BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006L04

Length=792
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          368   1e-124   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     368   1e-124   Solanum tuberosum [potatoes]
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     364   4e-123   Nicotiana tomentosiformis
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     364   4e-123   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     364   4e-123   Nicotiana sylvestris
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    363   1e-122   Solanum tuberosum [potatoes]
ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     363   1e-122   Nicotiana sylvestris
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     363   2e-122   Sesamum indicum [beniseed]
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                359   3e-121   Erythranthe guttata [common monkey flower]
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          353   1e-118   Prunus mume [ume]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     352   1e-118   Pyrus x bretschneideri [bai li]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     352   2e-118   Cucumis sativus [cucumbers]
gb|EPS61043.1|  hypothetical protein M569_13757                         352   2e-118   Genlisea aurea
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             352   3e-118   Phaseolus vulgaris [French bean]
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             351   4e-118   Prunus persica
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          351   6e-118   Cucumis melo [Oriental melon]
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     351   7e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          350   2e-117   Vitis vinifera
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     349   2e-117   
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        347   2e-117   Prunus persica
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     349   2e-117   Glycine max [soybeans]
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    349   3e-117   Glycine max [soybeans]
gb|KHN31904.1|  Proteasome subunit beta type-5                          349   3e-117   Glycine soja [wild soybean]
gb|ACP43315.1|  20S proteasome beta subunit 5                           349   4e-117   Citrus maxima [buntan]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    349   4e-117   Citrus sinensis [apfelsine]
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             348   4e-117   Capsella rubella
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             348   6e-117   Citrus clementina [clementine]
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     348   8e-117   Fragaria vesca subsp. vesca
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             348   8e-117   Eutrema salsugineum [saltwater cress]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    348   8e-117   
gb|ACP43316.1|  20S proteasome beta subunit 5                           345   9e-117   Citrus maxima [buntan]
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         347   1e-116   Jatropha curcas
gb|KHG05622.1|  Proteasome subunit beta type-5                          347   1e-116   Gossypium arboreum [tree cotton]
gb|ACU23791.1|  unknown                                                 347   1e-116   Glycine max [soybeans]
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     347   2e-116   Nelumbo nucifera [Indian lotus]
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          347   3e-116   Nelumbo nucifera [Indian lotus]
gb|KJB15718.1|  hypothetical protein B456_002G192400                    347   3e-116   Gossypium raimondii
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     346   4e-116   Phoenix dactylifera
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          346   5e-116   Pyrus x bretschneideri [bai li]
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          346   5e-116   
emb|CDY34594.1|  BnaC03g56940D                                          345   7e-116   Brassica napus [oilseed rape]
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        345   8e-116   Eucalyptus grandis [rose gum]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     345   9e-116   Elaeis guineensis
gb|KHG25400.1|  Proteasome subunit beta type-5                          345   9e-116   Gossypium arboreum [tree cotton]
gb|KJB78067.1|  hypothetical protein B456_012G175200                    345   1e-115   Gossypium raimondii
emb|CDX98014.1|  BnaA06g07650D                                          345   1e-115   
emb|CDP13326.1|  unnamed protein product                                347   2e-115   Coffea canephora [robusta coffee]
emb|CDY19402.1|  BnaC05g09110D                                          345   2e-115   Brassica napus [oilseed rape]
emb|CDY21081.1|  BnaA08g24440D                                          345   2e-115   Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        345   2e-115   Brassica rapa
gb|AFK46055.1|  unknown                                                 344   2e-115   Lotus japonicus
ref|XP_010105786.1|  Proteasome subunit beta type-5                     344   2e-115   Morus notabilis
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             343   5e-115   
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             343   6e-115   Eutrema salsugineum [saltwater cress]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    343   7e-115   Brassica rapa
ref|XP_003602092.1|  Proteasome subunit beta type                       343   7e-115   Medicago truncatula
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        343   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    343   8e-115   Camelina sativa [gold-of-pleasure]
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     343   8e-115   Phoenix dactylifera
emb|CDY16054.1|  BnaC08g40690D                                          343   9e-115   Brassica napus [oilseed rape]
gb|AFK34329.1|  unknown                                                 342   2e-114   Medicago truncatula
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    342   2e-114   Brachypodium distachyon [annual false brome]
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    342   3e-114   Brassica rapa
ref|NP_189265.1|  proteasome subunit beta type-5-B                      341   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57921.1|  Proteasome subunit beta type-5                          339   5e-114   Triticum urartu
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    340   8e-114   Camelina sativa [gold-of-pleasure]
gb|AAU82107.1|  20S proteasome beta 5 subunit                           340   8e-114   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97061.1|  predicted protein                                      340   8e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          340   1e-113   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY26610.1|  BnaA09g46670D                                          339   2e-113   Brassica napus [oilseed rape]
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    339   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          339   3e-113   
ref|NP_172765.1|  20S proteasome beta subunit E1                        339   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             339   3e-113   Capsella rubella
gb|AAK92808.1|  putative proteasome epsilon chain precursor             339   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184978.1|  20S proteasome beta subunit E1                     340   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             338   5e-113   
gb|ABK25888.1|  unknown                                                 338   5e-113   Picea sitchensis
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     337   1e-112   Elaeis guineensis
gb|ABK25785.1|  unknown                                                 337   1e-112   Picea sitchensis
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    337   2e-112   Spinacia oleracea
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     337   2e-112   Cucumis sativus [cucumbers]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    337   3e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        336   3e-112   Tarenaya hassleriana [spider flower]
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        336   3e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    336   3e-112   Camelina sativa [gold-of-pleasure]
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       337   4e-112   Cucumis sativus [cucumbers]
gb|AFK38197.1|  unknown                                                 335   1e-111   Medicago truncatula
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          335   2e-111   Sorghum bicolor [broomcorn]
ref|NP_001132821.1|  uncharacterized protein LOC100194311               334   3e-111   Zea mays [maize]
gb|ABE68720.1|  20S proteasome beta subunit                             332   4e-111   Arachis hypogaea [goober]
dbj|BAG92607.1|  unnamed protein product                                330   1e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    333   1e-110   Setaria italica
