BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006L23

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789016.1|  PREDICTED: uncharacterized GPI-anchored prot...    218   7e-65   Nicotiana sylvestris
ref|XP_009624117.1|  PREDICTED: uncharacterized GPI-anchored prot...    219   3e-64   Nicotiana tomentosiformis
ref|XP_009789015.1|  PREDICTED: uncharacterized GPI-anchored prot...    218   7e-64   Nicotiana sylvestris
ref|XP_006343290.1|  PREDICTED: uncharacterized GPI-anchored prot...    209   1e-60   
ref|XP_006343289.1|  PREDICTED: uncharacterized GPI-anchored prot...    209   2e-60   Solanum tuberosum [potatoes]
ref|XP_006348113.1|  PREDICTED: uncharacterized GPI-anchored prot...    207   3e-60   Solanum tuberosum [potatoes]
ref|XP_006348112.1|  PREDICTED: uncharacterized GPI-anchored prot...    208   6e-60   Solanum tuberosum [potatoes]
ref|XP_004234477.1|  PREDICTED: uncharacterized GPI-anchored prot...    207   1e-59   Solanum lycopersicum
ref|XP_004232714.1|  PREDICTED: uncharacterized GPI-anchored prot...    204   1e-58   Solanum lycopersicum
ref|XP_010655406.1|  PREDICTED: uncharacterized GPI-anchored prot...    201   2e-57   Vitis vinifera
ref|XP_011096070.1|  PREDICTED: uncharacterized GPI-anchored prot...    196   8e-56   Sesamum indicum [beniseed]
emb|CDP04392.1|  unnamed protein product                                196   2e-55   Coffea canephora [robusta coffee]
gb|KDP20754.1|  hypothetical protein JCGZ_21225                         194   6e-55   Jatropha curcas
ref|XP_010418167.1|  PREDICTED: uncharacterized GPI-anchored prot...    190   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006389630.1|  hypothetical protein POPTR_0021s00790g             190   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_008224823.1|  PREDICTED: uncharacterized GPI-anchored prot...    189   6e-53   Prunus mume [ume]
ref|XP_007211589.1|  hypothetical protein PRUPE_ppa005381mg             189   9e-53   Prunus persica
gb|KFK37988.1|  hypothetical protein AALP_AA3G055500                    187   2e-52   Arabis alpina [alpine rockcress]
ref|XP_004145108.1|  PREDICTED: uncharacterized GPI-anchored prot...    188   2e-52   Cucumis sativus [cucumbers]
ref|XP_010052838.1|  PREDICTED: uncharacterized GPI-anchored prot...    188   2e-52   Eucalyptus grandis [rose gum]
gb|EYU27795.1|  hypothetical protein MIMGU_mgv1a006122mg                188   2e-52   Erythranthe guttata [common monkey flower]
ref|XP_004293284.1|  PREDICTED: uncharacterized GPI-anchored prot...    187   2e-52   Fragaria vesca subsp. vesca
ref|XP_011047995.1|  PREDICTED: uncharacterized GPI-anchored prot...    189   2e-52   Populus euphratica
ref|XP_008371096.1|  PREDICTED: uncharacterized GPI-anchored prot...    177   6e-52   
ref|XP_011037655.1|  PREDICTED: uncharacterized GPI-anchored prot...    187   6e-52   Populus euphratica
ref|XP_011037654.1|  PREDICTED: uncharacterized GPI-anchored prot...    186   9e-52   Populus euphratica
ref|XP_010665573.1|  PREDICTED: uncharacterized GPI-anchored prot...    185   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB67174.1|  hypothetical protein B456_010G180100                    183   2e-51   Gossypium raimondii
gb|KJB67179.1|  hypothetical protein B456_010G180100                    184   2e-51   Gossypium raimondii
ref|XP_010276074.1|  PREDICTED: uncharacterized GPI-anchored prot...    185   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008441110.1|  PREDICTED: uncharacterized GPI-anchored prot...    185   3e-51   Cucumis melo [Oriental melon]
ref|XP_007026058.1|  Uncharacterized protein isoform 1                  185   4e-51   
ref|XP_009113111.1|  PREDICTED: uncharacterized GPI-anchored prot...    184   4e-51   Brassica rapa
ref|XP_011047994.1|  PREDICTED: uncharacterized GPI-anchored prot...    186   4e-51   Populus euphratica
ref|XP_008384071.1|  PREDICTED: uncharacterized GPI-anchored prot...    184   4e-51   Malus domestica [apple tree]
emb|CDY19508.1|  BnaC09g13950D                                          183   6e-51   Brassica napus [oilseed rape]
gb|KJB67173.1|  hypothetical protein B456_010G180100                    184   9e-51   Gossypium raimondii
gb|KJB67176.1|  hypothetical protein B456_010G180100                    183   9e-51   Gossypium raimondii
gb|EYU27794.1|  hypothetical protein MIMGU_mgv1a006122mg                183   1e-50   Erythranthe guttata [common monkey flower]
gb|KJB69284.1|  hypothetical protein B456_011G014700                    183   2e-50   Gossypium raimondii
ref|XP_002304912.2|  hypothetical protein POPTR_0004s01590g             182   2e-50   
ref|XP_009357443.1|  PREDICTED: uncharacterized GPI-anchored prot...    182   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_008371095.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   3e-50   
emb|CDY25331.1|  BnaC01g30000D                                          181   5e-50   Brassica napus [oilseed rape]
ref|XP_008364804.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    175   5e-50   
ref|XP_002518489.1|  conserved hypothetical protein                     180   1e-49   
gb|KJB69286.1|  hypothetical protein B456_011G014700                    181   1e-49   Gossypium raimondii
ref|XP_006391949.1|  hypothetical protein EUTSA_v10023466mg             180   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010430217.1|  PREDICTED: uncharacterized GPI-anchored prot...    180   2e-49   Camelina sativa [gold-of-pleasure]
ref|NP_176382.2|  uncharacterized protein                               179   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473411.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_007147733.1|  hypothetical protein PHAVU_006G150200g             179   3e-49   Phaseolus vulgaris [French bean]
ref|XP_010278700.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   3e-49   
ref|XP_003546148.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   4e-49   Glycine max [soybeans]
gb|KHG11868.1|  hypothetical protein F383_01404                         179   4e-49   Gossypium arboreum [tree cotton]
ref|XP_009361541.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_006858205.1|  hypothetical protein AMTR_s00062p00176270          178   5e-49   
ref|XP_006594428.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   5e-49   Glycine max [soybeans]
ref|XP_009361468.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   5e-49   Pyrus x bretschneideri [bai li]
ref|XP_006597581.1|  PREDICTED: uncharacterized GPI-anchored prot...    179   6e-49   
ref|XP_006301249.1|  hypothetical protein CARUB_v10021649mg             177   1e-48   
emb|CDY47167.1|  BnaA01g22930D                                          176   3e-48   Brassica napus [oilseed rape]
ref|XP_009105804.1|  PREDICTED: uncharacterized GPI-anchored prot...    176   3e-48   Brassica rapa
gb|KEH36841.1|  hypothetical protein MTR_2g022990                       176   5e-48   Medicago truncatula
ref|XP_004486118.1|  PREDICTED: uncharacterized GPI-anchored prot...    176   5e-48   Cicer arietinum [garbanzo]
gb|KHG15461.1|  hypothetical protein F383_19757                         176   6e-48   Gossypium arboreum [tree cotton]
ref|XP_008812638.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   7e-48   
gb|AFK46165.1|  unknown                                                 169   8e-48   Lotus japonicus
ref|XP_010093283.1|  hypothetical protein L484_006297                   175   1e-47   
ref|XP_006449719.1|  hypothetical protein CICLE_v10015200mg             174   2e-47   
ref|XP_008812631.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   2e-47   
ref|XP_008812636.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   2e-47   
ref|XP_008812632.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   3e-47   
gb|KDO78212.1|  hypothetical protein CISIN_1g012690mg                   174   3e-47   Citrus sinensis [apfelsine]
gb|KDO78211.1|  hypothetical protein CISIN_1g012690mg                   174   3e-47   Citrus sinensis [apfelsine]
ref|XP_006467444.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   3e-47   Citrus sinensis [apfelsine]
ref|XP_008812630.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   3e-47   Phoenix dactylifera
gb|KHN33033.1|  Putative GPI-anchored protein                           173   3e-47   Glycine soja [wild soybean]
ref|NP_001185289.1|  uncharacterized protein                            173   4e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28508.1|  ESTs gb|AA728658 and gb|N95943 come from this gene      173   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011463310.1|  PREDICTED: uncharacterized GPI-anchored prot...    173   6e-47   Fragaria vesca subsp. vesca
ref|XP_006467443.1|  PREDICTED: uncharacterized GPI-anchored prot...    173   8e-47   Citrus sinensis [apfelsine]
gb|KHN37599.1|  Putative GPI-anchored protein                           172   1e-46   Glycine soja [wild soybean]
ref|XP_006469765.1|  PREDICTED: uncharacterized GPI-anchored prot...    171   2e-46   
ref|XP_010923892.1|  PREDICTED: uncharacterized GPI-anchored prot...    172   3e-46   Elaeis guineensis
ref|XP_009105812.1|  PREDICTED: uncharacterized GPI-anchored prot...    171   4e-46   Brassica rapa
ref|XP_010930048.1|  PREDICTED: uncharacterized GPI-anchored prot...    170   7e-46   
ref|XP_010930030.1|  PREDICTED: uncharacterized GPI-anchored prot...    171   8e-46   Elaeis guineensis
gb|EPS59099.1|  hypothetical protein M569_15711                         168   1e-45   Genlisea aurea
ref|XP_007132551.1|  hypothetical protein PHAVU_011G104100g             169   3e-45   Phaseolus vulgaris [French bean]
ref|XP_006582352.1|  PREDICTED: uncharacterized GPI-anchored prot...    162   5e-45   Glycine max [soybeans]
ref|XP_006582350.1|  PREDICTED: uncharacterized GPI-anchored prot...    162   5e-45   Glycine max [soybeans]
ref|XP_006582351.1|  PREDICTED: uncharacterized GPI-anchored prot...    162   5e-45   
ref|XP_006582349.1|  PREDICTED: uncharacterized GPI-anchored prot...    162   5e-45   Glycine max [soybeans]
gb|KEH29676.1|  hypothetical protein MTR_4g048040                       168   6e-45   Medicago truncatula
gb|KEH29677.1|  hypothetical protein MTR_4g048040                       168   6e-45   Medicago truncatula
ref|XP_010546889.1|  PREDICTED: uncharacterized GPI-anchored prot...    167   6e-45   Tarenaya hassleriana [spider flower]
ref|NP_001143619.1|  uncharacterized protein LOC100276335 precursor     168   8e-45   
tpg|DAA59335.1|  TPA: hypothetical protein ZEAMMB73_763936              167   9e-45   
ref|XP_006592376.1|  PREDICTED: uncharacterized GPI-anchored prot...    166   2e-44   Glycine max [soybeans]
ref|XP_002461296.1|  hypothetical protein SORBIDRAFT_02g000365          167   2e-44   Sorghum bicolor [broomcorn]
ref|XP_003539868.1|  PREDICTED: uncharacterized GPI-anchored prot...    166   2e-44   Glycine max [soybeans]
ref|XP_006592373.1|  PREDICTED: uncharacterized GPI-anchored prot...    166   3e-44   Glycine max [soybeans]
gb|KCW89408.1|  hypothetical protein EUGRSUZ_A01709                     166   3e-44   Eucalyptus grandis [rose gum]
ref|XP_004987275.1|  PREDICTED: uncharacterized GPI-anchored prot...    165   7e-44   Setaria italica
ref|XP_006657387.1|  PREDICTED: uncharacterized GPI-anchored prot...    164   1e-43   
ref|XP_006592374.1|  PREDICTED: uncharacterized GPI-anchored prot...    164   2e-43   
ref|XP_010930038.1|  PREDICTED: uncharacterized GPI-anchored prot...    164   2e-43   Elaeis guineensis
gb|KJB67177.1|  hypothetical protein B456_010G180100                    163   2e-43   Gossypium raimondii
ref|XP_009397174.1|  PREDICTED: uncharacterized GPI-anchored prot...    163   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006389629.1|  hypothetical protein POPTR_0021s00790g             163   4e-43   
ref|XP_002886500.1|  hypothetical protein ARALYDRAFT_475141             162   6e-43   
gb|KCW89407.1|  hypothetical protein EUGRSUZ_A01709                     162   6e-43   Eucalyptus grandis [rose gum]
gb|KHN21235.1|  Putative GPI-anchored protein                           162   1e-42   Glycine soja [wild soybean]
ref|NP_001058682.1|  Os07g0102300                                       161   2e-42   
ref|XP_009408658.1|  PREDICTED: uncharacterized GPI-anchored prot...    161   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009590299.1|  PREDICTED: uncharacterized GPI-anchored prot...    161   2e-42   Nicotiana tomentosiformis
ref|XP_010100635.1|  hypothetical protein L484_001991                   160   2e-42   
gb|KJB69287.1|  hypothetical protein B456_011G014700                    159   1e-41   Gossypium raimondii
ref|XP_009770909.1|  PREDICTED: uncharacterized GPI-anchored prot...    159   1e-41   Nicotiana sylvestris
ref|NP_974068.1|  uncharacterized protein                               158   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397173.1|  PREDICTED: uncharacterized GPI-anchored prot...    159   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES88114.2|  hypothetical protein MTR_4g048040                       159   2e-41   Medicago truncatula
ref|XP_006366594.1|  PREDICTED: uncharacterized GPI-anchored prot...    157   5e-41   
ref|XP_008230068.1|  PREDICTED: uncharacterized GPI-anchored prot...    157   7e-41   Prunus mume [ume]
dbj|BAD31837.1|  unknown protein                                        154   7e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010323825.1|  PREDICTED: uncharacterized GPI-anchored prot...    151   6e-39   Solanum lycopersicum
ref|XP_010323826.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   2e-37   
ref|XP_009408659.1|  PREDICTED: uncharacterized GPI-anchored prot...    145   1e-36   
ref|XP_003605917.1|  GPI-anchored protein, putative                     145   2e-36   
ref|XP_008379633.1|  PREDICTED: uncharacterized GPI-anchored prot...    144   5e-36   
ref|XP_008379634.1|  PREDICTED: uncharacterized GPI-anchored prot...    142   2e-35   
ref|XP_006582353.1|  PREDICTED: uncharacterized GPI-anchored prot...    136   6e-35   Glycine max [soybeans]
ref|XP_003557710.2|  PREDICTED: uncharacterized GPI-anchored prot...    139   4e-34   Brachypodium distachyon [annual false brome]
ref|XP_004244742.1|  PREDICTED: uncharacterized GPI-anchored prot...    124   5e-29   Solanum lycopersicum
ref|XP_006352201.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   1e-28   Solanum tuberosum [potatoes]
ref|XP_009786452.1|  PREDICTED: uncharacterized GPI-anchored prot...    122   3e-28   Nicotiana sylvestris
ref|XP_010324691.1|  PREDICTED: uncharacterized GPI-anchored prot...    120   1e-27   
ref|XP_006352202.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   2e-27   Solanum tuberosum [potatoes]
ref|XP_010909048.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   3e-27   Elaeis guineensis
ref|XP_006356958.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   3e-27   Solanum tuberosum [potatoes]
ref|XP_008226609.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   3e-27   Prunus mume [ume]
ref|XP_009786453.1|  PREDICTED: uncharacterized GPI-anchored prot...    118   7e-27   Nicotiana sylvestris
ref|XP_010313112.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   9e-27   Solanum lycopersicum
ref|XP_010313113.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   9e-27   
ref|XP_006352204.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   1e-26   
ref|XP_006352203.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   1e-26   Solanum tuberosum [potatoes]
ref|XP_009799550.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   1e-26   Nicotiana sylvestris
ref|XP_008788195.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   2e-26   
emb|CDP16478.1|  unnamed protein product                                112   2e-26   Coffea canephora [robusta coffee]
ref|XP_009799548.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   2e-26   Nicotiana sylvestris
ref|XP_008226610.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   2e-26   Prunus mume [ume]
ref|XP_008788193.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   2e-26   Phoenix dactylifera
gb|KCW87646.1|  hypothetical protein EUGRSUZ_A00037                     115   3e-26   Eucalyptus grandis [rose gum]
gb|ABB47928.2|  expressed protein                                       116   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010069258.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   3e-26   Eucalyptus grandis [rose gum]
gb|ABB47927.2|  expressed protein                                       116   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661999.1|  PREDICTED: uncharacterized GPI-anchored prot...    115   4e-26   Oryza brachyantha
gb|EEE51310.1|  hypothetical protein OsJ_32270                          115   5e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KEH16341.1|  transmembrane protein, putative                         115   5e-26   Medicago truncatula
ref|XP_006356959.1|  PREDICTED: uncharacterized GPI-anchored prot...    115   7e-26   Solanum tuberosum [potatoes]
ref|XP_002465025.1|  hypothetical protein SORBIDRAFT_01g030650          115   8e-26   Sorghum bicolor [broomcorn]
ref|XP_008657905.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   8e-26   Zea mays [maize]
ref|XP_004983827.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   1e-25   Setaria italica
ref|NP_001065159.1|  Os10g0534100                                       114   1e-25   
gb|KCW87644.1|  hypothetical protein EUGRSUZ_A00037                     114   1e-25   Eucalyptus grandis [rose gum]
ref|XP_006661998.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   1e-25   Oryza brachyantha
ref|XP_010068655.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   1e-25   Eucalyptus grandis [rose gum]
ref|XP_006858875.1|  hypothetical protein AMTR_s00066p00196830          114   1e-25   
gb|KCW87634.1|  hypothetical protein EUGRSUZ_A00037                     114   1e-25   Eucalyptus grandis [rose gum]
gb|AAM88643.1|  hypothetical protein                                    114   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|KCW87635.1|  hypothetical protein EUGRSUZ_A00037                     114   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010268250.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_004250775.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   2e-25   Solanum lycopersicum
ref|XP_003574251.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_010234944.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_011091606.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   3e-25   Sesamum indicum [beniseed]
dbj|BAK07547.1|  predicted protein                                      113   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU41043.1|  hypothetical protein MIMGU_mgv1a005775mg                113   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_004983825.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   4e-25   Setaria italica
ref|XP_010065950.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   4e-25   Eucalyptus grandis [rose gum]
gb|EYU41042.1|  hypothetical protein MIMGU_mgv1a005775mg                113   4e-25   Erythranthe guttata [common monkey flower]
ref|XP_009799547.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   5e-25   Nicotiana sylvestris
gb|EEC67358.1|  hypothetical protein OsI_34458                          112   5e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_002970227.1|  hypothetical protein SELMODRAFT_33447              111   5e-25   
ref|XP_010907817.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   5e-25   
ref|XP_008245345.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   6e-25   Prunus mume [ume]
ref|XP_010907821.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   6e-25   
ref|XP_009356791.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_010907815.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   6e-25   
ref|XP_010907816.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   6e-25   
emb|CBI24633.3|  unnamed protein product                                109   7e-25   Vitis vinifera
ref|XP_010907822.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   7e-25   
ref|XP_010907818.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   7e-25   
ref|XP_010912780.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   7e-25   Elaeis guineensis
ref|XP_010069980.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   8e-25   Eucalyptus grandis [rose gum]
tpg|DAA46060.1|  TPA: hypothetical protein ZEAMMB73_313399              112   8e-25   
ref|XP_010907820.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   8e-25   
ref|XP_010912782.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   8e-25   Elaeis guineensis
ref|XP_011047725.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   9e-25   Populus euphratica
ref|XP_010907812.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   9e-25   Elaeis guineensis
gb|AFK40810.1|  unknown                                                 110   9e-25   Lotus japonicus
ref|XP_009799549.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   9e-25   Nicotiana sylvestris
ref|XP_008657911.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   9e-25   Zea mays [maize]
ref|XP_010912783.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   1e-24   
ref|XP_008800448.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   1e-24   
ref|XP_008800442.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   1e-24   
ref|XP_010907814.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   1e-24   
ref|XP_002978387.1|  hypothetical protein SELMODRAFT_108739             111   1e-24   
ref|XP_008800397.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   1e-24   
gb|EMT03898.1|  hypothetical protein F775_11902                         112   1e-24   
ref|XP_009383433.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800391.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   1e-24   Phoenix dactylifera
gb|KEH16340.1|  transmembrane protein, putative                         111   1e-24   Medicago truncatula
ref|XP_008386190.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   1e-24   
gb|KDP43911.1|  hypothetical protein JCGZ_20921                         111   2e-24   Jatropha curcas
gb|KCW87643.1|  hypothetical protein EUGRSUZ_A00037                     110   2e-24   Eucalyptus grandis [rose gum]
ref|XP_011043593.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   2e-24   Populus euphratica
ref|XP_010067401.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   2e-24   Eucalyptus grandis [rose gum]
ref|XP_009413428.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009627075.1|  PREDICTED: uncharacterized GPI-anchored prot...    111   2e-24   
gb|EPS68793.1|  hypothetical protein M569_05967                         110   2e-24   Genlisea aurea
ref|XP_008791793.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   2e-24   Phoenix dactylifera
gb|KCW87641.1|  hypothetical protein EUGRSUZ_A00037                     110   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010930241.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   4e-24   Elaeis guineensis
ref|XP_010068086.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   4e-24   Eucalyptus grandis [rose gum]
ref|XP_008245348.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   4e-24   
ref|XP_010930243.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   4e-24   Elaeis guineensis
ref|XP_006410172.1|  hypothetical protein EUTSA_v10016766mg             109   4e-24   
ref|XP_006387769.1|  hypothetical protein POPTR_0596s00200g             107   7e-24   
ref|XP_006294137.1|  hypothetical protein CARUB_v10023131mg             109   7e-24   
ref|XP_010469811.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010414232.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004152141.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   7e-24   Cucumis sativus [cucumbers]
ref|XP_010510299.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008454095.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   8e-24   Cucumis melo [Oriental melon]
ref|XP_010510301.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   8e-24   
ref|XP_004156974.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   8e-24   
ref|XP_008454096.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   9e-24   Cucumis melo [Oriental melon]
ref|XP_010542708.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   1e-23   Tarenaya hassleriana [spider flower]
emb|CDY23986.1|  BnaC03g17050D                                          108   1e-23   Brassica napus [oilseed rape]
gb|KFK31261.1|  hypothetical protein AALP_AA6G089400                    108   1e-23   Arabis alpina [alpine rockcress]
ref|XP_010542709.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010094091.1|  hypothetical protein L484_018108                   108   1e-23   
ref|XP_002273850.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   1e-23   Vitis vinifera
ref|XP_010522039.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   1e-23   Tarenaya hassleriana [spider flower]
gb|KJB37983.1|  hypothetical protein B456_006G230000                    108   1e-23   Gossypium raimondii
gb|KDO50747.1|  hypothetical protein CISIN_1g012117mg                   108   1e-23   Citrus sinensis [apfelsine]
ref|XP_006442928.1|  hypothetical protein CICLE_v10020018mg             108   2e-23   
ref|XP_006478825.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   2e-23   
ref|XP_009141092.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   2e-23   Brassica rapa
ref|XP_004513670.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   2e-23   Cicer arietinum [garbanzo]
ref|XP_009141091.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   2e-23   
ref|XP_006372774.1|  hypothetical protein POPTR_0017s04930g             108   2e-23   
ref|XP_002881126.1|  hypothetical protein ARALYDRAFT_481988             108   2e-23   
ref|XP_004309828.1|  PREDICTED: uncharacterized GPI-anchored prot...    107   2e-23   Fragaria vesca subsp. vesca
emb|CDP03434.1|  unnamed protein product                                107   3e-23   Coffea canephora [robusta coffee]
ref|XP_004513671.1|  PREDICTED: uncharacterized GPI-anchored prot...    107   3e-23   Cicer arietinum [garbanzo]
ref|NP_850153.1|  uncharacterized protein                               107   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007033842.1|  Uncharacterized protein isoform 3                  107   3e-23   
gb|KJB37984.1|  hypothetical protein B456_006G230000                    107   4e-23   Gossypium raimondii
ref|XP_007033840.1|  Uncharacterized protein isoform 1                  107   4e-23   
ref|XP_007033841.1|  Uncharacterized protein isoform 2                  107   4e-23   
gb|KJB37982.1|  hypothetical protein B456_006G230000                    107   4e-23   Gossypium raimondii
gb|KJB37980.1|  hypothetical protein B456_006G230000                    107   4e-23   Gossypium raimondii
gb|KHG08002.1|  hypothetical protein F383_34877                         107   5e-23   Gossypium arboreum [tree cotton]
gb|KJB37981.1|  hypothetical protein B456_006G230000                    107   5e-23   Gossypium raimondii
ref|XP_006294136.1|  hypothetical protein CARUB_v10023131mg             106   7e-23   
ref|XP_007223287.1|  hypothetical protein PRUPE_ppa005555mg             106   8e-23   
ref|XP_010522037.1|  PREDICTED: uncharacterized GPI-anchored prot...    105   2e-22   Tarenaya hassleriana [spider flower]
emb|CDX84821.1|  BnaA03g14090D                                          107   2e-22   
ref|XP_009132748.1|  PREDICTED: uncharacterized GPI-anchored prot...    105   2e-22   Brassica rapa
ref|XP_010672282.1|  PREDICTED: uncharacterized GPI-anchored prot...    105   3e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|AAC02741.2|  hypothetical protein                                    105   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530300.1|  conserved hypothetical protein                     104   3e-22   
ref|XP_006587693.1|  PREDICTED: uncharacterized GPI-anchored prot...    104   4e-22   Glycine max [soybeans]
ref|XP_007131412.1|  hypothetical protein PHAVU_011G011600g             104   5e-22   Phaseolus vulgaris [French bean]
gb|KHN32404.1|  Putative GPI-anchored protein                           104   6e-22   Glycine soja [wild soybean]
ref|XP_010317663.1|  PREDICTED: uncharacterized GPI-anchored prot...    102   7e-22   Solanum lycopersicum
gb|KHN11705.1|  Putative GPI-anchored protein                           103   8e-22   
gb|ACU18602.1|  unknown                                                 102   2e-21   
emb|CAN82818.1|  hypothetical protein VITISV_030074                     102   3e-21   
ref|XP_007026061.1|  Uncharacterized protein isoform 4                99.4    1e-20   
ref|XP_001774402.1|  predicted protein                                98.2    2e-20   
ref|XP_010276075.1|  PREDICTED: uncharacterized GPI-anchored prot...  98.6    2e-20   
ref|XP_006447552.1|  hypothetical protein CICLE_v10015544mg           94.0    9e-19   
ref|XP_006447553.1|  hypothetical protein CICLE_v10015544mg           94.0    9e-19   
ref|XP_010930056.1|  PREDICTED: uncharacterized GPI-anchored prot...  92.0    4e-18   
gb|EAZ38400.1|  hypothetical protein OsJ_22776                        85.9    2e-17   
gb|KHN41221.1|  Putative GPI-anchored protein                         89.0    2e-17   
gb|EMT03900.1|  hypothetical protein F775_17003                       83.6    2e-16   
ref|XP_010051000.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.0    2e-16   
gb|EEC81371.1|  hypothetical protein OsI_24575                        87.0    6e-16   
gb|KJB69288.1|  hypothetical protein B456_011G014700                  85.5    7e-16   
ref|XP_007216480.1|  hypothetical protein PRUPE_ppa024738mg           85.1    8e-16   
ref|XP_007026060.1|  Uncharacterized protein isoform 3                85.9    8e-16   
ref|XP_007026059.1|  Uncharacterized protein isoform 2                85.5    9e-16   
gb|KJB67181.1|  hypothetical protein B456_010G180100                  85.1    1e-15   
dbj|BAK03275.1|  predicted protein                                    82.4    1e-14   
ref|XP_002309774.2|  hypothetical protein POPTR_0007s01500g           81.6    3e-14   
gb|EEE66424.1|  hypothetical protein OsJ_22777                        80.9    5e-14   
gb|ACN25434.1|  unknown                                               77.4    7e-13   
ref|XP_007033843.1|  Uncharacterized protein isoform 5                75.9    3e-12   
ref|XP_009598829.1|  PREDICTED: uncharacterized GPI-anchored prot...  62.0    1e-07   
ref|XP_007212309.1|  hypothetical protein PRUPE_ppa006724mg           59.3    1e-06   
gb|KCW87645.1|  hypothetical protein EUGRSUZ_A00037                   58.5    1e-06   
gb|KDO50752.1|  hypothetical protein CISIN_1g012117mg                 57.4    4e-06   
ref|XP_006442927.1|  hypothetical protein CICLE_v10020018mg           57.4    4e-06   



