++GS
Sbjct  125  MDGAPYLRKIDLKMYRSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLINGS  184

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV TYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGS+AIGLAP+A EK K+++
Sbjct  185  EYVPTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNKS  238



>gb|AAM64650.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  223  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  282

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL  APRA EKSK R
Sbjct  283  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMR  337



>ref|NP_851275.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 sp|Q38827.1|IAA9_ARATH RecName: Full=Auxin-responsive protein IAA9; AltName: Full=Indoleacetic 
acid-induced protein 9 [Arabidopsis thaliana]
 gb|AAG50093.1|AF334715_1 auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AAC49050.1| IAA9 [Arabidopsis thaliana]
 emb|CAA16692.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AED98084.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  223  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  282

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL  APRA EKSK R
Sbjct  283  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMR  337



>ref|XP_010463449.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Camelina 
sativa]
Length=339

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  224  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  283

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL  APRA EKSK R
Sbjct  284  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAVEKSKMR  338



>ref|XP_010666360.1| PREDICTED: auxin-responsive protein IAA8-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVD++ Y +Y ELSSALEKMFSCFTIG C S    GRE LS +KL+D +HGS
Sbjct  252  MDGAPYLRKVDIKAYMTYHELSSALEKMFSCFTIGHCTSHMTTGREMLSINKLKDLVHGS  311

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYVLTY+DKDGDWMLVGDVPW+MF++SC+RL+IMK SDAIGLAPRA EK ++R+
Sbjct  312  EYVLTYKDKDGDWMLVGDVPWEMFVDSCRRLRIMKSSDAIGLAPRAVEKCRNRS  365



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRK+DL+ Y+SYQELS ALEKMFS FTIG C SQG  GR+ ++ESKL D L+GS
Sbjct  128  MDGAPYLRKIDLKMYSSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLLNGS  187

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV TYEDKDGDWMLVGDVPW+MF++SCKRL+IMKGS+AIGLAP+  EK K+++
Sbjct  188  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKVMEKCKNQS  241



>ref|XP_010433139.1| PREDICTED: auxin-responsive protein IAA27-like [Camelina sativa]
Length=310

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            M+GAPYLRK+DL+TY SY ELSSALEKMFSCFTIGQ GS G  GR+ L+ES+L D L GS
Sbjct  197  MEGAPYLRKIDLKTYKSYLELSSALEKMFSCFTIGQFGSHGGCGRDGLNESRLTDLLRGS  256

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  365
            EYV+TYEDKD DWMLVGDVPW+MFI SCK+LKIMK S+AIGLAPR  EK +SRN
Sbjct  257  EYVVTYEDKDSDWMLVGDVPWEMFICSCKKLKIMKSSEAIGLAPRVMEKCRSRN  310



>ref|XP_006279648.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
 gb|EOA12546.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
Length=339

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -3

Query  706  MDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLHGS  527
            MDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA G++ LSE+KL+D L+G 
Sbjct  224  MDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGK  283

Query  526  EYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL--APRAKEKSKSR  368
            +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL  APRA EKSK R
Sbjct  284  DYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAVEKSKMR  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365