gb|EEE65108.1|  hypothetical protein OsJ_20167                          332   2e-110   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       331   3e-110   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       331   4e-110   
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    331   4e-110   Populus euphratica
ref|XP_002312631.2|  20S proteasome beta subunit family protein         330   6e-110   
gb|EEC80034.1|  hypothetical protein OsI_21721                          330   9e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    330   1e-109   Oryza brachyantha
gb|ACJ85344.1|  unknown                                                 328   5e-109   Medicago truncatula
ref|XP_002315619.1|  20S proteasome beta subunit family protein         328   7e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    326   4e-108   Populus euphratica
emb|CAC43326.1|  putative beta5 proteasome subunit                      320   3e-107   Nicotiana tabacum [American tobacco]
gb|ACU51028.1|  20S proteasome beta5 subunit                            317   1e-104   Conocephalum conicum
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        341   4e-104   
ref|XP_001759925.1|  predicted protein                                  315   6e-104   
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             310   6e-102   Selaginella moellendorffii
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             308   3e-101   Selaginella moellendorffii
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     308   3e-101   Phoenix dactylifera
ref|NP_001265983.1|  proteasome subunit beta type-5-like                302   2e-99    Cicer arietinum [garbanzo]
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     301   2e-98    Elaeis guineensis
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    293   1e-95    
ref|XP_001751936.1|  predicted protein                                  289   3e-94    
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    284   2e-91    Ostreococcus tauri
ref|XP_003061052.1|  predicted protein                                  284   2e-91    Micromonas pusilla CCMP1545
ref|XP_002506817.1|  predicted protein                                  282   1e-90    Micromonas commoda
ref|XP_007514496.1|  predicted protein                                  280   1e-89    Bathycoccus prasinos
ref|XP_001421201.1|  predicted protein                                  278   6e-89    Ostreococcus lucimarinus CCE9901
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         272   2e-87    
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         270   3e-86    Coccomyxa subellipsoidea C-169
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              268   1e-85    Chlorella variabilis
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   260   4e-84    Brassica napus [oilseed rape]
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              263   2e-83    Volvox carteri f. nagariensis
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         261   9e-83    Chlamydomonas reinhardtii
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   257   4e-81    Auxenochlorella protothecoides
gb|KDD75121.1|  proteasome subunit protein                              251   3e-79    Helicosporidium sp. ATCC 50920
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              250   7e-79    Helobdella robusta
gb|EIE87710.1|  proteasome component PRE2                               248   9e-79    Rhizopus delemar RA 99-880
gb|EIE77859.1|  proteasome component PRE2                               249   5e-78    Rhizopus delemar RA 99-880
emb|CEG76257.1|  Putative Proteasome subunit beta type                  249   6e-78    Rhizopus microsporus
ref|XP_792356.3|  PREDICTED: proteasome subunit beta type-5-like        245   9e-78    
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             247   2e-77    Lottia gigantea
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like     246   9e-77    Aplysia californica
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like     245   1e-76    Latimeria chalumnae
gb|KFH71396.1|  20S proteasome subunit beta 5                           244   3e-76    Mortierella verticillata NRRL 6337
gb|AAI55951.1|  LOC100127332 protein                                    243   4e-76    Xenopus laevis [clawed frog]
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like     244   4e-76    Crassostrea gigas
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  244   4e-76    
gb|ADQ00176.1|  20S proteasome beta subunit E type beta 5               240   5e-76    Chlamydomonas sp. ICE-L
gb|AAY98499.1|  LMP X                                                   243   9e-76    Swiftia exserta
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          243   1e-75    Xenopus tropicalis [western clawed frog]
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              242   2e-75    Batrachochytrium dendrobatidis JAM81
gb|AAL74417.1|  proteosome PSMB5/8 protein                              239   2e-75    Branchiostoma lanceolatum [common lancelet]
ref|XP_004994692.1|  LMP X protein                                      243   2e-75    Salpingoeca rosetta
gb|ABQ50544.1|  hypothetical protein                                    240   3e-75    Brassica rapa
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Python bivittatus
ref|XP_002678668.1|  predicted protein                                  243   3e-75    Naegleria gruberi strain NEG-M
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 242   3e-75    Guillardia theta CCMP2712
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    239   4e-75    Mus musculus [mouse]
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  241   6e-75    Capitella teleta
emb|CAA66312.1|  LMP7-like protein                                      241   7e-75    Geodia cydonium
emb|CDH56820.1|  20s proteasome subunit                                 241   8e-75    Lichtheimia corymbifera JMRC:FSU:9682
gb|AAM18885.1|AF391293_2  unknown                                       241   1e-74    Branchiostoma floridae
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     241   1e-74    Saccoglossus kowalevskii
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    240   1e-74    
ref|XP_001730616.1|  hypothetical protein MGL_2412                      241   1e-74    Malassezia globosa CBS 7966
emb|CAA66313.1|  LMP7-like protein                                      240   1e-74    Botryllus schlosseri
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          240   1e-74    Cynoglossus semilaevis [half-smooth tongue sole]
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  237   2e-74    Homo sapiens [man]
emb|CEP17612.1|  hypothetical protein                                   240   2e-74    Parasitella parasitica
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    237   2e-74    Bos taurus [bovine]
dbj|BAE93066.1|  low molecular mass polypeptide                         237   2e-74    Lethenteron camtschaticum [Japanese lamprey]
ref|XP_002179855.1|  predicted protein                                  240   2e-74    Phaeodactylum tricornutum CCAP 1055/1
gb|EPY87607.1|  proteasome subunit beta type-5-like isoform 1           237   3e-74    Camelus ferus
gb|ADL27419.1|  proteasome subunit beta type                            239   3e-74    Pheronema raphanus
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    240   3e-74    Capsaspora owczarzaki ATCC 30864
ref|XP_001745267.1|  hypothetical protein                               238   3e-74    Monosiga brevicollis MX1
gb|EFA82937.1|  proteasome subunit beta type 5                          239   3e-74    Heterostelium album PN500
dbj|BAA08204.1|  proteasome subunit RCX                                 237   3e-74    Rattus rattus [house rat]
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          239   3e-74    Stegastes partitus
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          239   3e-74    Dasypus novemcinctus
dbj|BAA06097.1|  proteasome subunit X                                   237   4e-74    Homo sapiens [man]
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    236   4e-74    synthetic construct
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    236   5e-74    
dbj|GAM19629.1|  hypothetical protein SAMD00019534_028040               239   6e-74    Acytostelium subglobosum LB1
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          238   8e-74    Chrysochloris asiatica
gb|EWM22648.1|  proteasome subunit beta type 5                          238   1e-73    Nannochloropsis gaditana
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          237   1e-73    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          237   2e-73    Loxodonta africana [African bush elephant]
ref|XP_001626004.1|  predicted protein                                  238   2e-73    Nematostella vectensis
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     238   2e-73    Hydra vulgaris
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          237   2e-73    Trichechus manatus latirostris
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    235   2e-73    
gb|EFX81688.1|  hypothetical protein DAPPUDRAFT_303318                  237   2e-73    Daphnia pulex