>ref|XP_009789016.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009789017.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Nicotiana sylvestris]
Length=370

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E+YVSHLQRQS VTNLQALDCAASLG+KLQKANV++NVYNLCHI+LKDFSVQV PEVSGC
Sbjct  221  ERYVSHLQRQSFVTNLQALDCAASLGLKLQKANVSKNVYNLCHISLKDFSVQVAPEVSGC  280

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAILDQ+TGISFVCDLNDNIPAPWPS SQ  AS+CNK+VRIPALPA ASGQ
Sbjct  281  LLPSLPSDAILDQSTGISFVCDLNDNIPAPWPSMSQLPASSCNKSVRIPALPAVASGQ  338



>ref|XP_009624117.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nicotiana tomentosiformis]
Length=463

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E+YVSHLQRQS VTNLQALDCAASLG+KLQKANV++NVYNLCHI+LKDFSVQV PEVSGC
Sbjct  314  ERYVSHLQRQSFVTNLQALDCAASLGLKLQKANVSKNVYNLCHISLKDFSVQVAPEVSGC  373

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAILDQ+TGISFVCDLNDNIPAPWPS SQ  AS+CNK+VRIPALPAAASGQ
Sbjct  374  LLPSLPSDAILDQSTGISFVCDLNDNIPAPWPSMSQLPASSCNKSVRIPALPAAASGQ  431



>ref|XP_009789015.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Nicotiana sylvestris]
Length=458

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E+YVSHLQRQS VTNLQALDCAASLG+KLQKANV++NVYNLCHI+LKDFSVQV PEVSGC
Sbjct  309  ERYVSHLQRQSFVTNLQALDCAASLGLKLQKANVSKNVYNLCHISLKDFSVQVAPEVSGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAILDQ+TGISFVCDLNDNIPAPWPS SQ  AS+CNK+VRIPALPA ASGQ
Sbjct  369  LLPSLPSDAILDQSTGISFVCDLNDNIPAPWPSMSQLPASSCNKSVRIPALPAVASGQ  426



>ref|XP_006343290.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum tuberosum]
Length=425

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E+YVSHLQRQS VTNLQALDCAASLG+KLQK NV++NVYNLCHI+LKDFSVQVTPEVSGC
Sbjct  275  ERYVSHLQRQSFVTNLQALDCAASLGLKLQKDNVSKNVYNLCHISLKDFSVQVTPEVSGC  334

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LL SLPSDAILD+T GI FVCDLNDNIPAPWPS SQ  AS+C K+VRIPALPA ASGQ
Sbjct  335  LLSSLPSDAILDKTLGIGFVCDLNDNIPAPWPSMSQLPASSCKKSVRIPALPAVASGQ  392



>ref|XP_006343289.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum tuberosum]
Length=465

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E+YVSHLQRQS VTNLQALDCAASLG+KLQK NV++NVYNLCHI+LKDFSVQVTPEVSGC
Sbjct  315  ERYVSHLQRQSFVTNLQALDCAASLGLKLQKDNVSKNVYNLCHISLKDFSVQVTPEVSGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LL SLPSDAILD+T GI FVCDLNDNIPAPWPS SQ  AS+C K+VRIPALPA ASGQ
Sbjct  375  LLSSLPSDAILDKTLGIGFVCDLNDNIPAPWPSMSQLPASSCKKSVRIPALPAVASGQ  432



>ref|XP_006348113.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum tuberosum]
Length=418

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQRQS VTNLQALDCAASLG KLQKANV++N+Y LCHI+LKDFSVQV PEVSGC
Sbjct  275  ESYVSHLQRQSFVTNLQALDCAASLGFKLQKANVSKNIYKLCHISLKDFSVQVAPEVSGC  334

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA+LDQ++GISFVCDLNDNIPAPWPS S    S+CNKT++IPALPAAASGQ
Sbjct  335  LLPSLPSDAVLDQSSGISFVCDLNDNIPAPWPSLSHLPVSSCNKTMKIPALPAAASGQ  392



>ref|XP_006348112.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum tuberosum]
Length=457

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQRQS VTNLQALDCAASLG KLQKANV++N+Y LCHI+LKDFSVQV PEVSGC
Sbjct  314  ESYVSHLQRQSFVTNLQALDCAASLGFKLQKANVSKNIYKLCHISLKDFSVQVAPEVSGC  373

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA+LDQ++GISFVCDLNDNIPAPWPS S    S+CNKT++IPALPAAASGQ
Sbjct  374  LLPSLPSDAVLDQSSGISFVCDLNDNIPAPWPSLSHLPVSSCNKTMKIPALPAAASGQ  431



>ref|XP_004234477.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum lycopersicum]
Length=465

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E+YVSHLQRQS VTNLQALDCAASLG+KLQK NV++NVYNLCHI+LKDFSVQVT EVSGC
Sbjct  315  ERYVSHLQRQSFVTNLQALDCAASLGLKLQKDNVSKNVYNLCHISLKDFSVQVTSEVSGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LL SLPSDAILD+T GISFVCDLNDNIPAPWPS SQ  AS+C K+VRIPALPA ASGQ
Sbjct  375  LLSSLPSDAILDKTVGISFVCDLNDNIPAPWPSMSQLPASSCKKSVRIPALPAVASGQ  432



>ref|XP_004232714.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Solanum 
lycopersicum]
Length=457

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQRQS VTNLQAL CAAS G+KLQKANV++N+Y LCHI+LKDFSVQV PEVSGC
Sbjct  314  ESYVSHLQRQSFVTNLQALGCAASFGLKLQKANVSKNIYKLCHISLKDFSVQVAPEVSGC  373

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA+LDQ++GISFVCDLNDNIPAPWPS S    S+CNK+V+IPALPAAASGQ
Sbjct  374  LLPSLPSDAVLDQSSGISFVCDLNDNIPAPWPSLSHLPVSSCNKSVKIPALPAAASGQ  431



>ref|XP_010655406.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Vitis 
vinifera]
 emb|CBI23250.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E+YVSHLQ+QS +TNLQALDCAASLGMKLQKAN+T+N+YNLC ITLKDFS+Q   + SGC
Sbjct  315  ERYVSHLQKQSLITNLQALDCAASLGMKLQKANITRNIYNLCRITLKDFSLQAVGQESGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA LD+++GISF+CDLNDNIPAPWPS+SQ  AS+CNKTV+IPALPA AS Q+G
Sbjct  375  LLPSLPSDATLDKSSGISFICDLNDNIPAPWPSSSQLPASSCNKTVKIPALPAVASAQSG  434



>ref|XP_011096070.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Sesamum indicum]
 ref|XP_011069400.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Sesamum indicum]
Length=427

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQRQS VTNLQAL+CAASLG KL+KAN+TQNVY+ CHI+LKDFS+QV  + SGC
Sbjct  286  ENYVSHLQRQSFVTNLQALNCAASLGTKLRKANITQNVYSQCHISLKDFSLQVGTQESGC  345

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSD + D++TG+SF+CDLNDNIPAPWP+ASQ  AS+CN+TV+IPALPAAASGQ+
Sbjct  346  LLPSLPSDVVFDKSTGVSFLCDLNDNIPAPWPAASQLPASSCNRTVKIPALPAAASGQS  404



>emb|CDP04392.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPE--VS  627
            E YVSHLQ QS VTNLQAL+CAASLG+KLQKAN+T+N+YNLC ++LKDFSVQVTP+   S
Sbjct  320  ESYVSHLQNQSFVTNLQALNCAASLGLKLQKANITKNIYNLCRVSLKDFSVQVTPQGVES  379

Query  626  GCLLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            GCLLPSLPSDA+ D +TG+SF+CDLNDNIPAPWP+ SQ  AS+CNKTV+IPALPAAASGQ
Sbjct  380  GCLLPSLPSDAVFDSSTGLSFLCDLNDNIPAPWPAPSQLPASSCNKTVKIPALPAAASGQ  439

Query  446  T  444
            +
Sbjct  440  S  440



>gb|KDP20754.1| hypothetical protein JCGZ_21225 [Jatropha curcas]
Length=452

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YVSHLQ+QS +TNLQALDCA +LGMKLQK+N+T+N+Y+LCHI+LKDFS+QV  + SGCLL
Sbjct  313  YVSHLQKQSFITNLQALDCATTLGMKLQKSNITRNIYSLCHISLKDFSLQVAKQESGCLL  372

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PSLPSDA LD+++GI F+CDLNDNIPAPWPS++Q  AS+CNKTV+IPALPAAAS Q+G
Sbjct  373  PSLPSDATLDKSSGIGFICDLNDNIPAPWPSSAQLPASSCNKTVKIPALPAAASAQSG  430



>ref|XP_010418167.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Camelina sativa]
Length=433

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+QV  + SGC
Sbjct  293  ESYVSHLQKQTLMTNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQVGNQESGC  352

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI DQ TGISF CDLNDNIPAPWPS+SQS ASTC K VRIPALPAAAS Q
Sbjct  353  LLPSLPSDAIYDQDTGISFTCDLNDNIPAPWPSSSQSTASTCKKPVRIPALPAAASSQ  410



>ref|XP_006389630.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
 gb|ERP48544.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
Length=458

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS VTNLQAL+CA +LGMKLQ++N+T++VY+LCHITLKDFS+QV  + SGC
Sbjct  318  ESYVSHLQKQSLVTNLQALNCATTLGMKLQRSNITKDVYSLCHITLKDFSLQVAIQESGC  377

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  DQ +GISF+CDLNDNIPAPWPS SQ  AS CNKT++IPALPAAA+ Q+G
Sbjct  378  LLPSLPSDATFDQYSGISFICDLNDNIPAPWPSTSQLSAS-CNKTIKIPALPAAANAQSG  436



>ref|XP_008224823.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
Length=463

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCAASLGMKL+K+N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  323  ESYVSHLQKQSFITNLQALDCAASLGMKLRKSNITENVYSLCHISLKDFSLQVGNQVSGC  382

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP++SQ   S+C+K V+IPALPAAAS ++G
Sbjct  383  LLPSLPSDATFD-SSGVSFLCDLNDNIPAPWPTSSQGAGSSCSKNVKIPALPAAASAESG  441



>ref|XP_007211589.1| hypothetical protein PRUPE_ppa005381mg [Prunus persica]
 gb|EMJ12788.1| hypothetical protein PRUPE_ppa005381mg [Prunus persica]
Length=464

 Score =   189 bits (480),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCAASLGMKL+K+N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  324  ESYVSHLQKQSFITNLQALDCAASLGMKLRKSNITENVYSLCHISLKDFSLQVGNQVSGC  383

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP++SQ   S+C+K V+IPALPAAAS ++G
Sbjct  384  LLPSLPSDATFD-SSGVSFLCDLNDNIPAPWPTSSQGAGSSCSKNVKIPALPAAASAESG  442



>gb|KFK37988.1| hypothetical protein AALP_AA3G055500 [Arabis alpina]
Length=430

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+QV  + SGC
Sbjct  288  ESYVSHLQKQTLITNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQVGNQESGC  347

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI D+ +GISF CDLNDNIPAPWPS++ S ASTC K VRIPALPAAAS Q G
Sbjct  348  LLPSLPSDAIFDKDSGISFTCDLNDNIPAPWPSSTLSSASTCKKPVRIPALPAAASSQPG  407



>ref|XP_004145108.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 ref|XP_004153520.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 ref|XP_004158012.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 gb|KGN64526.1| hypothetical protein Csa_1G063500 [Cucumis sativus]
Length=457

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS VTNLQALDCA +L MKL+K+N+T++VY LCHI+LKDFS+QV  +  GC
Sbjct  316  EGYVTHLQKQSLVTNLQALDCATALEMKLRKSNITKDVYGLCHISLKDFSLQVGNQEFGC  375

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI D ++GISFVCDLND+IPAPW S SQ  AS+CNKT++IPALPAAASGQTG
Sbjct  376  LLPSLPSDAIFDPSSGISFVCDLNDHIPAPWSSTSQMTASSCNKTIKIPALPAAASGQTG  435



>ref|XP_010052838.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Eucalyptus grandis]
 gb|KCW76958.1| hypothetical protein EUGRSUZ_D01317 [Eucalyptus grandis]
Length=450

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS VTNLQA+DCA S+G++L+K N+++NVY+LCHITLKDFSVQV  EVSGC
Sbjct  308  ESYVSHLQKQSFVTNLQAVDCATSMGVRLRKLNISRNVYSLCHITLKDFSVQVESEVSGC  367

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWP   Q   S CNK V+IPALPAA S Q+G
Sbjct  368  LLPSLPSDATFDKFSGISFLCDLNDNIPAPWPLTDQFQTSLCNKNVKIPALPAATSDQSG  427



>gb|EYU27795.1| hypothetical protein MIMGU_mgv1a006122mg [Erythranthe guttata]
Length=455

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQRQS VTNLQAL+CAA LG+KL +AN+T+NVY+ C ++LKDFS+QV  + SGC
Sbjct  314  ESYVSHLQRQSFVTNLQALNCAALLGVKLSRANITENVYSQCRVSLKDFSLQVGAQESGC  373

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSD + D+TTG+SFVCDLNDNIPAPWP++SQ   S+CNKTV+IPALPA ASGQT
Sbjct  374  LLPSLPSDVVFDRTTGVSFVCDLNDNIPAPWPASSQLPPSSCNKTVKIPALPAVASGQT  432



>ref|XP_004293284.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 109/120 (91%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCAASLGMKL+K+N+T++VY+LCHI+LKDFS+QV  + SGC
Sbjct  305  DSYVSHLQKQSFITNLQALDCAASLGMKLRKSNITKDVYSLCHISLKDFSLQVGSQASGC  364

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI  +++G+SF+CDLNDNIPAPWP++SQ  ASTC+K V+IPALPAAAS ++G
Sbjct  365  LLPSLPSDAIF-ESSGVSFLCDLNDNIPAPWPTSSQGAASTCSKGVKIPALPAAASAESG  423



>ref|XP_011047995.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Populus euphratica]
Length=525

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS VTNLQAL+CA +LGMK+Q++N+T++VY+LCHITLKDFS+QV  + SGC
Sbjct  385  ESYVSHLQKQSLVTNLQALNCATTLGMKVQRSNITKDVYSLCHITLKDFSLQVAIQESGC  444

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  DQ +GISF+CDLNDNIPAPWPS SQ  AS CNKT++IPALPAAA+ Q+G
Sbjct  445  LLPSLPSDATFDQYSGISFICDLNDNIPAPWPSTSQLSAS-CNKTIKIPALPAAANAQSG  503



>ref|XP_008371096.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Malus domestica]
Length=141

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 104/120 (87%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS +TNLQALDCAASLGMKL+K+N+ ++VY+LC I+LKDFS+QV  +VSGC
Sbjct  2    ESYVAHLQKQSLITNLQALDCAASLGMKLRKSNIJEDVYSLCRISLKDFSLQVGNQVSGC  61

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP+ SQ  AS+C+K V+IPALPAAAS   G
Sbjct  62   LLPSLPSDAAFD-SSGVSFLCDLNDNIPAPWPT-SQGAASSCSKNVKIPALPAAASAGNG  119



>ref|XP_011037655.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Populus euphratica]
Length=458

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +LGMKLQ++N+T++VY+LCHITLKDFS+QV  + SGC
Sbjct  318  ESYVSHLQKQSLITNLQALDCATTLGMKLQRSNITKDVYSLCHITLKDFSLQVAKQESGC  377

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA    ++GISF+CDLNDNIPAPWPS SQ  A  CNKT++IPALPAAA+ Q+G
Sbjct  378  LLPSLPSDATFGHSSGISFICDLNDNIPAPWPSKSQLSAP-CNKTIKIPALPAAANAQSG  436



>ref|XP_011037654.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Populus euphratica]
Length=471

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +LGMKLQ++N+T++VY+LCHITLKDFS+QV  + SGC
Sbjct  331  ESYVSHLQKQSLITNLQALDCATTLGMKLQRSNITKDVYSLCHITLKDFSLQVAKQESGC  390

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA    ++GISF+CDLNDNIPAPWPS SQ  A  CNKT++IPALPAAA+ Q+G
Sbjct  391  LLPSLPSDATFGHSSGISFICDLNDNIPAPWPSKSQLSAP-CNKTIKIPALPAAANAQSG  449



>ref|XP_010665573.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E Y+SHLQ QS +TNLQAL+CAASLGMKLQ+ NVT NVYNLCH++LK FSVQ   + SGC
Sbjct  305  ENYMSHLQNQSFITNLQALNCAASLGMKLQRENVTTNVYNLCHVSLKQFSVQAGTQESGC  364

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LL SLPSD   D+T+GI+F+CDLNDNIPAPWPSA Q  AS+CNKTV IPALPAAASG+ G
Sbjct  365  LLQSLPSDVTFDKTSGITFLCDLNDNIPAPWPSALQLPASSCNKTVNIPALPAAASGEIG  424



>gb|KJB67174.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
 gb|KJB67175.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=370

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA +LG+KLQ  N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  230  DSYVSHLQKQTLITNLQALDCATALGLKLQTYNITKNVYSLCHISLKDFSLQVGSQVSGC  289

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWP+ S   AS+CNKTVRIPALPAA + Q+
Sbjct  290  LLPSLPSDATFDKFSGISFICDLNDNIPAPWPNPSLLPASSCNKTVRIPALPAATNAQS  348



>gb|KJB67179.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=385

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA +LG+KLQ  N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  245  DSYVSHLQKQTLITNLQALDCATALGLKLQTYNITKNVYSLCHISLKDFSLQVGSQVSGC  304

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWP+ S   AS+CNKTVRIPALPAA + Q+
Sbjct  305  LLPSLPSDATFDKFSGISFICDLNDNIPAPWPNPSLLPASSCNKTVRIPALPAATNAQS  363



>ref|XP_010276074.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Nelumbo nucifera]
Length=453

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q  +TNLQAL+CAA LG+KLQKAN+T+NVY+LCHITLKDFS+QV  + SGC
Sbjct  312  ENYVSHLQKQRFITNLQALNCAAMLGIKLQKANITKNVYSLCHITLKDFSLQVGSQESGC  371

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA  D+++GISF+CDLNDNI APWPS SQ  +S+CNKT+++PALPAA S Q
Sbjct  372  LLPSLPSDATFDKSSGISFLCDLNDNIAAPWPSTSQIPSSSCNKTIKLPALPAATSAQ  429



>ref|XP_008441110.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Cucumis 
melo]
Length=457

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS VTNLQALDCA +L MKL+K+N+T++VY LCHI+LKDFS+QV  +  GC
Sbjct  316  ESYVTHLQKQSLVTNLQALDCATALEMKLRKSNITKDVYGLCHISLKDFSLQVGNQEFGC  375

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI D ++GISFVCDLND+IPAPW S SQ  AS+CNKT++IPALPAAAS Q+G
Sbjct  376  LLPSLPSDAIFDPSSGISFVCDLNDHIPAPWSSTSQMTASSCNKTIKIPALPAAASAQSG  435



>ref|XP_007026058.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY28680.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=459

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA SLG+KLQK N+T+NVY+ CHI+LKDFS+QV  +VSGC
Sbjct  316  DSYVSHLQKQTLITNLQALDCATSLGLKLQKYNITRNVYSQCHISLKDFSLQVGSQVSGC  375

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWP+ S   AS+C K+VRIPALPAA + QTG
Sbjct  376  LLPSLPSDATFDKFSGISFICDLNDNIPAPWPTLSLLPASSCKKSVRIPALPAATNAQTG  435



>ref|XP_009113111.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Brassica 
rapa]
 emb|CDY12917.1| BnaA09g13570D [Brassica napus]
Length=430

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA SLG KLQK N+T+NV+  CHI+LKDFS+QV  + SGC
Sbjct  288  ESYVSHLQKQSLITNLQALDCATSLGTKLQKLNITKNVFTACHISLKDFSLQVGNQESGC  347

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI DQ TGISF CDLNDNIPAPWPS+SQS ASTC KTVRIPALPAAAS Q
Sbjct  348  LLPSLPSDAIFDQDTGISFTCDLNDNIPAPWPSSSQSSASTCKKTVRIPALPAAASSQ  405



>ref|XP_011047994.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Populus euphratica]
Length=544

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS VTNLQAL+CA +LGMK+Q++N+T++VY+LCHITLKDFS+QV  + SGC
Sbjct  385  ESYVSHLQKQSLVTNLQALNCATTLGMKVQRSNITKDVYSLCHITLKDFSLQVAIQESGC  444

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  DQ +GISF+CDLNDNIPAPWPS SQ  AS CNKT++IPALPAAA+ Q+
Sbjct  445  LLPSLPSDATFDQYSGISFICDLNDNIPAPWPSTSQLSAS-CNKTIKIPALPAAANAQS  502



>ref|XP_008384071.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Malus 
domestica]
Length=448

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS +TNLQALDCAASLGMKL+K+N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  309  ESYVAHLQKQSLITNLQALDCAASLGMKLRKSNITENVYSLCHISLKDFSLQVGNQVSGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP+ SQ  AS+C+K V+IPALPAAAS ++G
Sbjct  369  LLPSLPSDATFD-SSGVSFLCDLNDNIPAPWPT-SQGAASSCSKHVKIPALPAAASAESG  426



>emb|CDY19508.1| BnaC09g13950D [Brassica napus]
Length=430

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA SLG KLQK N+T+NV+  CHI+LKDFS+QV  + SGC
Sbjct  288  ESYVSHLQKQSLITNLQALDCATSLGTKLQKLNITKNVFTACHISLKDFSLQVGNQESGC  347

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI DQ TGISF CDLNDNIPAPWPS+SQS ASTC KTVRIPALPAAAS Q
Sbjct  348  LLPSLPSDAIFDQDTGISFTCDLNDNIPAPWPSSSQSSASTCKKTVRIPALPAAASSQ  405



>gb|KJB67173.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=453

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA +LG+KLQ  N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  313  DSYVSHLQKQTLITNLQALDCATALGLKLQTYNITKNVYSLCHISLKDFSLQVGSQVSGC  372

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWP+ S   AS+CNKTVRIPALPAA + Q+
Sbjct  373  LLPSLPSDATFDKFSGISFICDLNDNIPAPWPNPSLLPASSCNKTVRIPALPAATNAQS  431



>gb|KJB67176.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
 gb|KJB67178.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=434

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA +LG+KLQ  N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  313  DSYVSHLQKQTLITNLQALDCATALGLKLQTYNITKNVYSLCHISLKDFSLQVGSQVSGC  372

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWP+ S   AS+CNKTVRIPALPAA + Q+
Sbjct  373  LLPSLPSDATFDKFSGISFICDLNDNIPAPWPNPSLLPASSCNKTVRIPALPAATNAQS  431



>gb|EYU27794.1| hypothetical protein MIMGU_mgv1a006122mg [Erythranthe guttata]
Length=456

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQRQS VTNLQAL+CAA LG+KL +AN+T+NVY+ C ++LKDFS+QV  + SGC
Sbjct  314  ESYVSHLQRQSFVTNLQALNCAALLGVKLSRANITENVYSQCRVSLKDFSLQVGAQESGC  373

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKT-VRIPALPAAASGQT  444
            LLPSLPSD + D+TTG+SFVCDLNDNIPAPWP++SQ   S+CNKT V+IPALPA ASGQT
Sbjct  374  LLPSLPSDVVFDRTTGVSFVCDLNDNIPAPWPASSQLPPSSCNKTAVKIPALPAVASGQT  433



>gb|KJB69284.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=457

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YVSHLQ+Q+ +TNLQALDCA SLG+KLQK N+T++VY+LCHI+LKDFS+QV  + SGCLL
Sbjct  318  YVSHLQKQTLITNLQALDCATSLGLKLQKYNITKDVYSLCHISLKDFSLQVGSQESGCLL  377

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PSLPSDA LD+ +GISF+CDLNDNIPA WPS S   AS+CNKT+RIPALPAA + Q+G
Sbjct  378  PSLPSDATLDKFSGISFICDLNDNIPAQWPSLSLLPASSCNKTIRIPALPAATNAQSG  435



>ref|XP_002304912.2| hypothetical protein POPTR_0004s01590g [Populus trichocarpa]
 gb|EEE85423.2| hypothetical protein POPTR_0004s01590g [Populus trichocarpa]
Length=440

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 5/120 (4%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +LGMKLQ++N+T++VY+LCHITLKDFS+Q     SGC
Sbjct  304  ESYVSHLQKQSLITNLQALDCATTLGMKLQRSNITKDVYSLCHITLKDFSLQ----ESGC  359

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++GISF+CDLNDNIPAPWPS SQ  A  CNKT++IPALPAAA+ Q+G
Sbjct  360  LLPSLPSDATFDHSSGISFICDLNDNIPAPWPSKSQLSAP-CNKTIKIPALPAAANAQSG  418



>ref|XP_009357443.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Pyrus x bretschneideri]
Length=449

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YV+HLQ+QS +TNLQALDCAASLGMKL+K+N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  309  DSYVAHLQKQSLITNLQALDCAASLGMKLRKSNITKNVYSLCHISLKDFSLQVGNQVSGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP+ SQ  AS+C+K V+IPALPAAAS ++G
Sbjct  369  LLPSLPSDATFD-SSGVSFLCDLNDNIPAPWPT-SQGAASSCSKHVKIPALPAAASAESG  426



>ref|XP_008371095.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Malus domestica]
Length=162

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 103/120 (86%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS +TNLQALDCAASLG KL+K+N+ ++VY+LC I+LKDFS+QV  +VSGC
Sbjct  23   ESYVAHLQKQSLITNLQALDCAASLGXKLRKSNIIEDVYSLCXISLKDFSLQVGNQVSGC  82

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP+ SQ  AS+C+K V+IPALPAAAS   G
Sbjct  83   LLPSLPSDAXFD-SSGVSFLCDLNDNIPAPWPT-SQGAASSCSKNVKIPALPAAASAGNG  140



>emb|CDY25331.1| BnaC01g30000D [Brassica napus]
Length=432

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+NV+++CHI+LKDFS+QV  + SGC
Sbjct  290  ESYVSHLQKQALITNLQALDCATSLGTKLQKLNITKNVFSVCHISLKDFSLQVGSQESGC  349

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI DQ TGISF CDLNDNIPAPWPS+S S  STC K V IPALPAAAS Q G
Sbjct  350  LLPSLPSDAIFDQDTGISFTCDLNDNIPAPWPSSSSSSDSTCKKPVTIPALPAAASSQPG  409



>ref|XP_008364804.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized GPI-anchored 
protein At1g61900-like [Malus domestica]
Length=213

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 102/120 (85%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS +TNLQ  DCAASLGMKL+K+N+ ++VY+LCHI+LKDFS+QV  + SGC
Sbjct  74   ESYVAHLQKQSLITNLQTXDCAASLGMKLRKSNIIEDVYSLCHISLKDFSLQVGNQASGC  133

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D + G+SF+CD NDNIPAPWP+ SQ  AS+CNK V+IPALPAAAS ++G
Sbjct  134  LLPSLPSDATFD-SXGVSFLCDXNDNIPAPWPT-SQGAASSCNKNVKIPALPAAASAESG  191



>ref|XP_002518489.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43876.1| conserved hypothetical protein [Ricinus communis]
Length=433

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 108/120 (90%), Gaps = 4/120 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA +LGM+LQK+N+T+NVY+LCHI+LKDFS+Q     SGC
Sbjct  296  DSYVSHLQKQTLITNLQALDCATTLGMELQKSNITRNVYSLCHISLKDFSLQE----SGC  351

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA LD+++GISF+CDLNDNIPAPWPS+SQ  AS+CNKTV+IPALPAAAS Q+G
Sbjct  352  LLPSLPSDATLDKSSGISFICDLNDNIPAPWPSSSQLSASSCNKTVKIPALPAAASAQSG  411



>gb|KJB69286.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=453

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YVSHLQ+Q+ +TNLQALDCA SLG+KLQK N+T++VY+LCHI+LKDFS+QV  + SGCLL
Sbjct  318  YVSHLQKQTLITNLQALDCATSLGLKLQKYNITKDVYSLCHISLKDFSLQVGSQESGCLL  377

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            PSLPSDA LD+ +GISF+CDLNDNIPA WPS S   AS+CNKT+RIPALPAA + Q+
Sbjct  378  PSLPSDATLDKFSGISFICDLNDNIPAQWPSLSLLPASSCNKTIRIPALPAATNAQS  434



>ref|XP_006391949.1| hypothetical protein EUTSA_v10023466mg [Eutrema salsugineum]
 gb|ESQ29235.1| hypothetical protein EUTSA_v10023466mg [Eutrema salsugineum]
Length=433

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+QV  + SGC
Sbjct  291  ESYVSHLQKQTLITNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQVGNQESGC  350

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI D+ +GISF CDLNDNIPAPWPS+S S ASTC K VRIPALPAAAS Q G
Sbjct  351  LLPSLPSDAIFDKDSGISFTCDLNDNIPAPWPSSSLSSASTCKKPVRIPALPAAASSQPG  410



>ref|XP_010430217.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Camelina 
sativa]
Length=434

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+QV  + SGC
Sbjct  292  ESYVSHLQKQTLMTNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQVGNQESGC  351

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI DQ TGISF CDLNDNIPAPWPS+SQS ASTC K VRIPALPAAAS Q
Sbjct  352  LLPSLPSDAIYDQDTGISFTCDLNDNIPAPWPSSSQSSASTCKKPVRIPALPAAASSQ  409



>ref|NP_176382.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8GUI4.1|UGPI6_ARATH RecName: Full=Uncharacterized GPI-anchored protein At1g61900; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAO00850.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP31921.1| At1g61900 [Arabidopsis thaliana]
 dbj|BAF02087.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|AEE33900.1| uncharacterized protein AT1G61900 [Arabidopsis thaliana]
Length=433