dbj|GAN10935.1|  20S proteasome subunit                                 237   2e-73    Mucor ambiguus
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    236   2e-73    Pantholops hodgsonii [Tibetan antelope]
gb|EPB87271.1|  proteasome component PRE2                               237   2e-73    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    236   3e-73    Orycteropus afer afer
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          236   3e-73    Sarcophilus harrisii
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          234   3e-73    
ref|NP_001032701.1|  proteasome subunit beta type-5                     236   3e-73    Bos taurus [bovine]
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          236   3e-73    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ELR56586.1|  Proteasome subunit beta type-5                          236   3e-73    Bos mutus
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     237   3e-73    Haplochromis burtoni
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          236   3e-73    Bubalus bubalis [domestic water buffalo]
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          236   3e-73    Ovis aries [domestic sheep]
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     236   3e-73    
ref|XP_005707411.1|  20S proteasome subunit beta 5                      237   3e-73    Galdieria sulphuraria
gb|KFH65162.1|  20S proteasome subunit beta 5                           237   3e-73    Mortierella verticillata NRRL 6337
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5          237   4e-73    Anolis carolinensis [Carolina anole]
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     237   4e-73    Pundamilia nyererei
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     236   4e-73    Oreochromis niloticus
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          236   4e-73    Peromyscus maniculatus bairdii
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     236   4e-73    Myotis brandtii
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          236   5e-73    Callithrix jacchus [common marmoset]
ref|NP_035316.1|  proteasome subunit beta type-5                        236   5e-73    Mus musculus [mouse]
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             219   5e-73    
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          236   5e-73    Saimiri boliviensis boliviensis
gb|EPY26658.1|  20S proteasome subunit beta 5                           234   5e-73    Angomonas deanei
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 237   5e-73    Cyanidioschyzon merolae strain 10D
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          236   6e-73    Ursus maritimus [white bear]
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    236   6e-73    Mus musculus [mouse]
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          236   6e-73    Ailuropoda melanoleuca
dbj|BAA10932.1|  LMPX of lamprey                                        236   6e-73    Petromyzon marinus [marine lamprey]
ref|XP_002050049.1|  GJ21921                                            236   6e-73    Drosophila virilis
gb|ADO27969.1|  proteasome subunit beta type-5                          236   6e-73    Ictalurus furcatus
ref|NP_001099197.2|  proteasome subunit beta type-5                     235   7e-73    Rattus norvegicus [brown rat]
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          235   7e-73    Monodelphis domestica
ref|XP_001568804.1|  putative proteasome beta 5 subunit                 236   8e-73    Leishmania braziliensis MHOM/BR/75/M2904
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    235   8e-73    Rattus norvegicus [brown rat]
emb|CBY21147.1|  unnamed protein product                                236   8e-73    Oikopleura dioica
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5          235   8e-73    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    235   8e-73    Condylura cristata
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    235   9e-73    Lipotes vexillifer [baiji]
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          235   9e-73    Felis catus [cat]
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          235   9e-73    Rhinopithecus roxellana
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          235   9e-73    Myotis lucifugus
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    235   9e-73    Physeter catodon
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    235   1e-72    Orcinus orca [Orca]
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          235   1e-72    Vicugna pacos
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          235   1e-72    Odobenus rosmarus divergens
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          235   1e-72    Balaenoptera acutorostrata scammoni
dbj|BAA10935.1|  nurse shark LMPX                                       235   1e-72    Ginglymostoma cirratum
ref|XP_010703107.1|  proteasome beta 5 subunit, putative                236   1e-72    Leishmania panamensis
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    235   1e-72    Eptesicus fuscus
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          235   1e-72    Myotis davidii
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              235   1e-72    Trichoplax adhaerens
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    235   1e-72    Nomascus leucogenys [White-cheeked Gibbon]
gb|EPY20654.1|  20S proteasome subunit beta 5                           236   1e-72    Strigomonas culicis
gb|EFX80663.1|  hypothetical protein DAPPUDRAFT_303852                  235   1e-72    Daphnia pulex
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              235   1e-72    Homo sapiens [man]
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5          235   1e-72    Camelus ferus
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          235   1e-72    Cavia porcellus [guinea pig]
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    234   1e-72    
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    234   1e-72    Gorilla gorilla gorilla [lowland gorilla]
gb|ETE64662.1|  Proteasome subunit beta type-5                          236   1e-72    Ophiophagus hannah
ref|NP_001247774.1|  proteasome subunit beta type-5                     234   1e-72    Macaca mulatta [rhesus macaque]
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          235   1e-72    
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          234   1e-72    Galeopterus variegatus [Malayan flying lemur]
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    234   1e-72    Chlorocebus sabaeus
emb|CAD97956.1|  hypothetical protein                                   235   1e-72    Homo sapiens [man]
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    235   1e-72    
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          234   1e-72    Equus przewalskii [Przewalski horse]
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          234   1e-72    Cricetulus griseus [Chinese hamsters]
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     235   2e-72    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    Tupaia chinensis
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    Pteropus alecto
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    Microtus ochrogaster [prairie voles]
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    234   2e-72    Oryctolagus cuniculus [domestic rabbit]
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          234   2e-72    Sus scrofa [pigs]
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    Carlito syrichta
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    Canis lupus familiaris [dogs]
emb|CAF97719.1|  unnamed protein product                                234   2e-72    Tetraodon nigroviridis
gb|AAW24786.1|  SJCHGC05978 protein                                     234   2e-72    Schistosoma japonicum
ref|XP_004054985.1|  PREDICTED: proteasome subunit beta type-5 is...    234   2e-72    
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    Octodon degus
gb|AAB33092.1|  proteasome subunit MB1                                  232   3e-72    Homo sapiens [man]
dbj|BAB26942.1|  unnamed protein product                                234   3e-72    Mus musculus [mouse]
ref|XP_009311762.1|  proteasome beta 5 subunit                          236   3e-72    Trypanosoma grayi
ref|XP_001686739.1|  putative proteasome beta 5 subunit                 235   3e-72    Leishmania major strain Friedlin
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    234   3e-72    Pantholops hodgsonii [Tibetan antelope]
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          233   4e-72    Myotis brandtii
ref|XP_011391773.1|  putative proteasome core particle subunit be...    234   4e-72    Ustilago maydis 521
gb|EPY31554.1|  20S proteasome subunit beta 5                           234   4e-72    Angomonas deanei
gb|KGB40340.1|  Proteasome subunit beta type-5                          231   4e-72    Schistosoma haematobium
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like     234   4e-72    
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          233   5e-72    Fukomys damarensis [Damara mole rat]