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+QV  + SGC
Sbjct  291  ESYVSHLQKQTLITNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQVGNQESGC  350

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI D+ TGISF CDLNDNIPAPWPS+S S ASTC K VRIPALPAAAS Q
Sbjct  351  LLPSLPSDAIFDKDTGISFTCDLNDNIPAPWPSSSLSSASTCKKPVRIPALPAAASSQ  408



>ref|XP_010473411.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Camelina sativa]
Length=433

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++ +CHI+LKDFS+QV  + SGC
Sbjct  293  ESYVSHLQKQTLMTNLQALDCATSLGTKLQKLNITKNIFTVCHISLKDFSLQVGNQESGC  352

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI DQ TGISF CDLNDNIPAPWPS+SQS ASTC K VRIPALPAAAS Q
Sbjct  353  LLPSLPSDAIYDQDTGISFTCDLNDNIPAPWPSSSQSSASTCKKPVRIPALPAAASSQ  410



>ref|XP_007147733.1| hypothetical protein PHAVU_006G150200g [Phaseolus vulgaris]
 gb|ESW19727.1| hypothetical protein PHAVU_006G150200g [Phaseolus vulgaris]
Length=452

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MKL+++N+T ++Y LCHI+LKDFS+QV  + +GC
Sbjct  310  ESYVSHLQKQSFITNLQALDCAETLAMKLKRSNITADIYGLCHISLKDFSLQVGNQEAGC  369

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWPS SQ  +S+CNK+V IPALPAAAS Q+
Sbjct  370  LLPSLPSDATFDKISGISFLCDLNDNIPAPWPSTSQLTSSSCNKSVNIPALPAAASSQS  428



>ref|XP_010278700.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nelumbo nucifera]
Length=455

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YVS LQ Q  +TNLQALDCAA LG+KLQKAN+T+NVY+LCHITLKDFS+QV  + SGCLL
Sbjct  316  YVSRLQSQRFITNLQALDCAAMLGIKLQKANITKNVYSLCHITLKDFSLQVGSQESGCLL  375

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            PSLPSDA  D+++GISF+CDLNDNI APWPS SQ  +S+CNKT+++PALPAA S Q
Sbjct  376  PSLPSDATFDKSSGISFLCDLNDNIAAPWPSTSQLPSSSCNKTIKLPALPAATSAQ  431



>ref|XP_003546148.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Glycine max]
Length=454

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MKL+++N+T +VY LCHI+LKDFS+QV  + +GC
Sbjct  313  ESYVSHLQKQSFITNLQALDCAEALAMKLKRSNITADVYGLCHISLKDFSLQVGNQEAGC  372

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D  +GISF+CDLNDNIPAPWPS SQ  +S+CNK++ IPALPAAAS Q+
Sbjct  373  LLPSLPSDATFDSISGISFLCDLNDNIPAPWPSTSQLTSSSCNKSIYIPALPAAASSQS  431



>gb|KHG11868.1| hypothetical protein F383_01404 [Gossypium arboreum]
Length=449

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 100/119 (84%), Gaps = 4/119 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA SLG+KLQ  N+T+NVY+LCHI+LKDFS+QV    SGC
Sbjct  313  DSYVSHLQKQTLITNLQALDCATSLGLKLQTYNITKNVYSLCHISLKDFSLQV----SGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  DQ +GISF+CDLNDNIPAPWP  S   AS+CNKTVRIPALPAA + Q+
Sbjct  369  LLPSLPSDATFDQFSGISFICDLNDNIPAPWPDPSLLPASSCNKTVRIPALPAATNAQS  427



>ref|XP_009361541.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009345554.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Pyrus x bretschneideri]
Length=430

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 105/120 (88%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS +TNLQALDCAASLGMKL+K+N+ ++VY+LC I+LKDFS+QV  +VSGC
Sbjct  309  ESYVAHLQKQSLITNLQALDCAASLGMKLRKSNIIEDVYSLCRISLKDFSLQVGNQVSGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP+ SQ  AS+C + VRIPALPAAAS ++G
Sbjct  369  LLPSLPSDATFD-SSGVSFLCDLNDNIPAPWPT-SQGAASSCGRNVRIPALPAAASAESG  426



>ref|XP_006858205.1| hypothetical protein AMTR_s00062p00176270 [Amborella trichopoda]
 gb|ERN19672.1| hypothetical protein AMTR_s00062p00176270 [Amborella trichopoda]
Length=424

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E Y+SHLQ+QS VTNLQAL+CAA LG +LQKAN+++NVYNLCHI+LKDFSVQV  + SGC
Sbjct  271  ENYISHLQKQSFVTNLQALNCAALLGRQLQKANISENVYNLCHISLKDFSVQVGSQESGC  330

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSD  LDQ TG+SF CDLNDNI APWPS SQ   S+CNK++ IPALPAA S Q
Sbjct  331  LLPSLPSDVTLDQ-TGVSFTCDLNDNIAAPWPSLSQVSTSSCNKSISIPALPAATSAQ  387



>ref|XP_006594428.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Glycine max]
Length=450

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MK++++N+T +VY LCHI+LKDFS+QV  + +GC
Sbjct  309  ESYVSHLQKQSFITNLQALDCAETLAMKMKRSNITADVYGLCHISLKDFSLQVGNQEAGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D  +GISF+CDLNDNIPAPWPS SQ  +S+CNK++ IPALPAAAS Q+
Sbjct  369  LLPSLPSDATFDSVSGISFLCDLNDNIPAPWPSTSQLTSSSCNKSINIPALPAAASSQS  427



>ref|XP_009361468.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345551.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345552.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345553.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Pyrus x bretschneideri]
Length=448

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 105/120 (88%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS +TNLQALDCAASLGMKL+K+N+ ++VY+LC I+LKDFS+QV  +VSGC
Sbjct  309  ESYVAHLQKQSLITNLQALDCAASLGMKLRKSNIIEDVYSLCRISLKDFSLQVGNQVSGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++G+SF+CDLNDNIPAPWP+ SQ  AS+C + VRIPALPAAAS ++G
Sbjct  369  LLPSLPSDATFD-SSGVSFLCDLNDNIPAPWPT-SQGAASSCGRNVRIPALPAAASAESG  426



>ref|XP_006597581.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Glycine max]
Length=473

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MKL+++N+T +VY LCHI+LKDFS+QV  + +GC
Sbjct  313  ESYVSHLQKQSFITNLQALDCAEALAMKLKRSNITADVYGLCHISLKDFSLQVGNQEAGC  372

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D  +GISF+CDLNDNIPAPWPS SQ  +S+CNK++ IPALPAAAS Q+
Sbjct  373  LLPSLPSDATFDSISGISFLCDLNDNIPAPWPSTSQLTSSSCNKSIYIPALPAAASSQS  431



>ref|XP_006301249.1| hypothetical protein CARUB_v10021649mg [Capsella rubella]
 gb|EOA34147.1| hypothetical protein CARUB_v10021649mg [Capsella rubella]
Length=430

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 4/118 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG+KLQK N+T+N++++CHI+LKDFS+Q     SGC
Sbjct  292  ESYVSHLQKQTLMTNLQALDCATSLGIKLQKLNITKNIFSVCHISLKDFSLQE----SGC  347

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI DQ TGISF CDLNDNIPAPWPS+SQS ASTC KTVRIPALPAAAS Q
Sbjct  348  LLPSLPSDAIFDQDTGISFTCDLNDNIPAPWPSSSQSSASTCKKTVRIPALPAAASSQ  405



>emb|CDY47167.1| BnaA01g22930D [Brassica napus]
Length=431

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG +LQK N+T+NV+++CHI+LKDFS+QV  + SGC
Sbjct  289  ESYVSHLQKQALITNLQALDCATSLGTELQKLNITKNVFSVCHISLKDFSLQVGSQESGC  348

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI DQ TGISF CDLNDNIPAPW S+S S ASTC K V IPALPAAAS Q G
Sbjct  349  LLPSLPSDAIFDQDTGISFTCDLNDNIPAPWSSSSSSSASTCKKPVTIPALPAAASSQPG  408



>ref|XP_009105804.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Brassica rapa]
Length=431

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG +LQK N+T+NV+++CHI+LKDFS+QV  + SGC
Sbjct  289  ESYVSHLQKQALITNLQALDCATSLGTELQKLNITKNVFSVCHISLKDFSLQVGSQESGC  348

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI DQ TGISF CDLNDNIPAPW S+S S ASTC K V IPALPAAAS Q G
Sbjct  349  LLPSLPSDAIFDQDTGISFTCDLNDNIPAPWSSSSSSSASTCKKPVTIPALPAAASSQPG  408



>gb|KEH36841.1| hypothetical protein MTR_2g022990 [Medicago truncatula]
Length=442

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 100/119 (84%), Gaps = 4/119 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MKL+K+NV  +VY+LCHI+LKDFS+Q      GC
Sbjct  305  ESYVSHLQKQSFITNLQALDCAETLAMKLKKSNVADDVYSLCHISLKDFSLQEY----GC  360

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDAI D T+G++F+CDLNDNIPAPWPS SQ  + +CNK+V IPALPAAASGQ+
Sbjct  361  LLPSLPSDAIFDSTSGVTFLCDLNDNIPAPWPSTSQLASKSCNKSVNIPALPAAASGQS  419



>ref|XP_004486118.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cicer arietinum]
Length=458

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MKL+K+N+  ++Y+LCHI+LKDFS+QV  + +GC
Sbjct  318  ESYVSHLQKQSFITNLQALDCAETLAMKLKKSNIADDIYSLCHISLKDFSLQVGNQEAGC  377

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LL SLPSD + D T+G+S +CDLNDNIPAPWPS SQ   S+CNK+V IPALPAAASGQ+
Sbjct  378  LLSSLPSDTVFDSTSGVSVLCDLNDNIPAPWPSISQVAGSSCNKSVNIPALPAAASGQS  436



>gb|KHG15461.1| hypothetical protein F383_19757 [Gossypium arboreum]
Length=471

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YVSHLQ+Q+ +TNLQALDCA SLG+KLQK N+T++VY+LCHI+LKDFS+Q     SGCLL
Sbjct  334  YVSHLQKQTLITNLQALDCATSLGLKLQKYNITKDVYSLCHISLKDFSLQE----SGCLL  389

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PSLPSDA LD+ +GISF+CDLNDNIPA WPS S   AS+CNKT+RIPALPAA + Q+G
Sbjct  390  PSLPSDATLDKFSGISFICDLNDNIPAQWPSLSLLPASSCNKTIRIPALPAATNAQSG  447



>ref|XP_008812638.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X5 [Phoenix dactylifera]
Length=387

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+LC ITLKDFS+QV  + SGC
Sbjct  246  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSLCQITLKDFSLQVGSQESGC  305

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSA ++  S+CNK++ +P LPAA S   G
Sbjct  306  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSAPEAPTSSCNKSINLPELPAATSAHIG  365



>gb|AFK46165.1| unknown [Lotus japonicus]
Length=223

 Score =   169 bits (429),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YV +LQ QS VTNLQA+ CA SLG KLQ+ANV+ NVYNLCHI+LKDFS+QV  +VSGC
Sbjct  82   KSYVPYLQEQSFVTNLQAMKCAVSLGKKLQEANVSNNVYNLCHISLKDFSLQVGSQVSGC  141

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI  +T+GI F+CDLNDNI APWPS S    S+CN+T  +P+LP A S Q G
Sbjct  142  LLPSLPSDAIFYRTSGIGFICDLNDNIVAPWPSTSYPLPSSCNRTTTLPSLPTATSSQNG  201



>ref|XP_010093283.1| hypothetical protein L484_006297 [Morus notabilis]
 gb|EXB53808.1| hypothetical protein L484_006297 [Morus notabilis]
Length=452

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA SLGMKL+K+N+T++VY+LCHI+LKDFS+Q      GC
Sbjct  316  ESYVSHLQKQSFITNLQALDCATSLGMKLRKSNITRDVYSLCHISLKDFSLQEY----GC  371

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPS+PSDA  D T+GISF+CDLNDNIPAPWP+ SQ  AS+C  TV+IPALPAA S Q+G
Sbjct  372  LLPSMPSDAAFD-TSGISFLCDLNDNIPAPWPNTSQVSASSCKTTVKIPALPAATSAQSG  430



>ref|XP_006449719.1| hypothetical protein CICLE_v10015200mg [Citrus clementina]
 gb|ESR62959.1| hypothetical protein CICLE_v10015200mg [Citrus clementina]
Length=456

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA  LG KLQK+++T +V+ LCHI+LKDF++Q     SGC
Sbjct  318  ESYVSHLQKQSLITNLQALDCATLLGTKLQKSSITADVFKLCHISLKDFTLQAE---SGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D+++GISF+CDLNDNIPAPWPS+S+    +CN +VRIPALPAAAS Q+G
Sbjct  375  LLPSLPSDATFDKSSGISFICDLNDNIPAPWPSSSRLPTQSCNSSVRIPALPAAASAQSG  434



>ref|XP_008812631.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Phoenix dactylifera]
Length=425

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+LC ITLKDFS+QV  + SGC
Sbjct  284  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSLCQITLKDFSLQVGSQESGC  343

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSA ++  S+CNK++ +P LPAA S   G
Sbjct  344  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSAPEAPTSSCNKSINLPELPAATSAHIG  403



>ref|XP_008812636.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X4 [Phoenix dactylifera]
Length=423

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+LC ITLKDFS+QV  + SGC
Sbjct  282  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSLCQITLKDFSLQVGSQESGC  341

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSA ++  S+CNK++ +P LPAA S   G
Sbjct  342  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSAPEAPTSSCNKSINLPELPAATSAHIG  401



>ref|XP_008812632.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008812633.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008812634.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008812635.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
Length=424

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+LC ITLKDFS+QV  + SGC
Sbjct  283  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSLCQITLKDFSLQVGSQESGC  342

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSA ++  S+CNK++ +P LPAA S   G
Sbjct  343  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSAPEAPTSSCNKSINLPELPAATSAHIG  402



>gb|KDO78212.1| hypothetical protein CISIN_1g012690mg [Citrus sinensis]
Length=437

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTP-EVSG  624
            E YVSHLQ+QS +TNLQALDCA  LG KLQK+++T +V+ LCHI+LKDF++Q    + SG
Sbjct  316  ESYVSHLQKQSLITNLQALDCATLLGTKLQKSSITADVFKLCHISLKDFTLQAAGNQESG  375

Query  623  CLLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            CLLPSLPSDA  D+++GISF+CDLNDNIPAPWPS+S+    +CN +VRIPALPAAAS Q+
Sbjct  376  CLLPSLPSDATFDKSSGISFICDLNDNIPAPWPSSSRLPTQSCNSSVRIPALPAAASAQS  435

Query  443  G  441
            G
Sbjct  436  G  436



>gb|KDO78211.1| hypothetical protein CISIN_1g012690mg [Citrus sinensis]
Length=458

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTP-EVSG  624
            E YVSHLQ+QS +TNLQALDCA  LG KLQK+++T +V+ LCHI+LKDF++Q    + SG
Sbjct  316  ESYVSHLQKQSLITNLQALDCATLLGTKLQKSSITADVFKLCHISLKDFTLQAAGNQESG  375

Query  623  CLLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            CLLPSLPSDA  D+++GISF+CDLNDNIPAPWPS+S+    +CN +VRIPALPAAAS Q+
Sbjct  376  CLLPSLPSDATFDKSSGISFICDLNDNIPAPWPSSSRLPTQSCNSSVRIPALPAAASAQS  435

Query  443  G  441
            G
Sbjct  436  G  436



>ref|XP_006467444.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Citrus sinensis]
Length=458

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTP-EVSG  624
            E YVSHLQ+QS +TNLQALDCA  LG KLQK+++T +V+ LCHI+LKDF++Q    + SG
Sbjct  316  ESYVSHLQKQSLITNLQALDCATLLGTKLQKSSITADVFKLCHISLKDFTLQAAGNQESG  375

Query  623  CLLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            CLLPSLPSDA  D+++GISF+CDLNDNIPAPWPS+S+    +CN +VRIPALPAAAS Q+
Sbjct  376  CLLPSLPSDATFDKSSGISFICDLNDNIPAPWPSSSRLPTQSCNSSVRIPALPAAASAQS  435

Query  443  G  441
            G
Sbjct  436  G  436



>ref|XP_008812630.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Phoenix dactylifera]
Length=441

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+LC ITLKDFS+QV  + SGC
Sbjct  300  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSLCQITLKDFSLQVGSQESGC  359

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSA ++  S+CNK++ +P LPAA S   G
Sbjct  360  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSAPEAPTSSCNKSINLPELPAATSAHIG  419



>gb|KHN33033.1| Putative GPI-anchored protein [Glycine soja]
Length=404

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 4/119 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MKL+++N+T +VY LCHI+LKDFS+Q     +GC
Sbjct  267  ESYVSHLQKQSFITNLQALDCAEALAMKLKRSNITADVYGLCHISLKDFSLQE----AGC  322

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D  +GISF+CDLNDNIPAPWPS SQ  +S+CNK++ IPALPAAAS Q+
Sbjct  323  LLPSLPSDATFDSISGISFLCDLNDNIPAPWPSTSQLTSSSCNKSIYIPALPAAASSQS  381



>ref|NP_001185289.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33902.1| uncharacterized protein AT1G61900 [Arabidopsis thaliana]
Length=429

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+Q     SGC
Sbjct  291  ESYVSHLQKQTLITNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQE----SGC  346

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI D+ TGISF CDLNDNIPAPWPS+S S ASTC K VRIPALPAAAS Q
Sbjct  347  LLPSLPSDAIFDKDTGISFTCDLNDNIPAPWPSSSLSSASTCKKPVRIPALPAAASSQ  404



>gb|AAC28508.1| ESTs gb|AA728658 and gb|N95943 come from this gene [Arabidopsis 
thaliana]
Length=421

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+Q     SGC
Sbjct  283  ESYVSHLQKQTLITNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQE----SGC  338

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI D+ TGISF CDLNDNIPAPWPS+S S ASTC K VRIPALPAAAS Q
Sbjct  339  LLPSLPSDAIFDKDTGISFTCDLNDNIPAPWPSSSLSSASTCKKPVRIPALPAAASSQ  396



>ref|XP_011463310.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS LQ QS +TNLQAL+CAASLG+KLQKANV+ NVY LCHI LKDFS+QV  +  GC
Sbjct  302  DSYVSQLQEQSFITNLQALNCAASLGVKLQKANVSNNVYQLCHINLKDFSLQVGSQEYGC  361

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLP+DA  D+T+G+SF+CDLNDNI APWPS+     STCN+T +IPA+P A S Q+G
Sbjct  362  LLPSLPTDATFDKTSGVSFICDLNDNIAAPWPSSFSEPPSTCNRTTKIPAVPKATSAQSG  421



>ref|XP_006467443.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Citrus sinensis]
Length=459

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 2/122 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPE--VS  627
            E YVSHLQ+QS +TNLQALDCA  LG KLQK+++T +V+ LCHI+LKDF++Q       S
Sbjct  316  ESYVSHLQKQSLITNLQALDCATLLGTKLQKSSITADVFKLCHISLKDFTLQAAGNQAES  375

Query  626  GCLLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            GCLLPSLPSDA  D+++GISF+CDLNDNIPAPWPS+S+    +CN +VRIPALPAAAS Q
Sbjct  376  GCLLPSLPSDATFDKSSGISFICDLNDNIPAPWPSSSRLPTQSCNSSVRIPALPAAASAQ  435

Query  446  TG  441
            +G
Sbjct  436  SG  437



>gb|KHN37599.1| Putative GPI-anchored protein [Glycine soja]
Length=438

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 4/119 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQALDCA +L MK++++N+T +VY LCHI+LKDFS+Q     +GC
Sbjct  301  ESYVSHLQKQSFITNLQALDCAETLAMKMKRSNITADVYGLCHISLKDFSLQE----AGC  356

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  D  +GISF+CDLNDNIPAPWPS SQ  +S+CNK++ IPALPAAAS Q+
Sbjct  357  LLPSLPSDATFDSVSGISFLCDLNDNIPAPWPSTSQLTSSSCNKSINIPALPAAASSQS  415



>ref|XP_006469765.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Citrus sinensis]
Length=403

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ QS +TNLQAL+CAASLGMKLQKANV+QNVY+LCHI LKDFS+QV  + SGC
Sbjct  260  ESYVSHLQEQSFITNLQALNCAASLGMKLQKANVSQNVYDLCHINLKDFSLQVGLQESGC  319

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLP D   D+T+GI F+CDLNDNI APWPSAS   A +CN+T ++PA P A   Q
Sbjct  320  LLPSLPLDVNYDKTSGIGFICDLNDNIEAPWPSASFVPAGSCNETSKLPARPTAKPSQ  377



>ref|XP_010923892.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Elaeis guineensis]
Length=505

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YV+HLQ+QS +TNLQALDCAA LG+KLQK NV  N+Y+ C ITLKDFS+QV  + SGC
Sbjct  364  DNYVAHLQKQSFITNLQALDCAALLGLKLQKMNVATNIYSFCQITLKDFSLQVGSQESGC  423

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++GISF CDLNDNI APWPSAS+   S+CNK+V +PALPAA S   G
Sbjct  424  LLPSLPSDATFDPSSGISFTCDLNDNIAAPWPSASRPPTSSCNKSVNLPALPAATSAHIG  483



>ref|XP_009105812.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Brassica rapa]
Length=429

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 2/120 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG +LQK N+T+NV+++CHI+LKDFS+QV  +  GC
Sbjct  289  ESYVSHLQKQALITNLQALDCATSLGTELQKLNITKNVFSVCHISLKDFSLQVGSQ--GC  346

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDAI DQ TGISF CDLNDNIPAPW S+S S ASTC K V IPALPAAAS Q G
Sbjct  347  LLPSLPSDAIFDQDTGISFTCDLNDNIPAPWSSSSSSSASTCKKPVTIPALPAAASSQPG  406



>ref|XP_010930048.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Elaeis guineensis]
Length=446

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+ C ITLKDFS+QV  + SGC
Sbjct  321  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSFCQITLKDFSLQVGSQESGC  380

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSAS +  S CNK+V +P LPAA S  
Sbjct  381  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSASGAPTSFCNKSVNLPELPAATSAH  438



>ref|XP_010930030.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=462

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+ C ITLKDFS+QV  + SGC
Sbjct  321  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSFCQITLKDFSLQVGSQESGC  380

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSAS +  S CNK+V +P LPAA S  
Sbjct  381  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSASGAPTSFCNKSVNLPELPAATSAH  438



>gb|EPS59099.1| hypothetical protein M569_15711, partial [Genlisea aurea]
Length=375

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E Y+SHLQRQS VTNLQAL+CAASLG+KL++AN+T+NVYN CH++LKDFS+QV  + SGC
Sbjct  271  ESYISHLQRQSFVTNLQALNCAASLGVKLRRANITENVYNQCHVSLKDFSLQVGAQESGC  330

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKT  486
            LLPSLPSD + D +TG+SF+CDLNDNIPAPWP+ +Q  AS+CNK+
Sbjct  331  LLPSLPSDVVFDASTGVSFLCDLNDNIPAPWPAKAQLPASSCNKS  375



>ref|XP_007132551.1| hypothetical protein PHAVU_011G104100g [Phaseolus vulgaris]
 gb|ESW04545.1| hypothetical protein PHAVU_011G104100g [Phaseolus vulgaris]
Length=445

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CAASLG KLQ ANV+++VYNLCHI+LKDFS+QV  + SGC
Sbjct  304  KSYVSYLQEQSFVTNLQALKCAASLGKKLQNANVSKDVYNLCHISLKDFSLQVGLQESGC  363

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPS+A+ D T+GI F+CDLNDNI APWP++S    S+CN+T ++P+LP A S Q G
Sbjct  364  LLPSLPSNAVFDGTSGIGFICDLNDNIVAPWPTSSYLLPSSCNRTTKLPSLPTATSSQNG  423



>ref|XP_006582352.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Glycine max]
Length=229

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS +TNLQAL CA SLG KLQ+ANV++NVY LC I+LKDFS+QV  + SGC
Sbjct  88   KSYVSYLQEQSFLTNLQALKCATSLGKKLQEANVSKNVYYLCRISLKDFSLQVGLQESGC  147

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LL SLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  148  LLTSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  207



>ref|XP_006582350.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Glycine max]
Length=234

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS +TNLQAL CA SLG KLQ+ANV++NVY LC I+LKDFS+QV  + SGC
Sbjct  87   KSYVSYLQEQSFLTNLQALKCATSLGKKLQEANVSKNVYYLCRISLKDFSLQVGLQESGC  146

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LL SLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  147  LLTSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  206



>ref|XP_006582351.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Glycine max]
Length=233

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS +TNLQAL CA SLG KLQ+ANV++NVY LC I+LKDFS+QV  + SGC
Sbjct  86   KSYVSYLQEQSFLTNLQALKCATSLGKKLQEANVSKNVYYLCRISLKDFSLQVGLQESGC  145

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LL SLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  146  LLTSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  205



>ref|XP_006582349.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Glycine max]
Length=235

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS +TNLQAL CA SLG KLQ+ANV++NVY LC I+LKDFS+QV  + SGC
Sbjct  88   KSYVSYLQEQSFLTNLQALKCATSLGKKLQEANVSKNVYYLCRISLKDFSLQVGLQESGC  147

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LL SLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  148  LLTSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  207



>gb|KEH29676.1| hypothetical protein MTR_4g048040 [Medicago truncatula]
Length=454

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQKANVT+N+Y+LCHI+LKDFS+QV  + SGC
Sbjct  313  KNYVSYLQGQSFVTNLQALKCAVSLGEKLQKANVTKNIYDLCHISLKDFSLQVGSQESGC  372

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D+T+GI F+CDLNDN+ APW S S +  S+CN+T ++P+LP + S Q G
Sbjct  373  LLPSLPSDASFDRTSGIGFICDLNDNVVAPWTSTSYALQSSCNRTTKLPSLPTSTSSQNG  432



>gb|KEH29677.1| hypothetical protein MTR_4g048040 [Medicago truncatula]
Length=462

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQKANVT+N+Y+LCHI+LKDFS+QV  + SGC
Sbjct  313  KNYVSYLQGQSFVTNLQALKCAVSLGEKLQKANVTKNIYDLCHISLKDFSLQVGSQESGC  372

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D+T+GI F+CDLNDN+ APW S S +  S+CN+T ++P+LP + S Q G
Sbjct  373  LLPSLPSDASFDRTSGIGFICDLNDNVVAPWTSTSYALQSSCNRTTKLPSLPTSTSSQNG  432



>ref|XP_010546889.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Tarenaya 
hassleriana]
Length=432

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS VTNLQALDCA+++G+KLQK NVT+N++++CHI+LKDFS+QV  +VSGC
Sbjct  287  ENYVSHLQKQSLVTNLQALDCASTMGLKLQKLNVTKNLFSICHISLKDFSIQVASQVSGC  346

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNI-PAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI D +TGISF CDLNDNI      S+SQS AS+CNKTVRIPALPAAAS Q
Sbjct  347  LLPSLPSDAIFDNSTGISFTCDLNDNIPAPWPSSSSQSPASSCNKTVRIPALPAAASSQ  405



>ref|NP_001143619.1| uncharacterized protein LOC100276335 precursor [Zea mays]
 gb|ACG33583.1| hypothetical protein [Zea mays]
Length=465

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YV+HLQ+QS +TNLQAL+CA+ LG KLQK NV+ NVY+ C ITLKDFS+QV  + SGCLL
Sbjct  323  YVAHLQKQSFITNLQALNCASFLGAKLQKMNVSMNVYSSCQITLKDFSLQVGSQESGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PS+PSDA  D T+GISF CDLNDNI APWPS+ Q+ +S+CNK+V IP  PAA S Q+G
Sbjct  383  PSMPSDASFDSTSGISFTCDLNDNIAAPWPSSMQAPSSSCNKSVNIPERPAATSAQSG  440



>tpg|DAA59335.1| TPA: hypothetical protein ZEAMMB73_763936 [Zea mays]
Length=465

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YV+HLQ+QS +TNLQAL+CA+ LG KLQK NV+ NVY+ C ITLKDFS+QV  + SGCLL
Sbjct  323  YVAHLQKQSFITNLQALNCASFLGAKLQKMNVSMNVYSSCQITLKDFSLQVGSQESGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PS+PSDA  D T+GISF CDLNDNI APWPS+ Q+ +S+CNK+V IP  PAA S Q+G
Sbjct  383  PSMPSDASFDSTSGISFTCDLNDNIAAPWPSSMQAPSSSCNKSVNIPERPAATSAQSG  440



>ref|XP_006592376.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X5 [Glycine max]
Length=444

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQ+ NV++NVYNLC I+LKDFS+QV  + SGC
Sbjct  297  KSYVSYLQEQSFVTNLQALKCATSLGKKLQQENVSKNVYNLCRISLKDFSLQVGLQESGC  356

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  357  LLPSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  416



>ref|XP_002461296.1| hypothetical protein SORBIDRAFT_02g000365 [Sorghum bicolor]
 gb|EER97817.1| hypothetical protein SORBIDRAFT_02g000365 [Sorghum bicolor]
Length=469

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YV+HLQ+QS +TNLQAL+CA+ LG KLQK NV+ NVY+ C ITLKDFS+QV  + SGCLL
Sbjct  327  YVAHLQKQSFITNLQALNCASFLGAKLQKMNVSTNVYSSCQITLKDFSLQVGSQESGCLL  386

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PS+PSDA  D T+GISF CDLNDNI APWPS+ Q+ +S+CNK+V IP  PAA S Q G
Sbjct  387  PSMPSDASFDSTSGISFTCDLNDNIAAPWPSSMQAPSSSCNKSVNIPERPAATSAQNG  444



>ref|XP_003539868.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Glycine max]
Length=456

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQ+ NV++NVYNLC I+LKDFS+QV  + SGC
Sbjct  315  KSYVSYLQEQSFVTNLQALKCATSLGKKLQQENVSKNVYNLCRISLKDFSLQVGLQESGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  375  LLPSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  434



>ref|XP_006592373.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Glycine max]
Length=462

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQ+ NV++NVYNLC I+LKDFS+QV  + SGC
Sbjct  315  KSYVSYLQEQSFVTNLQALKCATSLGKKLQQENVSKNVYNLCRISLKDFSLQVGLQESGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  375  LLPSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  434



>gb|KCW89408.1| hypothetical protein EUGRSUZ_A01709 [Eucalyptus grandis]
Length=452

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ QS +TNLQAL+CA  LGMKLQ+ANV++N+YNLCHI LKDFS+Q   + SGC
Sbjct  310  ESYVSHLQEQSFLTNLQALNCATYLGMKLQQANVSKNLYNLCHINLKDFSLQALSKESGC  369

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSA-SQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLPSDA  DQ +G+SF+CDLNDNI APWPS+ S     +CNKT +IPALP  +S   
Sbjct  370  LLPSLPSDATFDQMSGVSFICDLNDNIAAPWPSSTSLIPLPSCNKTGKIPALPKTSSAHR  429

Query  443  G  441
            G
Sbjct  430  G  430



>ref|XP_004987275.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Setaria italica]
Length=464

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YV+HLQ+QS +TNLQAL+CA+ LG KLQK NV+ NVY+ C ITLKDFS+QV  + SGCLL
Sbjct  322  YVAHLQKQSFITNLQALNCASFLGAKLQKMNVSTNVYSSCQITLKDFSLQVGSQESGCLL  381

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PS+PSDA  D+ +GISF CDLNDNI APWPS+ Q+ +S+CNK+V IP  PAA S Q G
Sbjct  382  PSMPSDASFDRISGISFTCDLNDNIAAPWPSSMQAPSSSCNKSVNIPERPAATSAQNG  439



>ref|XP_006657387.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Oryza brachyantha]
Length=403

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA  LG KLQK NV+ NVY+ C ITLKDFS+QV  + SGC
Sbjct  260  DSYVSHLQKQSFITNLQALDCAQFLGGKLQKMNVSMNVYSSCQITLKDFSLQVGSQESGC  319

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPS+PSDA  D  +GISF CDLNDNI APWPS+ Q+ +S+CNK+V IP  PAA S Q G
Sbjct  320  LLPSMPSDASFDPASGISFTCDLNDNIAAPWPSSMQA-SSSCNKSVNIPERPAATSAQNG  378



>ref|XP_006592374.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Glycine max]
 ref|XP_006592375.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Glycine max]
Length=446

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQ+ NV++NVYNLC I+LKDFS+QV  + SGC
Sbjct  315  KSYVSYLQEQSFVTNLQALKCATSLGKKLQQENVSKNVYNLCRISLKDFSLQVGLQESGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q
Sbjct  375  LLPSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQ  432



>ref|XP_010930038.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=458

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA+ LG+KLQK NVT N+Y+ C ITLKDFS+Q     SGC
Sbjct  321  DNYVSHLQKQSFITNLQALDCASLLGLKLQKMNVTTNIYSFCQITLKDFSLQE----SGC  376

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA+ D ++GISF CDLNDNI APWPSAS +  S CNK+V +P LPAA S  
Sbjct  377  LLPSLPSDAMFDPSSGISFTCDLNDNIAAPWPSASGAPTSFCNKSVNLPELPAATSAH  434



>gb|KJB67177.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
 gb|KJB67180.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=429

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+Q+ +TNLQALDCA +LG+KLQ  N+T+NVY+LCHI+LKDFS+QV  +VSGC
Sbjct  313  DSYVSHLQKQTLITNLQALDCATALGLKLQTYNITKNVYSLCHISLKDFSLQVGSQVSGC  372

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAA  456
            LLPSLPSDA  D+ +GISF+CDLNDNIPAPWP+ S   AS+CNK++   +L  AA
Sbjct  373  LLPSLPSDATFDKFSGISFICDLNDNIPAPWPNPSLLPASSCNKSMYSLSLLLAA  427



>ref|XP_009397174.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=461

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQAL CA  LG+KLQ+ NV+ N+Y+LC ITLKDFS+QV  + SGC
Sbjct  320  ENYVSHLQKQSFITNLQALSCATLLGLKLQEMNVSTNIYSLCQITLKDFSLQVGTQESGC  379

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSD   D ++G SF CDLNDNI APWPSASQ  +S+CNK+V  PALPAA S Q G
Sbjct  380  LLPSLPSDVTFDPSSGFSFTCDLNDNIAAPWPSASQISSSSCNKSVNFPALPAATSSQFG  439



>ref|XP_006389629.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
 gb|ERP48543.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
Length=440

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 94/111 (85%), Gaps = 5/111 (5%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS VTNLQAL+CA +LGMKLQ++N+T++VY+LCHITLKDFS+Q     SGC
Sbjct  318  ESYVSHLQKQSLVTNLQALNCATTLGMKLQRSNITKDVYSLCHITLKDFSLQ----ESGC  373

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPAL  468
            LLPSLPSDA  DQ +GISF+CDLNDNIPAPWPS SQ  AS CNK++  P+L
Sbjct  374  LLPSLPSDATFDQYSGISFICDLNDNIPAPWPSTSQLSAS-CNKSMSNPSL  423



>ref|XP_002886500.1| hypothetical protein ARALYDRAFT_475141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62759.1| hypothetical protein ARALYDRAFT_475141 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG+KLQK N+T+N++++CHI+LKDFS+QV  + SGC
Sbjct  291  ESYVSHLQKQTLITNLQALDCATSLGIKLQKLNITKNIFSVCHISLKDFSLQVGNQESGC  350

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDAI D+ TGISF CDLNDNIPAPWPS+SQS AS C K VRIPALPAAAS Q
Sbjct  351  LLPSLPSDAIFDKDTGISFTCDLNDNIPAPWPSSSQSSASACKKPVRIPALPAAASSQ  408



>gb|KCW89407.1| hypothetical protein EUGRSUZ_A01709 [Eucalyptus grandis]
Length=453

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 2/122 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ QS +TNLQAL+CA  LGMKLQ+ANV++N+YNLCHI LKDFS+Q   + SGC
Sbjct  310  ESYVSHLQEQSFLTNLQALNCATYLGMKLQQANVSKNLYNLCHINLKDFSLQALSKESGC  369

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSA-SQSHASTCNKTV-RIPALPAAASGQ  447
            LLPSLPSDA  DQ +G+SF+CDLNDNI APWPS+ S     +CNKT  +IPALP  +S  
Sbjct  370  LLPSLPSDATFDQMSGVSFICDLNDNIAAPWPSSTSLIPLPSCNKTAGKIPALPKTSSAH  429

Query  446  TG  441
             G
Sbjct  430  RG  431



>gb|KHN21235.1| Putative GPI-anchored protein [Glycine soja]
Length=452

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 4/120 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQ+ANV++NVYNLC I+LKDFS+Q     SGC
Sbjct  315  KSYVSYLQEQSFVTNLQALKCATSLGKKLQQANVSKNVYNLCRISLKDFSLQE----SGC  370

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPS+A+ D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  371  LLPSLPSNAVFDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  430



>ref|NP_001058682.1| Os07g0102300 [Oryza sativa Japonica Group]
 dbj|BAF20596.1| Os07g0102300 [Oryza sativa Japonica Group]
 dbj|BAG95285.1| unnamed protein product [Oryza sativa Japonica Group]
Length=441

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA  LG KLQK NV+ NVY+ C ITLKDFS+QV  + SGC
Sbjct  297  DSYVSHLQKQSFITNLQALDCAQFLGDKLQKMNVSMNVYSSCQITLKDFSLQVGSQESGC  356

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPS+PSDA  D  TGISF CDLNDNI APWPS+ Q+ +S+CNK+V IP  PAA S Q G
Sbjct  357  LLPSMPSDASFDPATGISFTCDLNDNIAAPWPSSMQASSSSCNKSVNIPERPAATSAQNG  416



>ref|XP_009408658.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=461

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQ+L CA+ LG+KLQ+ NV+ N+Y+LC I+LKDFS+QV  + SGC
Sbjct  320  ENYVSHLQKQSFITNLQSLGCASLLGLKLQEMNVSTNIYSLCQISLKDFSLQVGTQESGC  379

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D ++GISF CDLNDNI APWPSASQ+ +S+CNK+V  P+LPAA S Q G
Sbjct  380  LLPSLPSDATFDPSSGISFTCDLNDNIAAPWPSASQASSSSCNKSVNYPSLPAATSSQLG  439



>ref|XP_009590299.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + Y+S LQ+QS +TNLQAL+CA  LG KLQ+AN+T NV++LCH+ LKDFS+QV  + SGC
Sbjct  306  DSYLSRLQQQSFITNLQALNCATLLGKKLQEANITSNVFDLCHVNLKDFSLQVDAKESGC  365