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          233   5e-72    
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          233   5e-72    
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          233   5e-72    
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    233   5e-72    
ref|XP_002033298.1|  GM21240                                            234   6e-72    
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like     233   6e-72    
ref|XP_002080955.1|  GD10758                                            234   6e-72    
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               234   7e-72    
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          233   7e-72    
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                231   7e-72    
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         233   7e-72    
ref|XP_001469755.1|  putative proteasome beta 5 subunit                 234   7e-72    
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          233   8e-72    
gb|ERE89366.1|  proteasome subunit beta type-5-like protein             234   1e-71    
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5          232   1e-71    
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    232   1e-71    
emb|CAX70714.1|  proteasome (prosome, macropain) subunit, beta ty...    232   1e-71    
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          232   1e-71    
gb|EPY36607.1|  20S proteasome subunit beta 5                           234   1e-71    
ref|XP_004358358.1|  proteasome subunit beta type 5                     233   1e-71    
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      234   1e-71    
gb|AGG11598.1|  hypothetical protein                                    233   1e-71    
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5          232   2e-71    
emb|CCC93748.1|  proteasome beta 5 subunit                              233   2e-71    
ref|XP_003874511.1|  putative proteasome beta 5 subunit                 233   2e-71    
gb|AGG11403.1|  hypothetical protein                                    233   2e-71    
gb|EJK48257.1|  hypothetical protein THAOC_32963                        231   2e-71    
ref|XP_006261242.1|  PREDICTED: proteasome subunit beta type-5          232   2e-71    
gb|AAF37285.1|AF226674_1  20S proteasome beta 5 subunit                 231   2e-71    
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    233   3e-71    
ref|XP_002063746.1|  GK15836                                            232   3e-71    
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 232   3e-71    
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          231   3e-71    
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          231   3e-71    
gb|AAC97957.2|  proteasome beta 5 subunit                               231   3e-71    
emb|CCC51553.1|  putative proteasome beta 5 subunit, fragment           232   3e-71    
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     231   3e-71    
ref|NP_652014.1|  proteasome beta5 subunit, isoform A                   232   3e-71    
gb|AAF26416.1|AF217726_1  20S proteasome beta5 subunit                  231   4e-71    
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          231   4e-71    
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          232   4e-71    
dbj|BAA10934.1|  LMP7                                                   231   4e-71    
ref|XP_003287743.1|  proteasome subunit beta type 5                     231   5e-71    
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           231   6e-71    
ref|XP_010571771.1|  PREDICTED: proteasome subunit beta type-5          228   7e-71    
dbj|BAO50694.1|  proteasome subunit beta type 8,F-type                  228   7e-71    
gb|EPQ17641.1|  Proteasome subunit beta type-5                          233   8e-71    
ref|XP_001361733.1|  GA11556                                            231   9e-71    
gb|KFM59336.1|  Proteasome subunit beta type-5                          230   9e-71    
ref|XP_628966.1|  proteasome subunit beta type 5                        230   9e-71    
ref|XP_011184652.1|  PREDICTED: proteasome subunit beta type-5-like     230   1e-70    
ref|XP_008036606.1|  proteasome component pts1                          231   1e-70    
ref|XP_001961263.1|  GF13778                                            231   1e-70    
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    230   1e-70    
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     229   1e-70    
ref|NP_001270574.1|  uncharacterized protein LOC101865806               229   1e-70    
ref|XP_001986559.1|  GH20460                                            230   1e-70    
gb|AAI53590.1|  Psmb5 protein                                           229   2e-70    
ref|XP_810086.1|  proteasome beta 5 subunit                             231   2e-70    
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             231   2e-70    
dbj|BAM21000.1|  proteasome subunit beta type-8                         228   2e-70    
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    232   2e-70    
ref|XP_822850.1|  proteasome subunit beta 5                             231   2e-70    
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    229   2e-70    
gb|ABQ22856.1|  proteasome subunit beta type 5 precursor-like pro...    226   2e-70    
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      231   3e-70    
ref|XP_810804.1|  proteasome beta 5 subunit                             230   3e-70    
ref|XP_001976166.1|  GG20151                                            229   3e-70    
gb|ESS68038.1|  proteasome beta 5 subunit                               230   3e-70    
gb|AAL59862.1|AF363583_1  proteasome beta-subunit LMP7                  229   3e-70    
ref|XP_002090364.1|  Prosbeta5                                          229   4e-70    
ref|XP_011182734.1|  PREDICTED: proteasome subunit beta type-5-like     229   4e-70    
gb|EKG04000.1|  proteasome beta 5 subunit, putative                     230   4e-70    
ref|XP_007863011.1|  20S proteasome subunit                             230   4e-70    
gb|ESL07999.1|  proteasome beta 5 subunit                               230   4e-70    
ref|NP_571226.1|  proteasome subunit beta type-5                        228   4e-70    
ref|XP_002005785.1|  GI18886                                            229   4e-70    
gb|EKF32460.1|  proteasome beta 5 subunit, putative                     229   5e-70    
ref|XP_007418509.1|  20S proteasome subunit                             229   5e-70    
dbj|BAO50685.1|  proteasome subunit beta type 8,F-type                  226   5e-70    
ref|XP_011214452.1|  PREDICTED: proteasome subunit beta type-5-like     228   6e-70    
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          228   6e-70    
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     228   6e-70    
ref|XP_008543771.1|  PREDICTED: proteasome subunit beta type-5          228   7e-70    
emb|CBN74512.1|  conserved unknown protein                              228   8e-70    
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    229   8e-70    
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              229   8e-70    
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  229   1e-69    
ref|XP_005188727.1|  PREDICTED: proteasome subunit beta type-5          228   1e-69    
dbj|BAO50697.1|  proteasome subunit beta type 8,F-type                  225   1e-69    
dbj|BAO50692.1|  proteasome subunit beta type 8,A-type                  225   1e-69    
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              229   1e-69    
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    229   1e-69    
ref|XP_011206211.1|  PREDICTED: proteasome subunit beta type-5-like     227   2e-69    
dbj|BAA10931.1|  LMPX of hagfish                                        227   2e-69    
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               228   2e-69    
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   228   2e-69    
ref|XP_003332961.2|  20S proteasome subunit beta 5                      228   2e-69    
gb|AGM32352.1|  proteasome subunit beta type-5-like protein             227   2e-69    
gb|KDE05583.1|  proteasome component PRE2                               228   2e-69    
gb|EJU05281.1|  proteasome-domain-containing protein                    228   3e-69    
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              228   3e-69    
ref|XP_394680.3|  PREDICTED: proteasome subunit beta type-5-like        227   3e-69    
dbj|BAO50693.1|  proteasome subunit beta type 8,F-type                  224   3e-69    
ref|XP_004534832.1|  PREDICTED: proteasome subunit beta type-5-like     226   3e-69    
emb|CCM00020.1|  predicted protein                                      227   3e-69    
ref|XP_007850837.1|  proteasome component pre2 precursor                227   3e-69    
ref|XP_003694700.1|  PREDICTED: proteasome subunit beta type-5-like     226   3e-69    
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  227   4e-69    
emb|CAA40494.1|  proteasome C1 subunit                                  223   5e-69    
dbj|BAO50687.1|  proteasome subunit beta type 8,F-type                  223   5e-69    
gb|AJK90586.1|  20S proteasome beta5 subunit                            226   6e-69    
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   227   7e-69    
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  227   7e-69    
ref|XP_003488646.1|  PREDICTED: proteasome subunit beta type-5-like     226   9e-69    
dbj|BAO49776.1|  proteasome subunit beta type 8,A-type-A                221   9e-69    
ref|XP_003394930.1|  PREDICTED: proteasome subunit beta type-5-like     225   9e-69    
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   226   1e-68    
dbj|BAA10933.1|  LMP7 of nurse shark                                    225   1e-68    
gb|AAR09671.1|  similar to Drosophila melanogaster Prosbeta5            221   1e-68    
gb|EHJ72628.1|  proteasome subunit beta 5                               225   1e-68    
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  226   1e-68    
ref|XP_001867951.1|  proteasome subunit beta type 8                     224   1e-68    
gb|ETS60462.1|  hypothetical protein PaG_05302                          232   1e-68    
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   226   2e-68    
ref|NP_001264655.1|  proteasome subunit beta type-5                     224   2e-68    
gb|ACI66984.1|  Proteasome subunit beta type-8 precursor                224   2e-68    
ref|NP_001017791.1|  proteasome subunit beta type 8                     224   2e-68    
sp|P34065.2|PSB5_CHICK  RecName: Full=Proteasome subunit beta typ...    224   2e-68    
emb|CCO27714.1|  20S proteasome subunit beta 5                          225   2e-68    
ref|XP_011351485.1|  PREDICTED: proteasome subunit beta type-5          224   2e-68    
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  225   2e-68    
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  225   3e-68    
emb|CDQ73245.1|  unnamed protein product                                224   3e-68    
dbj|BAO50689.1|  proteasome subunit beta type 8,A-type                  222   3e-68    
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             225   3e-68    
gb|EFN77251.1|  Proteasome subunit beta type-5                          224   3e-68    
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 225   3e-68    
ref|XP_011150435.1|  PREDICTED: proteasome subunit beta type-5          224   3e-68    
ref|XP_001663403.1|  AAEL013236-PA                                      224   3e-68    
emb|CAN13318.1|  proteasome (prosome, macropain) subunit, beta ty...    221   3e-68    
emb|CCW60032.1|  unnamed protein product                                225   3e-68    
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     224   3e-68    
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                224   3e-68    
ref|XP_002911819.1|  proteasome component pts1                          225   4e-68    
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  221   4e-68    
gb|ACN10160.1|  Proteasome subunit beta type-8 precursor                224   4e-68    
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 224   4e-68    
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                223   4e-68    
dbj|BAO50691.1|  proteasome subunit beta type 8,A-type                  221   5e-68    
gb|ACO15462.1|  Proteasome subunit beta type-5 precursor                223   6e-68    
dbj|BAO50690.1|  proteasome subunit beta type 8,A-type                  221   6e-68    
gb|EMS25821.1|  20S proteasome subunit beta 5                           224   6e-68    
dbj|BAM18296.1|  proteasome beta5 subunit                               223   7e-68    
ref|XP_011502385.1|  PREDICTED: proteasome subunit beta type-5          222   7e-68    
dbj|BAM20999.1|  proteasome subunit beta type-8                         221   7e-68    
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              223   7e-68    
ref|NP_001158688.1|  Proteasome subunit beta type 8                     223   8e-68    
ref|XP_970194.1|  PREDICTED: proteasome subunit beta type-5             223   8e-68    
ref|XP_006619720.1|  PREDICTED: proteasome subunit beta type-5-like     223   8e-68    
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  224   8e-68    
ref|XP_004833459.1|  proteasome beta 5 subunit, putative                223   8e-68    
ref|XP_011060822.1|  PREDICTED: proteasome subunit beta type-5          223   9e-68    
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  224   9e-68    
gb|AAL59861.1|AF363582_1  proteasome beta-subunit LMP7-like protein     223   9e-68    
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              224   1e-67    
emb|CEG76258.1|  Putative Proteasome subunit beta type                  221   1e-67    
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                222   1e-67    
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537             222   1e-67    
dbj|BAO50684.1|  proteasome subunit beta type 8,A-type                  220   1e-67    
dbj|BAM20998.1|  proteasome subunit beta type-8                         221   1e-67    
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     222   1e-67    
ref|XP_007764597.1|  20S proteasome subunit                             223   1e-67    
ref|XP_559226.2|  AGAP010718-PA                                         223   1e-67    
gb|ETN63828.1|  proteasome subunit beta type 5,8                        223   2e-67    
gb|KFB51802.1|  AGAP010718-PA-like protein                              222   2e-67    
dbj|BAO50686.1|  proteasome subunit beta type 8,A-type                  219   2e-67    
ref|XP_011254239.1|  PREDICTED: proteasome subunit beta type-5          222   2e-67    
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  223   2e-67    
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  223   2e-67    
ref|XP_011163166.1|  PREDICTED: proteasome subunit beta type-5          222   2e-67    
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   223   2e-67    
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   223   2e-67    
gb|ABI31729.1|  low molecular mass protein 7                            221   3e-67    
gb|KJE01830.1|  proteasome subunit beta type-5                          222   3e-67    
gb|ACM09015.1|  Proteasome subunit beta type-5 precursor                221   3e-67    
gb|KGG50522.1|  proteasome subunit beta type                            221   3e-67    
gb|KDR22252.1|  Proteasome subunit beta type-5                          221   3e-67    
ref|XP_571562.1|  proteasome component pts1                             222   3e-67    
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     219   3e-67    
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  223   3e-67    
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   222   3e-67    
ref|XP_004519324.1|  PREDICTED: proteasome subunit beta type-5-like     221   3e-67    
gb|ACJ09226.1|  proteasome subunit beta 5                               221   3e-67    
gb|KIM30973.1|  hypothetical protein M408DRAFT_327886                   219   4e-67    
ref|XP_004922586.1|  PREDICTED: proteasome subunit beta type-5-like     221   4e-67    
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   222   4e-67    
ref|XP_001924154.2|  PREDICTED: proteasome subunit beta type-8          221   4e-67    
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   222   5e-67    
ref|XP_001875479.1|  20S proteasome subunit                             222   5e-67    
ref|XP_004590508.1|  PREDICTED: proteasome subunit beta type-8          221   5e-67    
ref|XP_011309100.1|  PREDICTED: proteasome subunit beta type-5          221   5e-67    
gb|KIR99960.1|  proteasome subunit beta type-5                          221   5e-67    
ref|XP_003194765.1|  proteasome component                               221   5e-67    
dbj|BAO50688.1|  proteasome subunit beta type 8,F-type                  218   5e-67    
gb|AEE61820.1|  unknown                                                 221   6e-67    
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   218   6e-67    
gb|ACO11122.1|  Proteasome subunit beta type-5 precursor                221   6e-67    
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            222   6e-67    
ref|NP_999100.1|  proteasome subunit beta type-8                        220   6e-67    
gb|ENN71488.1|  hypothetical protein YQE_11784                          221   7e-67    
ref|XP_003700810.1|  PREDICTED: proteasome subunit beta type-5-like     221   7e-67    
gb|AFR96090.1|  proteasome component PRE2                               222   7e-67    
dbj|BAA19767.1|  LMP7                                                   219   8e-67    
ref|XP_006457891.1|  20S proteasome subunit                             221   8e-67    
ref|XP_006001021.1|  PREDICTED: proteasome subunit beta type-8-like     220   8e-67    
ref|XP_007882652.1|  PREDICTED: proteasome subunit beta type-8-like     220   9e-67    
gb|KIY65291.1|  proteasome-domain-containing protein                    221   1e-66    
gb|ABQ22703.1|  proteasome subunit beta type 5 precursor-like pro...    216   1e-66    
dbj|GAK66792.1|  proteasome-domain-containing protein                   230   1e-66    
emb|CCW66993.1|  unnamed protein product                                221   2e-66    