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLP+D   DQ++GI F+CDLNDN+ APW SA    ASTCNKTV +P LP A S Q
Sbjct  366  LLPSLPTDLTYDQSSGIGFICDLNDNVAAPWSSAYSGAASTCNKTVALPELPKATSSQ  423



>ref|XP_010100635.1| hypothetical protein L484_001991 [Morus notabilis]
 gb|EXB83383.1| hypothetical protein L484_001991 [Morus notabilis]
Length=403

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 90/118 (76%), Gaps = 4/118 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YVS LQ QS +TN+QAL CA SLG +LQKANV+ NVYNLCH+ +KDFS+Q     SGCLL
Sbjct  268  YVSKLQEQSFITNVQALHCATSLGTELQKANVSNNVYNLCHVNIKDFSLQE----SGCLL  323

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            PSLPSD   D T+G+ F+CDLNDNI APWPS+S    S CN+T++IPA+P A S Q G
Sbjct  324  PSLPSDVTYDTTSGVGFICDLNDNIAAPWPSSSSKPVSFCNRTMKIPAIPKATSAQKG  381



>gb|KJB69287.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=468

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YVSHLQ+Q+ +TNLQALDCA SLG+KLQK N+T++VY+LCHI+LKDFS+QV  + SGCLL
Sbjct  318  YVSHLQKQTLITNLQALDCATSLGLKLQKYNITKDVYSLCHISLKDFSLQVGSQESGCLL  377

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTV  483
            PSLPSDA LD+ +GISF+CDLNDNIPA WPS S   AS+CNK++
Sbjct  378  PSLPSDATLDKFSGISFICDLNDNIPAQWPSLSLLPASSCNKSM  421



>ref|XP_009770909.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nicotiana sylvestris]
Length=464

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + Y+S LQ+QS +TNLQAL+CA  LG KLQ+ N+T NV++LCH+ LKDFS+QV  + SGC
Sbjct  321  DSYLSRLQQQSFITNLQALNCATLLGKKLQEVNITSNVFDLCHVNLKDFSLQVDEKESGC  380

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLP+D   DQ++GI F+CDLNDN+ APW SA    ASTCNKTV +P LP A S Q
Sbjct  381  LLPSLPTDLTYDQSSGIGFICDLNDNVAAPWSSAYSVAASTCNKTVSLPELPKATSSQ  438



>ref|NP_974068.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33901.1| uncharacterized protein AT1G61900 [Arabidopsis thaliana]
Length=413

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+Q+ +TNLQALDCA SLG KLQK N+T+N++++CHI+LKDFS+QV  + SGC
Sbjct  291  ESYVSHLQKQTLITNLQALDCATSLGTKLQKLNITKNIFSVCHISLKDFSLQVGNQESGC  350

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNK  489
            LLPSLPSDAI D+ TGISF CDLNDNIPAPWPS+S S ASTC K
Sbjct  351  LLPSLPSDAIFDKDTGISFTCDLNDNIPAPWPSSSLSSASTCKK  394



>ref|XP_009397173.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=462

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQ-VTPEVSG  624
            E YVSHLQ+QS +TNLQAL CA  LG+KLQ+ NV+ N+Y+LC ITLKDFS+Q V  + SG
Sbjct  320  ENYVSHLQKQSFITNLQALSCATLLGLKLQEMNVSTNIYSLCQITLKDFSLQAVGTQESG  379

Query  623  CLLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            CLLPSLPSD   D ++G SF CDLNDNI APWPSASQ  +S+CNK+V  PALPAA S Q 
Sbjct  380  CLLPSLPSDVTFDPSSGFSFTCDLNDNIAAPWPSASQISSSSCNKSVNFPALPAATSSQF  439

Query  443  G  441
            G
Sbjct  440  G  440



>gb|AES88114.2| hypothetical protein MTR_4g048040 [Medicago truncatula]
Length=477

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQKANVT+N+Y+LCHI+LKDFS+Q     SGC
Sbjct  313  KNYVSYLQGQSFVTNLQALKCAVSLGEKLQKANVTKNIYDLCHISLKDFSLQE----SGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            LLPSLPSDA  D+T+GI F+CDLNDN+ APW S S +  S+CN+T ++P+LP + S Q
Sbjct  369  LLPSLPSDASFDRTSGIGFICDLNDNVVAPWTSTSYALQSSCNRTTKLPSLPTSTSSQ  426



>ref|XP_006366594.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Solanum tuberosum]
Length=456

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+SHLQ+QS +TNLQAL+CA  LG KLQ+AN+T N+++LCH+ LKDFS+QV  + SGCLL
Sbjct  315  YLSHLQQQSFITNLQALNCATLLGKKLQEANITSNIFDLCHVNLKDFSLQVDEKESGCLL  374

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            PSLP+D   DQT+GI  +CDLNDN+ APW S     ASTCNKT  +P LP A S Q
Sbjct  375  PSLPTDLTYDQTSGIGIICDLNDNVAAPWSSPYSGAASTCNKTAALPELPKATSSQ  430



>ref|XP_008230068.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
 ref|XP_008230069.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
 ref|XP_008230070.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
Length=441

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS LQ+QS +TNLQAL+CAASLG+KLQKANV+ NVYNLCHI LKDFS+QV  +  GC
Sbjct  300  DSYVSQLQQQSFITNLQALNCAASLGVKLQKANVSNNVYNLCHINLKDFSLQVGSQEYGC  359

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLPSDA  D T GISF+CDLNDNI APWPS+S  H S+C KT ++PA+P A S Q+G
Sbjct  360  LLPSLPSDATYDITLGISFICDLNDNIAAPWPSSSSEHPSSCKKTTKLPAVPKATSAQSG  419



>dbj|BAD31837.1| unknown protein [Oryza sativa Japonica Group]
Length=437

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVSHLQ+QS +TNLQALDCA  LG KLQK NV+ NVY+ C ITLKDFS+Q     SGC
Sbjct  297  DSYVSHLQKQSFITNLQALDCAQFLGDKLQKMNVSMNVYSSCQITLKDFSLQE----SGC  352

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPS+PSDA  D  TGISF CDLNDNI APWPS+ Q+ +S+CNK+V IP  PAA S Q G
Sbjct  353  LLPSMPSDASFDPATGISFTCDLNDNIAAPWPSSMQASSSSCNKSVNIPERPAATSAQNG  412



>ref|XP_010323825.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum lycopersicum]
Length=438

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S LQ+QS +TNLQAL+CA  LG KLQ+AN+T N++++CH+ LKDFS+QV  + SGCL 
Sbjct  297  YLSRLQQQSFITNLQALNCATLLGKKLQEANITSNIFDICHVNLKDFSLQVDEKESGCLF  356

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            PSLP+D   DQT+GI F+CDLNDN+ APW S+  + ASTCNKT  +P LP A S Q
Sbjct  357  PSLPTDLTYDQTSGIGFICDLNDNVAAPWSSSYSNSASTCNKTAALPELPKATSSQ  412



>ref|XP_010323826.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum lycopersicum]
Length=437

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S LQ+QS +TNLQAL+CA  LG KLQ+AN+T N++++CH+ LKDFS+QV  + SGCL 
Sbjct  297  YLSRLQQQSFITNLQALNCATLLGKKLQEANITSNIFDICHVNLKDFSLQVDEKESGCLF  356

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQ  447
            PSLP+D   DQT+GI F+CDLNDN+ APW S+  + ASTCNKT  +P LP A S Q
Sbjct  357  PSLPTDLTYDQTSGIGFICDLNDNVAAPWSSSYSNSASTCNKTA-LPELPKATSSQ  411



>ref|XP_009408659.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=443

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YVSHLQ+QS +TNLQ+L CA+ LG+KLQ+ NV+ N+Y+LC I+LKDFS+QV  + SGC
Sbjct  320  ENYVSHLQKQSFITNLQSLGCASLLGLKLQEMNVSTNIYSLCQISLKDFSLQVGTQESGC  379

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTV  483
            LLPSLPSDA  D ++GISF CDLNDNI APWPSASQ+ +S+CNK V
Sbjct  380  LLPSLPSDATFDPSSGISFTCDLNDNIAAPWPSASQASSSSCNKLV  425



>ref|XP_003605917.1| GPI-anchored protein, putative [Medicago truncatula]
Length=626

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 4/106 (4%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS VTNLQAL CA SLG KLQKANVT+N+Y+LCHI+LKDFS+Q     SGC
Sbjct  313  KNYVSYLQGQSFVTNLQALKCAVSLGEKLQKANVTKNIYDLCHISLKDFSLQ----ESGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTV  483
            LLPSLPSDA  D+T+GI F+CDLNDN+ APW S S +  S+CN+++
Sbjct  369  LLPSLPSDASFDRTSGIGFICDLNDNVVAPWTSTSYALQSSCNRSM  414



>ref|XP_008379633.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Malus domestica]
Length=446

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS LQ QS +TNLQAL+CAASLG KL KANV+ NVYNLC I LKDFS+QV  +  GC
Sbjct  310  DSYVSRLQEQSFITNLQALNCAASLGEKLLKANVS-NVYNLCXINLKDFSLQVGSQEYGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
            LLPSLP DA  D+T+GISF+CDLNDN+ APWPS S    S+C KT +IPA+P A S Q+G
Sbjct  369  LLPSLPLDATYDKTSGISFICDLNDNVAAPWPSLSSESPSSCKKTTKIPAVPKATSAQSG  428



>ref|XP_008379634.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Malus domestica]
Length=441

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS LQ QS +TNLQAL+CAASLG KL KANV+ NVYNLC I LKDFS+QV  +  GC
Sbjct  310  DSYVSRLQEQSFITNLQALNCAASLGEKLLKANVS-NVYNLCXINLKDFSLQVGSQEYGC  368

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQT  444
            LLPSLP DA  D+T+GISF+CDLNDN+ APWPS S    S+C KT +IPA+P A S Q+
Sbjct  369  LLPSLPLDATYDKTSGISFICDLNDNVAAPWPSLSSESPSSCKKTTKIPAVPKATSAQS  427



>ref|XP_006582353.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X5 [Glycine max]
Length=222

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 13/120 (11%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + YVS+LQ QS +TNLQAL CA SLG KLQ+ANV++NVY LC I+LKDFS+QV  +V   
Sbjct  88   KSYVSYLQEQSFLTNLQALKCATSLGKKLQEANVSKNVYYLCRISLKDFSLQVGLQV---  144

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHASTCNKTVRIPALPAAASGQTG  441
                       D T+GI F+CDLNDNI APWP+ S S  S+CN+T ++P+LP A S Q G
Sbjct  145  ----------FDGTSGIGFICDLNDNIVAPWPTTSYSLPSSCNRTTKLPSLPTATSSQNG  194



>ref|XP_003557710.2| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Brachypodium 
distachyon]
Length=466

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            E YV+HLQ+QS +TNLQALDCA+ LG KLQ  NV+ NVY+ C  +LKDFS+QV  + SGC
Sbjct  315  ESYVTHLQKQSFITNLQALDCASFLGKKLQMMNVSMNVYSSCQTSLKDFSLQVGSQESGC  374

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQS  510
            LLPS+PSDA  D ++GISF CDLNDNI APWPS+ Q+
Sbjct  375  LLPSMPSDASFDPSSGISFTCDLNDNIAAPWPSSLQA  411



>ref|XP_004244742.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum lycopersicum]
Length=468

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q+Q  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  328  YISGIQKQMLITNRQAIICAAAFGFMLQKAGVMTNVYELCDVDLKDFSLQAYGQEEGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAA  459
             S P+D + D +TG SF CDLNDNI APWPS+S + + T C   + +PALP +
Sbjct  388  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSSAATSLTLCAPEMSLPALPTS  440



>ref|XP_006352201.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum tuberosum]
Length=468

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  328  YIAGIQKQMLITNRQAIICAAAFGFMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAA  459
             S P+D + D +TG SF CDLNDNI APWPS+S + + T C   + +PALP +
Sbjct  388  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSSTATSWTLCAPEMSLPALPTS  440



>ref|XP_009786452.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Nicotiana sylvestris]
Length=475

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +QRQ  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  328  YITGMQRQMLITNQQAIMCAAAFGSMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSA-SQSHASTCNKTVRIPALPAA  459
             S P+D + D +TG SF CDLNDNI APWPS+ + +  S C   + +PALP +
Sbjct  388  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSLTGTSFSLCAPEMSLPALPTS  440



>ref|XP_010324691.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum lycopersicum]
Length=467

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q+Q  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  328  YISGIQKQMLITNRQAIICAAAFGFMLQKAGVMTNVYELCDVDLKDFSLQAYGQ-EGCLL  386

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAA  459
             S P+D + D +TG SF CDLNDNI APWPS+S + + T C   + +PALP +
Sbjct  387  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSSAATSLTLCAPEMSLPALPTS  439



>ref|XP_006352202.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum tuberosum]
Length=467

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  328  YIAGIQKQMLITNRQAIICAAAFGFMLQKAGVMTNVYELCDVDLKDFSLQAYGQ-EGCLL  386

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAA  459
             S P+D + D +TG SF CDLNDNI APWPS+S + + T C   + +PALP +
Sbjct  387  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSSTATSWTLCAPEMSLPALPTS  439



>ref|XP_010909048.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Elaeis guineensis]
Length=468

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YV+ LQRQ  +TN QA++CA   G  LQK  VT ++Y LC++ LKDFS+Q   +  GCLL
Sbjct  329  YVATLQRQMLITNKQAINCATLFGSMLQKGGVTTDIYELCNVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQTG  441
             SLP+D I D  TG SF CDL+DNI APWP S+S    S C   + +PALP  ASG  G
Sbjct  388  RSLPTDIIFDNVTGFSFTCDLSDNIAAPWPSSSSLQSLSLCAPEMSLPALPLPASGSFG  446



>ref|XP_006356958.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum tuberosum]
Length=470

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  329  YITGIQKQMLITNRQAIICAAVFGYMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS-GQTG  441
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP + + G +G
Sbjct  389  RSLPADLVFDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTSQTLGSSG  448



>ref|XP_008226609.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Prunus mume]
Length=473

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q+Q  +TN QA+ CA   G  L+K  V +NVY LC + LKDFS+Q      GCLL
Sbjct  331  YISGIQKQMLITNKQAIICATVFGSMLRKGGVMENVYELCDVDLKDFSIQAAYGQQGCLL  390

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             SLPSD I D  TGISF+CDL+DNI APWPS+S   + + C   + +PALP A +
Sbjct  391  KSLPSDVIFDNVTGISFICDLSDNIAAPWPSSSSISSVSLCAPEMSLPALPTAET  445



>ref|XP_009786453.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Nicotiana sylvestris]
Length=474

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 77/115 (67%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +QRQ  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  328  YITGMQRQMLITNQQAIMCAAAFGSMLQKAGVMTNVYELCDVDLKDFSLQAYGQ-EGCLL  386

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSA-SQSHASTCNKTVRIPALPAAAS  453
             S P+D + D +TG SF CDLNDNI APWPS+ + +  S C   + +PALP + +
Sbjct  387  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSLTGTSFSLCAPEMSLPALPTSET  441



>ref|XP_010313112.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum lycopersicum]
Length=470

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  329  YITGIQKQMLITNRQAIICAAVFGYMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  389  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  441



>ref|XP_010313113.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum lycopersicum]
Length=470

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  329  YITGIQKQMLITNRQAIICAAVFGYMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  389  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  441



>ref|XP_006352204.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Solanum tuberosum]
Length=434

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  328  YIAGIQKQMLITNRQAIICAAAFGFMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST  498
             S P+D + D +TG SF CDLNDNI APWPS+S + + T
Sbjct  388  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSSTATSWT  426



>ref|XP_006352203.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Solanum tuberosum]
Length=452

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA+ G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  328  YIAGIQKQMLITNRQAIICAAAFGFMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST  498
             S P+D + D +TG SF CDLNDNI APWPS+S + + T
Sbjct  388  RSYPADLVYDNSTGFSFTCDLNDNIAAPWPSSSTATSWT  426



>ref|XP_009799550.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Nicotiana sylvestris]
Length=425

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  284  YITGIQKQMLITNRQAILCAAVFGSMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  343

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  344  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  396



>ref|XP_008788195.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008788196.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
Length=420

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ LQ+Q  +TN QA++CA   G  LQK  VT ++Y LC + LKDFS+Q   +  GCLL
Sbjct  281  YIATLQKQMLITNRQAINCATWFGSMLQKGGVTTDIYELCSVDLKDFSLQAYGQ-QGCLL  339

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQTG  441
             SLP+D I D  TG SF CDL+DNI APWP S+S    S C   + +PALP  ASG  G
Sbjct  340  RSLPTDIIFDNATGFSFTCDLSDNIAAPWPSSSSLQSLSLCAPEMSLPALPIPASGSFG  398



>emb|CDP16478.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 69/96 (72%), Gaps = 5/96 (5%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQV----TPE  633
            E Y+S LQ QS + NLQA +CA+   MKLQ AN++ ++YNL HI LKDFS QV    +PE
Sbjct  37   ESYMSRLQEQSFINNLQAENCASLPVMKLQGANISSSMYNLYHIKLKDFSPQVYHLYSPE  96

Query  632  VSGCLLPSLPSDAILDQTTGISFVCDLNDNIPAPWP  525
             SGCLLPSLPSD   + + GI F+CDLNDNI A WP
Sbjct  97   -SGCLLPSLPSDVTFNGSFGIGFICDLNDNIVASWP  131



>ref|XP_009799548.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Nicotiana sylvestris]
Length=466

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   + +GCLL
Sbjct  325  YITGIQKQMLITNRQAILCAAVFGSMLQKAGVMTNVYELCDVDLKDFSLQAYGQEAGCLL  384

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  385  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  437



>ref|XP_008226610.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Prunus mume]
Length=472

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q+Q  +TN QA+ CA   G  L+K  V +NVY LC + LKDFS+Q   +  GCLL
Sbjct  331  YISGIQKQMLITNKQAIICATVFGSMLRKGGVMENVYELCDVDLKDFSIQAYGQ-QGCLL  389

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             SLPSD I D  TGISF+CDL+DNI APWPS+S   + + C   + +PALP A +
Sbjct  390  KSLPSDVIFDNVTGISFICDLSDNIAAPWPSSSSISSVSLCAPEMSLPALPTAET  444



>ref|XP_008788193.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Phoenix dactylifera]
Length=468

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ LQ+Q  +TN QA++CA   G  LQK  VT ++Y LC + LKDFS+Q   +  GCLL
Sbjct  329  YIATLQKQMLITNRQAINCATWFGSMLQKGGVTTDIYELCSVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQTG  441
             SLP+D I D  TG SF CDL+DNI APWP S+S    S C   + +PALP  ASG  G
Sbjct  388  RSLPTDIIFDNATGFSFTCDLSDNIAAPWPSSSSLQSLSLCAPEMSLPALPIPASGSFG  446



>gb|KCW87646.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=312

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 2/112 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPE-VSGCL  618
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q   + V+GCL
Sbjct  169  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQVAGCL  228

Query  617  LPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP  465
            L S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP
Sbjct  229  LRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALP  280



>gb|ABB47928.2| expressed protein [Oryza sativa Japonica Group]
Length=472

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q   +  GCLL
Sbjct  333  YIATRQKQIFVTNLQAINCATMFGSMLQKAGVSNDIYELCDIDLKDFSLQAFGQ-QGCLL  391

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQTG  441
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP A  SG +G
Sbjct  392  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVAPTSGSSG  451