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   368 bits (945),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR+DLSVE
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRYDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE AAVE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEVAAVEQE  266

Query  252  MTEVPIA  232
            M EVP+A
Sbjct  267  MAEVPVA  273



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   368 bits (944),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR+DLSVE
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRYDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE AAVE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEVAAVEQE  266

Query  252  MTEVPIA  232
            M EVP+A
Sbjct  267  MAEVPVA  273



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   364 bits (934),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSVE
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE AAVE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVEVAAVEQE  266

Query  252  MTEVPIA  232
            M EVP+A
Sbjct  267  MAEVPVA  273



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   364 bits (934),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GYRFDLSVE
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYRFDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE  +VE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVELESVEQE  266

Query  252  MTEVPIA  232
            M EVP+A
Sbjct  267  MAEVPVA  273



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   364 bits (934),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GYRFDLSVE
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYRFDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE  +VE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVELESVEQE  266

Query  252  MTEVPIA  232
            M EVP+A
Sbjct  267  MAEVPVA  273



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   363 bits (931),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR DLSVE
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRNDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP+E AAVE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPIEVAAVEQE  266

Query  252  MTEVPIA  232
            M EV +A
Sbjct  267  MAEVSVA  273



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   363 bits (931),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSV+
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVK  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE AAVE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVEVAAVEQE  266

Query  252  MTEVPIA  232
            M EVP+A
Sbjct  267  MAEVPVA  273



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   363 bits (931),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE+GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYRFDLSVE
Sbjct  147  RGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRFDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPVE  AVE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVEPTAVEQE  266

Query  252  MTEVPIA  232
            MTEV IA
Sbjct  267  MTEVSIA  273



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   359 bits (922),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRIS+AGASK+LANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKMLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE+GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFDLSVE
Sbjct  147  RGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGW+KLSGDDVGELHY YYPVE A VE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWEKLSGDDVGELHYKYYPVETAVVEQE  266