>ref|XP_010069258.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X5 [Eucalyptus grandis]
 gb|KCW87642.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=471

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q   + +GCLL
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQAGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP +
Sbjct  389  RSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALPTS  441



>gb|ABB47927.2| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG92746.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q   +  GCLL
Sbjct  333  YIATRQKQIFVTNLQAINCATMFGSMLQKAGVSNDIYELCDIDLKDFSLQAFGQ-QGCLL  391

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQTG  441
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP A  SG +G
Sbjct  392  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVAPTSGSSG  451



>ref|XP_006661999.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Oryza brachyantha]
Length=471

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 80/122 (66%), Gaps = 3/122 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
              Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q   +  GC
Sbjct  330  HSYIATRQKQIFVTNLQAINCATMFGSMLQKAGVSSDIYGLCDIDLKDFSLQAFGQ-QGC  388

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQ  447
            LL SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP A  SG 
Sbjct  389  LLRSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVAQPSGS  448

Query  446  TG  441
            +G
Sbjct  449  SG  450



>gb|EEE51310.1| hypothetical protein OsJ_32270 [Oryza sativa Japonica Group]
Length=441

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 79/120 (66%), Gaps = 8/120 (7%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q      GCLL
Sbjct  324  YIATRQKQIFVTNLQAINCATMFGSMLQKAGVSNDIYELCDIDLKDFSLQ------GCLL  377

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQTG  441
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP A  SG +G
Sbjct  378  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVAPTSGSSG  437



>gb|KEH16341.1| transmembrane protein, putative [Medicago truncatula]
Length=479

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  VTN QA+ CA   G  L+   V  NV+ LC + LKDFS+Q   +  GCLL
Sbjct  336  YIAGIQKQMLVTNKQAIICATQFGSMLRGGGVMTNVFELCDVDLKDFSIQAYRQDVGCLL  395

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS  453
             SLP D I D +TG+SF CDLNDNIPAPWP S+S +  S C   + +PALP + S
Sbjct  396  RSLPGDVIFDNSTGVSFTCDLNDNIPAPWPSSSSFTSLSLCAPEMSLPALPISQS  450



>ref|XP_006356959.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum tuberosum]
Length=469

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YITGIQKQMLITNRQAIICAAVFGYMLQKAGVMTNVYELCDVDLKDFSLQAYGQ-EGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS-GQTG  441
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP + + G +G
Sbjct  388  RSLPADLVFDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTSQTLGSSG  447



>ref|XP_002465025.1| hypothetical protein SORBIDRAFT_01g030650 [Sorghum bicolor]
 gb|EER92023.1| hypothetical protein SORBIDRAFT_01g030650 [Sorghum bicolor]
Length=463

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+   Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q   +  GCLL
Sbjct  324  YIGTRQKQIFVTNLQAINCATKFGSMLQKAGVVDDIYGLCDIDLKDFSLQAFGQ-QGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D + D TTGISF CDL+DNI APWP S+S    S C   + +PALP +   ++
Sbjct  383  RSLPTDIVFDNTTGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVSPKSES  440



>ref|XP_008657905.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Zea mays]
Length=463

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+   Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q      GCLL
Sbjct  324  YIGTRQKQIFVTNLQAINCATMFGSMLQKAGVVDDIYGLCDIDLKDFSLQADFGQQGCLL  383

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP +   ++
Sbjct  384  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVSPKSES  441



>ref|XP_004983827.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Setaria italica]
Length=463

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+   Q+Q  VTNLQA++CA   G  LQKA V +++Y LC I LKDFS+Q   +  GCLL
Sbjct  324  YIGTRQKQIFVTNLQAINCATMFGSMLQKAGVVEDIYGLCDIDLKDFSLQAFGQ-QGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQTG  441
             SLP+D   D TTGISF CDL+DNI APWP S+S    S C   + +PALP +  SG +G
Sbjct  383  RSLPTDIEFDNTTGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVSPKSGSSG  442



>ref|NP_001065159.1| Os10g0534100 [Oryza sativa Japonica Group]
 gb|ABB47926.2| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27073.1| Os10g0534100 [Oryza sativa Japonica Group]
Length=473

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q   +  GCLL
Sbjct  333  YIATRQKQIFVTNLQAINCATMFGSMLQKAGVSNDIYELCDIDLKDFSLQAFGQ-QGCLL  391

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP A
Sbjct  392  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVA  444



>gb|KCW87644.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=450

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVT-PEVSGCL  618
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q    +V+GCL
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQVAGCL  388

Query  617  LPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            L S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP +
Sbjct  389  LRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALPTS  442



>ref|XP_006661998.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Oryza brachyantha]
Length=472

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
              Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q   +  GC
Sbjct  330  HSYIATRQKQIFVTNLQAINCATMFGSMLQKAGVSSDIYGLCDIDLKDFSLQAFGQ-QGC  388

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            LL SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP A
Sbjct  389  LLRSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVA  443



>ref|XP_010068655.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X4 [Eucalyptus grandis]
 gb|KCW87638.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
 gb|KCW87639.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
 gb|KCW87640.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=472

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVT-PEVSGCL  618
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q    +V+GCL
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQVAGCL  388

Query  617  LPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            L S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP +
Sbjct  389  LRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALPTS  442



>ref|XP_006858875.1| hypothetical protein AMTR_s00066p00196830 [Amborella trichopoda]
 gb|ERN20342.1| hypothetical protein AMTR_s00066p00196830 [Amborella trichopoda]
Length=489

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 79/113 (70%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QAL+CA   G  L+K  V +N+Y LC I LKDFS+Q    + GCLL
Sbjct  345  YITSIQKQMLITNRQALNCATMFGSMLKKGGVKENIYELCGIDLKDFSLQAN-GLQGCLL  403

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D ++D +TG+SF CDL+DNI APWP S+S S  S C   + +PALP++
Sbjct  404  RSLPTDVVIDNSTGVSFTCDLSDNIAAPWPLSSSLSTLSLCAPEMSLPALPSS  456



>gb|KCW87634.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=467

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 2/112 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPE-VSGCL  618
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q   + V+GCL
Sbjct  324  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQVAGCL  383

Query  617  LPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP  465
            L S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP
Sbjct  384  LRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALP  435



>gb|AAM88643.1| hypothetical protein [Oryza sativa Japonica Group]
Length=459

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 7/113 (6%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q      GCLL
Sbjct  324  YIATRQKQIFVTNLQAINCATMFGSMLQKAGVSNDIYELCDIDLKDFSLQ------GCLL  377

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP A
Sbjct  378  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVA  430



>gb|KCW87635.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=489

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVT-PEVSGCL  618
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q    +V+GCL
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQVAGCL  388

Query  617  LPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            L S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP +
Sbjct  389  LRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALPTS  442



>ref|XP_010268250.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Nelumbo 
nucifera]
 ref|XP_010268252.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Nelumbo 
nucifera]
Length=467

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  N+Y LC + LKDFS+Q   E  GCLL
Sbjct  328  YIAGIQKQMLITNRQAINCATLFGSLLQKGGVMTNIYELCDVDLKDFSLQAYGE-QGCLL  386

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQTG  441
             SLP+D ++D +TG+SF CDL+DNI APWP S+S S  S C   + +PALP +  SG +G
Sbjct  387  RSLPADVVIDNSTGVSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPTSETSGNSG  446



>ref|XP_004250775.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Solanum lycopersicum]
Length=469

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YITGIQKQMLITNRQAIICAAVFGYMLQKAGVMTNVYELCDVDLKDFSLQAYGQ-EGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  388  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  440



>ref|XP_003574251.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Brachypodium distachyon]
 ref|XP_010234943.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Brachypodium distachyon]
Length=463

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
              Y++  Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q   +  GC
Sbjct  322  HSYIATRQKQLFVTNLQAINCATMFGSMLQKAGVGNDIYGLCDIDLKDFSLQAFGQ-QGC  380

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAA-SGQ  447
            LL SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP +  SG 
Sbjct  381  LLRSLPTDIVFDNITGISFTCDLSDNIAAPWPSSSSLQSLSLCAPEMSLPALPVSPLSGS  440

Query  446  TG  441
            +G
Sbjct  441  SG  442



>ref|XP_010234944.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Brachypodium distachyon]
Length=461

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
              Y++  Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q   +  GC
Sbjct  320  HSYIATRQKQLFVTNLQAINCATMFGSMLQKAGVGNDIYGLCDIDLKDFSLQAFGQ-QGC  378

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAA-SGQ  447
            LL SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP +  SG 
Sbjct  379  LLRSLPTDIVFDNITGISFTCDLSDNIAAPWPSSSSLQSLSLCAPEMSLPALPVSPLSGS  438

Query  446  TG  441
            +G
Sbjct  439  SG  440



>ref|XP_011091606.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Sesamum 
indicum]
Length=470

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +QRQ  +TN QA+ CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAGIQRQMLITNRQAIICATVFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-EGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
            PSLP+D + D +TG SF CDL DNI APWPS+S   + + C   + +PALP + +
Sbjct  388  PSLPADMVYDNSTGFSFTCDLRDNIAAPWPSSSSMTSISLCAPEMSLPALPKSET  442



>dbj|BAK07547.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=481

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + Y++  Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q   +  GC
Sbjct  339  QSYIATRQKQIFVTNLQAINCATMFGSMLQKAGVGNDIYGLCDIDLKDFSLQAFGQ-QGC  397

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            LL SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP +
Sbjct  398  LLRSLPTDIVFDNVTGISFTCDLSDNIAAPWPSSSSLQSLSLCAPEMSLPALPVS  452



>gb|EYU41043.1| hypothetical protein MIMGU_mgv1a005775mg [Erythranthe guttata]
Length=470

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +QRQ  +TN QA+ CA   G  LQK  V  NVY LC + +KDFS+Q   +  GCLL
Sbjct  329  YIASIQRQMLITNRQAIMCATMFGSMLQKGGVITNVYELCDVDIKDFSLQAYGQ-EGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAA-SGQTG  441
            PSLP+D + D +TG SF CDL+DNI APWPS+S   + + C   + +PALP +  SG  G
Sbjct  388  PSLPADMVYDNSTGFSFTCDLSDNIAAPWPSSSSMTSMSLCAPEMSLPALPTSQNSGNPG  447



>ref|XP_004983825.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Setaria italica]
 ref|XP_004983826.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Setaria italica]
Length=464

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+   Q+Q  VTNLQA++CA   G  LQKA V +++Y LC I LKDFS+Q   +  GCLL
Sbjct  324  YIGTRQKQIFVTNLQAINCATMFGSMLQKAGVVEDIYGLCDIDLKDFSLQAFGQ-QGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D   D TTGISF CDL+DNI APWP S+S    S C   + +PALP +
Sbjct  383  RSLPTDIEFDNTTGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVS  435



>ref|XP_010065950.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010066651.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Eucalyptus grandis]
 gb|KCW87636.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=475

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQ----VTPEVS  627
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q       +V+
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQEDAAYGQQVA  388

Query  626  GCLLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP  465
            GCLL S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP
Sbjct  389  GCLLRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALP  443



>gb|EYU41042.1| hypothetical protein MIMGU_mgv1a005775mg [Erythranthe guttata]
Length=471

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +QRQ  +TN QA+ CA   G  LQK  V  NVY LC + +KDFS+Q   +  GCLL
Sbjct  329  YIASIQRQMLITNRQAIMCATMFGSMLQKGGVITNVYELCDVDIKDFSLQAYGQ-EGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAA-SGQTG  441
            PSLP+D + D +TG SF CDL+DNI APWPS+S   + + C   + +PALP +  SG  G
Sbjct  388  PSLPADMVYDNSTGFSFTCDLSDNIAAPWPSSSSMTSMSLCAPEMSLPALPTSQNSGNPG  447



>ref|XP_009799547.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Nicotiana sylvestris]
Length=469

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YITGIQKQMLITNRQAILCAAVFGSMLQKAGVMTNVYELCDVDLKDFSLQAYGQ-EGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  388  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  440



>gb|EEC67358.1| hypothetical protein OsI_34458 [Oryza sativa Indica Group]
Length=468

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++  Q+Q  VTNLQA++CA   G  LQKA V+ ++Y LC I LKDFS+Q      GCLL
Sbjct  324  YIATRQKQIFVTNLQAINCATMFGSMLQKAGVSNDIYELCDIDLKDFSLQ------GCLL  377

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +P LP A
Sbjct  378  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPGLPVA  430



>ref|XP_002970227.1| hypothetical protein SELMODRAFT_33447, partial [Selaginella moellendorffii]
 gb|EFJ28357.1| hypothetical protein SELMODRAFT_33447, partial [Selaginella moellendorffii]
Length=324

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 6/96 (6%)
 Frame = -1

Query  797  KYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCL  618
            +Y+S +Q+Q  +TNLQAL+C + LG  LQK  VT N+Y+LC I LKDFS+Q      GCL
Sbjct  235  RYISEMQQQKLITNLQALECVSLLGSMLQKRGVTSNIYDLCGIYLKDFSLQ------GCL  288

Query  617  LPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQS  510
            L SLPSD ++  ++GI+F CDLNDNI APW   S S
Sbjct  289  LNSLPSDVMITSSSGITFTCDLNDNIAAPWMPMSSS  324



>ref|XP_010907817.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X5 [Elaeis guineensis]
Length=468

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  445



>ref|XP_008245345.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Prunus mume]
 ref|XP_008245347.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Prunus mume]
Length=471

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q      GCLL
Sbjct  329  YIAGIQKQMLITNRQAIVCATMFGSMLRKGGVMSNIYELCDVDLKDFSIQAAYGQQGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             SLPSD I D +TG SF CDL+DNI APWPS+S   + + C   + +PALP + +
Sbjct  389  RSLPSDMIFDNSTGYSFTCDLSDNIAAPWPSSSSISSFSLCGPEMSLPALPTSET  443



>ref|XP_010907821.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X8 [Elaeis guineensis]
Length=451

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  445



>ref|XP_009356791.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Pyrus x bretschneideri]
Length=473

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q+Q  +TN QA+ CA+  G  L+K  V +NVY LC I LKDFS+Q   +  GCLL
Sbjct  332  YISGIQKQMLITNRQAIICASVFGSMLRKGGVMENVYELCDIDLKDFSIQEYVQ-QGCLL  390

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             SLP+DAI+D TTG SF CDL+DN  APWPS+S   + + C   + +PALP + +
Sbjct  391  RSLPADAIIDNTTGFSFSCDLSDNTAAPWPSSSSVSSLSFCAPEMSLPALPTSET  445



>ref|XP_010907815.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Elaeis guineensis]
Length=468

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  445



>ref|XP_010907816.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Elaeis guineensis]
Length=468

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  445



>emb|CBI24633.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  LQK  V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  84   YIAGIQKQMLITNRQAIMCATMFGSMLQKGGVMTNIYELCDVDLKDFSLQAYGQ-QGCLL  142

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQTG  441
             SLP+D   D +TG SF CDL+DNI APWP S S S  S C   + +PALP +  SG +G
Sbjct  143  RSLPADVDFDNSTGFSFTCDLSDNIAAPWPSSTSISSLSLCAPEMSLPALPTSQTSGNSG  202



>ref|XP_010907822.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X9 [Elaeis guineensis]
Length=450

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  445



>ref|XP_010907818.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X6 [Elaeis guineensis]
Length=465

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  445



>ref|XP_010912780.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010912781.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=468

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 6/123 (5%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA  LG  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLLGSMLQKGGVMSNVYELCGVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPS-ASQSHASTCNKTVRIPALP----AAASG  450
             SLP+D +LD  TG SF CDL+DNI APWP+ +S S  S C   + +PALP    + +SG
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPASSSLSSLSLCAPEMSLPALPIPQTSRSSG  447

Query  449  QTG  441
              G
Sbjct  448  SCG  450



>ref|XP_010069980.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X6 [Eucalyptus grandis]
Length=470

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP +
Sbjct  388  RSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALPTS  440



>tpg|DAA46060.1| TPA: hypothetical protein ZEAMMB73_313399 [Zea mays]
Length=461

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 7/118 (6%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+   Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q      GCLL
Sbjct  324  YIGTRQKQIFVTNLQAINCATMFGSMLQKAGVVDDIYGLCDIDLKDFSLQ------GCLL  377

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP +   ++
Sbjct  378  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVSPKSES  435



>ref|XP_010907820.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X7 [Elaeis guineensis]
Length=463

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q      GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQ------GCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  383  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  440



>ref|XP_010912782.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=466

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA  LG  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLLGSMLQKGGVMSNVYELCGVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPS-ASQSHASTCNKTVRIPALP  465
             SLP+D +LD  TG SF CDL+DNI APWP+ +S S  S C   + +PALP
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPASSSLSSLSLCAPEMSLPALP  438



>ref|XP_011047725.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Populus 
euphratica]
 ref|XP_011047726.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Populus 
euphratica]
Length=469

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q Q  +TN QA+ CA  LG KL++  V  NVY LC I LKDFS+Q   +  GCLL
Sbjct  329  YMAGIQNQMLITNKQAIICATVLGSKLRQGGVMTNVYELCDIDLKDFSIQAYRQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQTG  441
             SLP D ILD +TG SF CDLNDNI APWP S+S S  S C   + +PALP +     G
Sbjct  388  RSLPPDVILDNSTGFSFTCDLNDNIEAPWPSSSSISTLSLCAPEMSLPALPTSQIKNPG  446



>ref|XP_010907812.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010907813.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=500

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  445



>gb|AFK40810.1| unknown [Lotus japonicus]
Length=274

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA+  G  L+   V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  133  YIAGIQKQMLITNKQAIICASLFGSMLRVGGVMTNIYELCDVDLKDFSIQAYGQ-QGCLL  191

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSA-SQSHASTCNKTVRIPALPAA  459
             SLP+D + D ++G SF CDL+DNI APWPS+ S +  S C   + +PALP +
Sbjct  192  RSLPADVVFDNSSGFSFTCDLSDNIAAPWPSSTSITSMSLCAPEMSLPALPTS  244



>ref|XP_009799549.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Nicotiana sylvestris]
Length=464

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 75/113 (66%), Gaps = 7/113 (6%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  LQKA V  NVY LC + LKDFS+Q      GCLL
Sbjct  329  YITGIQKQMLITNRQAILCAAVFGSMLQKAGVMTNVYELCDVDLKDFSLQ------GCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  383  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  435



>ref|XP_008657911.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Zea mays]
 tpg|DAA46061.1| TPA: hypothetical protein ZEAMMB73_313399 [Zea mays]
Length=462

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+   Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q   +  GCLL
Sbjct  324  YIGTRQKQIFVTNLQAINCATMFGSMLQKAGVVDDIYGLCDIDLKDFSLQDFGQ-QGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP +   ++
Sbjct  383  RSLPTDIVFDNATGISFTCDLSDNIAAPWPSSSSVQSLSLCAPEMSLPALPVSPKSES  440



>ref|XP_010912783.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Elaeis guineensis]
Length=460

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA  LG  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLLGSMLQKGGVMSNVYELCGVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPS-ASQSHASTCNKTVRIPALP  465
             SLP+D +LD  TG SF CDL+DNI APWP+ +S S  S C   + +PALP
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPASSSLSSLSLCAPEMSLPALP  438



>ref|XP_008800448.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Phoenix dactylifera]
Length=426

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 6/123 (5%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  287  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  345

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP----AAASG  450
             SLP+D +LD  TG+SF CDL+DNI APWP S+S S  S C   + +PALP    + +SG
Sbjct  346  RSLPADIVLDNVTGVSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIPQTSRSSG  405

Query  449  QTG  441
              G
Sbjct  406  SYG  408



>ref|XP_008800442.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Phoenix dactylifera]
Length=427

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 6/123 (5%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  288  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  346

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP----AAASG  450
             SLP+D +LD  TG+SF CDL+DNI APWP S+S S  S C   + +PALP    + +SG
Sbjct  347  RSLPADIVLDNVTGVSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIPQTSRSSG  406

Query  449  QTG  441
              G
Sbjct  407  SYG  409



>ref|XP_010907814.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=495

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q      GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQ------GCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP A + ++
Sbjct  383  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIAQTSRS  440



>ref|XP_002978387.1| hypothetical protein SELMODRAFT_108739 [Selaginella moellendorffii]
 gb|EFJ20373.1| hypothetical protein SELMODRAFT_108739 [Selaginella moellendorffii]
Length=379

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
             +Y+S +Q+Q  +TNLQAL+C + LG  LQK  VT N+Y+LC I LKDFS+Q      GC
Sbjct  240  HRYISEMQQQKLITNLQALECVSLLGSMLQKRGVTSNIYDLCGIYLKDFSLQ------GC  293

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQS  510
            LL SLPSD ++  ++GI+F CDLNDNI APW   S S
Sbjct  294  LLNSLPSDVMITSSSGITFTCDLNDNIAAPWMPMSTS  330



>ref|XP_008800397.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800406.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800412.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800419.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800427.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800435.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
Length=468

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 6/123 (5%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP----AAASG  450
             SLP+D +LD  TG+SF CDL+DNI APWP S+S S  S C   + +PALP    + +SG
Sbjct  388  RSLPADIVLDNVTGVSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIPQTSRSSG  447

Query  449  QTG  441
              G
Sbjct  448  SYG  450



>gb|EMT03898.1| hypothetical protein F775_11902 [Aegilops tauschii]
Length=542

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = -1

Query  800  EKYVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGC  621
            + Y++  Q+Q  VTNLQA++CA   G  LQKA V  ++Y LC I LKDFS+Q      GC
Sbjct  405  QSYIATRQKQIFVTNLQAINCATMFGSMLQKAGVGNDIYGLCDIDLKDFSLQ------GC  458

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            LL SLP+D + D  TGISF CDL+DNI APWP S+S    S C   + +PALP +
Sbjct  459  LLRSLPTDIVFDNVTGISFTCDLSDNIAAPWPSSSSLQSLSLCAPEMSLPALPVS  513



>ref|XP_009383433.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
Length=461

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  VT N+Y LC++ LKDFS+Q   +  GCLL
Sbjct  323  YIASIQKQMLITNRQAINCATFFGSMLQKGGVTTNIYELCNVDLKDFSLQSYGQ-QGCLL  381

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP  465
             SLP+D + D  TG SF CDL+DNI APWP S+S S  S C   + +PALP
Sbjct  382  RSLPADIVFDNVTGFSFTCDLSDNIAAPWPSSSSLSTFSLCAPEMSLPALP  432



>ref|XP_008800391.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Phoenix dactylifera]
Length=469

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 6/123 (5%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  330  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP----AAASG  450
             SLP+D +LD  TG+SF CDL+DNI APWP S+S S  S C   + +PALP    + +SG
Sbjct  389  RSLPADIVLDNVTGVSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPIPQTSRSSG  448

Query  449  QTG  441
              G
Sbjct  449  SYG  451



>gb|KEH16340.1| transmembrane protein, putative [Medicago truncatula]
Length=475

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  VTN QA+ CA   G  L+   V  NV+ LC + LKDFS+Q      GCLL
Sbjct  336  YIAGIQKQMLVTNKQAIICATQFGSMLRGGGVMTNVFELCDVDLKDFSIQDV----GCLL  391

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS  453
             SLP D I D +TG+SF CDLNDNIPAPWP S+S +  S C   + +PALP + S
Sbjct  392  RSLPGDVIFDNSTGVSFTCDLNDNIPAPWPSSSSFTSLSLCAPEMSLPALPISQS  446



>ref|XP_008386190.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Malus 
domestica]
Length=474

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+  +Q+Q  +TN QA+ CA+  G  L+K  V +NVY LC I LKDFSVQ      GCLL
Sbjct  332  YMLGIQKQMLITNRQAIICASVFGSMLRKGGVLENVYELCDIDLKDFSVQAEYMQQGCLL  391

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             +LP+D I D +TG SF CDL+DNI APWPS+S   + + C   + +PALP + +
Sbjct  392  RNLPADGIFDNSTGFSFTCDLSDNIAAPWPSSSSVSSLSFCAPEMSLPALPTSET  446



>gb|KDP43911.1| hypothetical protein JCGZ_20921 [Jatropha curcas]
Length=471

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ LQ+Q  +TN QA+ CA   G  L+KA V  N+Y LC I LKDFS+Q      GCLL
Sbjct  329  YIAGLQKQMLITNKQAIICATVFGSMLRKAGVMTNIYELCDIDLKDFSIQAVYGQQGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             S P+D + D +TG SF CDL DNI APWPS+S   + + C   + +PALP + +
Sbjct  389  RSWPADVVFDNSTGFSFTCDLTDNIAAPWPSSSSMSSLSFCAPEMSLPALPTSET  443



>gb|KCW87643.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=437

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = -1

Query  782  LQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPE-VSGCLLPSL  606
            +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q   + V+GCLL S 
Sbjct  298  IQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQVAGCLLRSF  357

Query  605  PSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP +
Sbjct  358  PADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALPTS  407



>ref|XP_011043593.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Populus euphratica]
Length=469

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q Q  +TN QA+ CA  LG KL++  V  NVY LC I LKDFS+Q   +  GCLL
Sbjct  329  YIAGIQNQMLITNKQAIICATVLGSKLRQGGVMTNVYELCDIDLKDFSIQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAA  459
             SLP+D ILD +TG SF CDL DNI APWPS+S   + + C   + +PALP +
Sbjct  388  RSLPADVILDNSTGFSFTCDLTDNIAAPWPSSSSVSSVSLCAPEMSLPALPTS  440



>ref|XP_010067401.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Eucalyptus grandis]
Length=474

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQ---VTPEVSG  624
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q      + +G
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQEDAAYGQQAG  388

Query  623  CLLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP  465
            CLL S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP
Sbjct  389  CLLRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALP  442



>ref|XP_009413428.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413429.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413430.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413431.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413432.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
Length=461

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 2/111 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            YV+ +Q+Q  +TN QA++CA   G  L+K  VT N+Y LC + LKDFS+Q   +  GCLL
Sbjct  323  YVASIQKQMLITNRQAINCATLFGSMLEKGGVTANIYELCKVDLKDFSLQSYGQ-QGCLL  381

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP  465
             SLP+D I D  TG SF CDL+DNI APWP S+S S  S C   + +PALP
Sbjct  382  RSLPADIIFDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALP  432



>ref|XP_009627075.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Nicotiana 
tomentosiformis]
Length=496

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  LQKA V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YITGIQKQMLITNRQAILCATVFGSMLQKAGVMINVYELCDVDLKDFSLQAYGQ-EGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             SLP+D + D +TG SF CDLNDNI APWP S+S +  S C   + +PALP +
Sbjct  388  RSLPADLVYDNSTGFSFTCDLNDNIAAPWPSSSSVTSLSLCAPEMSLPALPTS  440



>gb|EPS68793.1| hypothetical protein M569_05967, partial [Genlisea aurea]
Length=440

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+  +Q+Q  +TN QA+ C+  LG  L+K  V  N+++LC + L+DFS+QV  +  GCLL
Sbjct  314  YMDGVQKQMLITNRQAILCSIMLGSMLRKGGVMTNIFDLCDVDLEDFSLQVYGK-QGCLL  372

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAA-SGQTG  441
             SLP+D I D +TG SF CDL DNI APWP SA+ +  S C   + +PALP +  SG +G
Sbjct  373  GSLPTDMIYDNSTGFSFTCDLRDNIAAPWPSSATATTISLCATEMSLPALPTSQNSGISG  432



>ref|XP_008791793.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
 ref|XP_008791794.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
 ref|XP_008791795.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
 ref|XP_008791796.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
Length=468

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMSNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQT  444
             SLP+D +LD  TG SF CDL+DNI APWP S+S S  S C   + +PALP   + ++
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNIAAPWPSSSSLSSLSLCAPEMSLPALPVPQTSRS  445



>gb|KCW87641.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=456

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPE-VSGCL  618
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q   + V+GCL
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQAYGQQVAGCL  388

Query  617  LPSLPSDAILDQTTGISFVCDLNDNIPAPWP  525
            L S P+D I D TTG SF CDLNDNI APWP
Sbjct  389  LRSFPADVIFDNTTGYSFTCDLNDNIIAPWP  419



>ref|XP_010930241.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010930242.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=468

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 79/123 (64%), Gaps = 6/123 (5%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP----AAASG  450
             SLP+D +LD  TG SF CDL+DN+ APWP S+S S  S C   + +PALP    + +SG
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNVAAPWPSSSSLSSLSLCAPEMSLPALPIPQMSRSSG  447

Query  449  QTG  441
              G
Sbjct  448  SYG  450



>ref|XP_010068086.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Eucalyptus grandis]
 gb|KCW87637.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=473

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVS--GC  621
            Y++ +QRQ  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q        GC
Sbjct  329  YIAGIQRQMLITNKQAIICATMFGSMLRKGGVMTNIYELCDVDLKDFSIQEDAAYGQQGC  388

Query  620  LLPSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
            LL S P+D I D TTG SF CDLNDNI APWP S+S S  S C   + +PALP +
Sbjct  389  LLRSFPADVIFDNTTGYSFTCDLNDNIIAPWPSSSSVSSLSLCAPEMSLPALPTS  443



>ref|XP_008245348.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Prunus mume]
Length=470

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAGIQKQMLITNRQAIVCATMFGSMLRKGGVMSNIYELCDVDLKDFSIQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             SLPSD I D +TG SF CDL+DNI APWPS+S   + + C   + +PALP + +
Sbjct  388  RSLPSDMIFDNSTGYSFTCDLSDNIAAPWPSSSSISSFSLCGPEMSLPALPTSET  442



>ref|XP_010930243.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=454

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 2/111 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA++CA   G  LQK  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAAIQKQMLITNRQAINCATLFGSMLQKGGVMTNVYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALP  465
             SLP+D +LD  TG SF CDL+DN+ APWP S+S S  S C   + +PALP
Sbjct  388  RSLPADIVLDNVTGFSFTCDLSDNVAAPWPSSSSLSSLSLCAPEMSLPALP  438



>ref|XP_006410172.1| hypothetical protein EUTSA_v10016766mg [Eutrema salsugineum]
 gb|ESQ51625.1| hypothetical protein EUTSA_v10016766mg [Eutrema salsugineum]
Length=392

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  248  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  307

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  308  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  360



>ref|XP_006387769.1| hypothetical protein POPTR_0596s00200g, partial [Populus trichocarpa]
 gb|ERP46683.1| hypothetical protein POPTR_0596s00200g, partial [Populus trichocarpa]
Length=260

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 61/90 (68%), Gaps = 6/90 (7%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q Q  +TN QA+ CA  LG KL++  V  NVY LC I LKDFS+Q      GCLL
Sbjct  119  YMAGIQNQMLITNKQAIICATVLGSKLRQGGVMTNVYELCDIDLKDFSIQ------GCLL  172

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP  525
             SLP D ILD +TG SF CDLNDNI APWP
Sbjct  173  RSLPPDVILDNSTGFSFTCDLNDNIAAPWP  202



>ref|XP_006294137.1| hypothetical protein CARUB_v10023131mg [Capsella rubella]
 gb|EOA27035.1| hypothetical protein CARUB_v10023131mg [Capsella rubella]
Length=472

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  329  YISGIQNQMLITNKQAIVCATVIGAMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  388

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  389  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  441



>ref|XP_010469811.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Camelina 
sativa]
Length=466

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  323  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  383  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  435



>ref|XP_010414232.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Camelina sativa]
Length=466

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  323  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  383  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  435



>ref|XP_004152141.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 gb|KGN52997.1| hypothetical protein Csa_4G010960 [Cucumis sativus]
Length=474

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  332  YIAGIQKQMLITNKQAIICATMFGSMLRKGGVMTNVYELCDVDLKDFSIQAYGQ-QGCLL  390

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQ  447
             SLPSD + D +TG SF CDL DNI APWP S+S S  S C   + +PALP + + +
Sbjct  391  RSLPSDVVFDNSTGFSFTCDLTDNIAAPWPSSSSISTLSLCAPEMSLPALPTSETRR  447



>ref|XP_010510299.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Camelina sativa]
Length=466

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  323  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  383  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  435



>ref|XP_008454095.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Cucumis melo]
Length=475

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  332  YIAGIQKQMLITNKQAIICATMFGSMLRKGGVMTNVYELCDVDLKDFSIQAYGQ-QGCLL  390

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQ  447
             SLPSD + D +TG SF CDL DNI APWP S+S S  S C   + +PALP + + +
Sbjct  391  RSLPSDVVFDNSTGFSFTCDLTDNIAAPWPSSSSISTLSLCAPEMSLPALPTSETRR  447



>ref|XP_010510301.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Camelina sativa]
Length=480

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  337  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  396

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  397  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  449



>ref|XP_004156974.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
Length=475

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  332  YIAGIQKQMLITNKQAIICATMFGSMLRKGGVMTNVYELCDVDLKDFSIQAYGQ-QGCLL  390

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQ  447
             SLPSD + D +TG SF CDL DNI APWP S+S S  S C   + +PALP + + +
Sbjct  391  RSLPSDVVFDNSTGFSFTCDLTDNIAAPWPSSSSISTLSLCAPEMSLPALPTSETRR  447



>ref|XP_008454096.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Cucumis melo]
Length=474

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  332  YIAGIQKQMLITNKQAIICATMFGSMLRKGGVMTNVYELCDVDLKDFSIQAYGQ-QGCLL  390

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAASGQ  447
             SLPSD + D +TG SF CDL DNI APWP S+S S  S C   + +PALP + + +
Sbjct  391  RSLPSDVVFDNSTGFSFTCDLTDNIAAPWPSSSSISTLSLCAPEMSLPALPTSETRR  447



>ref|XP_010542708.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Tarenaya hassleriana]
Length=475

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  330  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  389

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  390  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  442



>emb|CDY23986.1| BnaC03g17050D [Brassica napus]
Length=460

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S ++ Q  +TN QA+ CA   G  L+K  V  NVY LC++ LKDFSVQ      GCLL
Sbjct  311  YISGIRNQMLITNKQAIVCATVFGSMLRKGGVMTNVYELCNVDLKDFSVQAYGMQQGCLL  370

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  371  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSVSSLSLCAPEMSLPALPTS  423



>gb|KFK31261.1| hypothetical protein AALP_AA6G089400 [Arabis alpina]
Length=468

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  323  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  382

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  383  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  435



>ref|XP_010542709.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Tarenaya hassleriana]
Length=469

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  324  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  383

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  384  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  436



>ref|XP_010094091.1| hypothetical protein L484_018108 [Morus notabilis]
 gb|EXB55181.1| hypothetical protein L484_018108 [Morus notabilis]
Length=464

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  NV+ LC + LKDFS+Q   +  GCLL
Sbjct  331  YIAGIQKQMLITNKQAIICATVFGSMLRKGGVITNVFELCDVDLKDFSIQAYGQ-QGCLL  389

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWPSASQSHAST-CNKTVRIPALPAAAS  453
             SLP+D ILD  TG SF CDL+DNI APWPS+S   + + C   + +PALP + +
Sbjct  390  RSLPTDVILDNVTGFSFTCDLSDNIAAPWPSSSSVSSISLCAPEMSLPALPTSET  444



>ref|XP_002273850.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Vitis 
vinifera]
Length=470

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  LQK  V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAGIQKQMLITNRQAIMCATMFGSMLQKGGVMTNIYELCDVDLKDFSLQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA-ASGQTG  441
             SLP+D   D +TG SF CDL+DNI APWP S S S  S C   + +PALP +  SG +G
Sbjct  388  RSLPADVDFDNSTGFSFTCDLSDNIAAPWPSSTSISSLSLCAPEMSLPALPTSQTSGNSG  447



>ref|XP_010522039.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Tarenaya hassleriana]
Length=482

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y+S +Q Q  +TN QA+ CA  +G  L+K  V  N+Y LC + LKDFSVQ      GCLL
Sbjct  337  YISGIQNQMLITNKQAIVCATVIGSMLRKGGVMTNIYELCDVDLKDFSVQAYGMQQGCLL  396

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAA  459
             S P+D I D TTG SF CDL DNI APWP S+S S  S C   + +PALP +
Sbjct  397  RSYPADLIFDNTTGYSFTCDLTDNIAAPWPSSSSMSSLSLCAPEMSLPALPTS  449



>gb|KJB37983.1| hypothetical protein B456_006G230000 [Gossypium raimondii]
Length=389

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CA   G  L+K  V  NVY LC + LKDFS+Q   +  GCLL
Sbjct  248  YIAGIQKQMLITNKQAIVCATMFGSILRKGGVMTNVYELCDVDLKDFSIQAYGQ-QGCLL  306

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS  453
             SLP+D I D +TG SF CDL DNI APWP S+S S  S C   + +PALP + +
Sbjct  307  RSLPADVIFDNSTGYSFTCDLTDNIGAPWPSSSSMSSLSLCAPEMSLPALPTSET  361



>gb|KDO50747.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50748.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50749.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50750.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50751.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
Length=470

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  L+K  V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAGVQKQMLITNKQAIICAAVFGSMLRKEGVMTNIYELCDVDLKDFSIQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS  453
             SLP+D +LD  TG SF CDL DNI APWP S+S S  S C   + +PALP + +
Sbjct  388  RSLPADVVLDNITGYSFTCDLTDNIAAPWPASSSASSLSLCAPEMSLPALPTSET  442



>ref|XP_006442928.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
 ref|XP_006442929.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
 ref|XP_006478823.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Citrus sinensis]
 ref|XP_006478824.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Citrus sinensis]
 gb|ESR56168.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
 gb|ESR56169.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
Length=470

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  L+K  V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAGVQKQMLITNKQAIICAAVFGSMLRKEGVMTNIYELCDVDLKDFSIQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS  453
             SLP+D +LD  TG SF CDL DNI APWP S+S S  S C   + +PALP + +
Sbjct  388  RSLPADVVLDNITGYSFTCDLTDNIAAPWPASSSASSLSLCAPEMSLPALPTSET  442



>ref|XP_006478825.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Citrus sinensis]
Length=468

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -1

Query  794  YVSHLQRQSXVTNLQALDCAASLGMKLQKANVTQNVYNLCHITLKDFSVQVTPEVSGCLL  615
            Y++ +Q+Q  +TN QA+ CAA  G  L+K  V  N+Y LC + LKDFS+Q   +  GCLL
Sbjct  329  YIAGVQKQMLITNKQAIICAAVFGSMLRKEGVMTNIYELCDVDLKDFSIQAYGQ-QGCLL  387

Query  614  PSLPSDAILDQTTGISFVCDLNDNIPAPWP-SASQSHASTCNKTVRIPALPAAAS  453
             SLP+D +LD  TG SF CDL DNI APWP S+S S  S C   + +PALP + +
Sbjct  388  RSLPADVVLDNITGYSFTCDLTDNIAAPWPASSSASSLSLCAPEMSLPALPTSET  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195