Query  252  MTEVPIA  232
            MTEV IA
Sbjct  267  MTEVAIA  273



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   353 bits (905),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV   AVE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVQGAVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   352 bits (904),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  147  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV A +VE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVAGSVEQE  266

Query  252  MTEV  241
            M EV
Sbjct  267  MVEV  270



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLGVKCRLH+LANKRRISVAGASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHKLANKRRISVAGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY+YYPV    V+ E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYNYYPVTPTTVDQE  265

Query  252  MTEVPIA  232
            MTEV  A
Sbjct  266  MTEVTAA  272



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLL NILYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLGNILYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE+GPGLYYVDSEGGRLKG +FSVGSGSPYAYG+LD+G+RFDLSVE
Sbjct  148  RGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTKFSVGSGSPYAYGILDSGHRFDLSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYH+GPNGWKKLSGDDVGELHY YYPVE A VE E
Sbjct  208  EAAELARRAIYHATFRDGASGGVASVYHIGPNGWKKLSGDDVGELHYLYYPVEPATVERE  267

Query  252  MTEVPIA  232
            M+EV I+
Sbjct  268  MSEVAIS  274



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   352 bits (902),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTEVP  238
            M E P
Sbjct  266  MVEAP  270



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   351 bits (901),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDDGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV   AVE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVEGAVEQE  265

Query  252  MTEVPIA  232
            M EV  A
Sbjct  266  MVEVAAA  272



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   351 bits (900),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLGVKCR HELANKRRISVAGASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRRHELANKRRISVAGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY+YYPV    V+ E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYNYYPVTPTTVDQE  265

Query  252  MTEVPIA  232
            MTEV  A
Sbjct  266  MTEVTAA  272



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   351 bits (900),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFD+ VE
Sbjct  147  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDMPVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGP+GWKKLSGDDVGELHY YYPV    VE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYHVGPDGWKKLSGDDVGELHYKYYPVAPTPVEQE  266

Query  252  MTEVPIA  232
            MT+ P A
Sbjct  267  MTDAPAA  273



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   350 bits (897),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARRSIYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE E
Sbjct  206  EAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   349 bits (896),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  147  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY VGPNGWKKLSGDDVGELHYHYYPV A +VE E
Sbjct  207  EAAELARRAIYHATFRDGASGGVASVYXVGPNGWKKLSGDDVGELHYHYYPVVAGSVEQE  266

Query  252  MTEV  241
            M EV
Sbjct  267  MVEV  270



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   347 bits (889),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  15   VEKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  74

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVE
Sbjct  75   RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDDGYRYDMSVE  134

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV   AVE E
Sbjct  135  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVEGAVEQE  194

Query  252  MTEVPIA  232
            M EV  A
Sbjct  195  MVEVAAA  201



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   349 bits (896),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTE  244
            M E
Sbjct  266  MVE  268



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   349 bits (896),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTE  244
            M E
Sbjct  266  MVE  268



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   349 bits (895),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTE  244
            M E
Sbjct  266  MVE  268



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   349 bits (895),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+E
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   349 bits (895),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+E
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   348 bits (894),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GYRFD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYRFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GWKKLSGDDVGELHYHYYPV     EHE
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELHYHYYPVAPTTAEHE  267

Query  252  MTE  244
            M E
Sbjct  268  MAE  270



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   348 bits (893),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+E
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   348 bits (893),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  91   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  151  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV    VE E
Sbjct  211  EASELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYEYYPVTPETVEQE  270

Query  252  MTEV  241
            M EV
Sbjct  271  MVEV  274



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   348 bits (892),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E E
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVPATAEQE  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   348 bits (892),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDSGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   345 bits (884),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  8    VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  67

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+E
Sbjct  68   RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIE  127

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  128  EAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  187

Query  252  MTEV  241
            M EV
Sbjct  188  MAEV  191



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   347 bits (891),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLS+E
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   347 bits (891),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   347 bits (891),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGT+AGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQE  265

Query  252  MTE  244
            M E
Sbjct  266  MVE  268



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   347 bits (889),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLL NILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLTNILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELH+ YYPV    VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHFKYYPVTPGTVEQE  265

Query  252  MTEV  241
            M+EV
Sbjct  266  MSEV  269



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   347 bits (889),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+E
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELH+ YYPV    VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHFKYYPVSPGTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   347 bits (889),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   346 bits (888),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYM+GTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  86   VKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+E
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VG +GWKKLSGDDVGELHY YYPV  + VEHE
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGRDGWKKLSGDDVGELHYTYYPVAPSPVEHE  265

Query  252  MTEVP  238
            M EVP
Sbjct  266  MAEVP  270



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   346 bits (887),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVG NGWKKLSGDDVGELHY YYPV   AVE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHYSYYPVVPGAVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   346 bits (887),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDDGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVG NGWKKLSGDDVGELHY YYPV A AVE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHYSYYPVVAGAVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   345 bits (886),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPATAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   345 bits (886),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINP+MLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGP GWKKLSGDDVGELHYHY+PV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYHVGPTGWKKLSGDDVGELHYHYHPVTPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   345 bits (885),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYM+GTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  86   VKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+E
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGV SVY+VG +GWKKLSGDDVGELHY YYPV  + VEHE
Sbjct  206  EAAELARRAIYHATFRDGASGGVVSVYYVGRDGWKKLSGDDVGELHYTYYPVAPSPVEHE  265

Query  252  MTEVPIA  232
            M EVP A
Sbjct  266  MAEVPPA  272



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   345 bits (885),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + +E E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYRYYPVMPSTIEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   345 bits (884),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYRYYPVMPSTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   345 bits (884),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   347 bits (890),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 173/183 (95%), Gaps = 1/183 (1%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  154  VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  213

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRL GNRFSVGSGSPYAYGVLD+GYRFD+SVE
Sbjct  214  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLNGNRFSVGSGSPYAYGVLDSGYRFDMSVE  273

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGV SVYHVGP+GWKKLSGDDVGELHY YYPVE   VEHE
Sbjct  274  EAAELARRAIYHATFRDGASGGVVSVYHVGPDGWKKLSGDDVGELHYAYYPVE-PTVEHE  332

Query  252  MTE  244
            M E
Sbjct  333  MAE  335



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   345 bits (884),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   345 bits (884),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  +  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPSTAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   345 bits (884),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  +  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPSTAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   344 bits (883),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASK+LANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKMLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY PV  + VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYNPVVPSTVEQE  265

Query  252  MTE  244
            M E
Sbjct  266  MVE  268



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   344 bits (883),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SV 
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDDGYRYDMSVH  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVASVY+VGP+GWKKLSGDDVGELHY YYPV A  VE E
Sbjct  206  EAAELARRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVGELHYKYYPVTAGTVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   343 bits (881),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  89   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  148

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  149  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  208

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GWKKLSGDDVGELHYHYYPV     EH 
Sbjct  209  EASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELHYHYYPVTPVTAEHV  268

Query  252  MTE  244
            M E
Sbjct  269  MEE  271



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   343 bits (880),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVAPATAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   343 bits (880),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   343 bits (879),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  85   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  144

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  145  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVE  204

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARR+IYHATFRDGASGGVASVY+VGP GWKKLSGDDVGELHYHY PV  + VE E
Sbjct  205  EASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHYHYNPVTPSTVEQE  264

Query  252  MTE  244
            M E
Sbjct  265  MVE  267



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   343 bits (880),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+S+E
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSIE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  EH 
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPATAEHV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   343 bits (879),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+S+E
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSIE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  EH 
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPATAEHV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   343 bits (879),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYM+GTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  86   VKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRD ASGGVASVY+VGP+GWKKLSGDDVGELH+ YYPV  +  E E
Sbjct  206  EAAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHFRYYPVAPSPTEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   343 bits (879),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   342 bits (877),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  85   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  144

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  145  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVE  204

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARR+IYHATFRDGASGGVASVY+VGP GWKKLSGDDVGELHYHY PV  + VE E
Sbjct  205  EASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHYHYNPVTPSTVEQE  264

Query  252  MTE  244
            M E
Sbjct  265  MVE  267



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   342 bits (878),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG KCRLHELANKRRIS+AG+SK+LANILYSY
Sbjct  89   VRKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELANKRRISIAGSSKMLANILYSY  148

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GPGLYYVDSEG RLKGNRFSVGSGS YAYG+LD GY+F++SVE
Sbjct  149  RGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGNRFSVGSGSLYAYGILDEGYKFNMSVE  208

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA ELARR+IYHATFRDGASGG  SVYHVGPNGWKKLSGDDVGELHYHYYPV+AA VE E
Sbjct  209  EAGELARRAIYHATFRDGASGGCVSVYHVGPNGWKKLSGDDVGELHYHYYPVQAAPVEQE  268

Query  252  MTEVPIA*T  226
            M + P A T
Sbjct  269  MADAPSAST  277



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   342 bits (876),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+R SVGSGSPYAYGVLD+GY+FD++VE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRLSVGSGSPYAYGVLDSGYKFDMTVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   341 bits (875),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV     EH 
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPITAEHV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   339 bits (870),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLGVKCRLHELANKRRIS+AG+SK LANILYSY
Sbjct  38   VRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  97

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVE
Sbjct  98   RGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVE  157

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE E
Sbjct  158  EAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQE  217

Query  252  MTEVPIA*T  226
            M E P A T
Sbjct  218  MAEAPSAST  226



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   340 bits (873),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLG+MAGG+ADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGSMAGGSADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+S+E
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSIE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  EH 
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPATAEHV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   340 bits (873),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLGVKCRLHELANKRRIS+AG+SK LANILYSY
Sbjct  91   VRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVE
Sbjct  151  RGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE E
Sbjct  211  EAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQE  270

Query  252  MTEVPIA*T  226
            M E P A T
Sbjct  271  MAEAPSAST  279



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   340 bits (873),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLGVKCRLHELANKRRIS+AG+SK LANILYSY
Sbjct  91   VRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVE
Sbjct  151  RGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE E
Sbjct  211  EAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQE  270

Query  252  MTEVPIA*T  226
            M E P A T
Sbjct  271  MAEAPSAST  279



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   340 bits (872),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILY+Y
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGY++D++VE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYQYDMTVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARR+IYHAT+RDGASGGV SVYHVGP+GWKKL+GDDVGELHY YYPV  A VE E
Sbjct  206  EASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKLTGDDVGELHYQYYPVVPATVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   339 bits (870),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVG NGW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGSNGWTKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   339 bits (870),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGR+KG+RFSVGSGSPYAYGVLD+GY++D++VE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRIKGDRFSVGSGSPYAYGVLDSGYKYDMTVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV  ++ E  
Sbjct  208  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVTPSSAEQV  267

Query  252  MTE  244
            M+E
Sbjct  268  MSE  270



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPY++GT+AGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  91   VKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+S E
Sbjct  151  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDMSCE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARRSIYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV    VE E
Sbjct  211  EAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVPKGNVEQE  270

Query  252  MTE  244
            M E
Sbjct  271  MVE  273



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP+GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPDGWTKLSGDDVGELHYHYYPVAPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   340 bits (871),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  112  VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  171

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  172  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVE  231

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  232  EASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQV  291

Query  252  MTE  244
            M E
Sbjct  292  MEE  294



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   338 bits (868),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   338 bits (867),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPY+LGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+ VE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRWDMPVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARRSIYHATFRDGASGGVASVY+VGP GWKKLSGDDV ELH++YYPV    VE E
Sbjct  206  EAAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVAELHFNYYPVTENVVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   337 bits (865),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYM+GTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  86   VKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE G GLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+E
Sbjct  146  RGMGLSVGTMIAGWDETGAGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRD ASGGVASVY+VGP+GWKKLSGDDVGELH+ YYPV     E E
Sbjct  206  EAAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHFRYYPVAPNPTEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MAEV  269



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINP++LGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+ VE
Sbjct  146  RGMGLSIGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRWDMPVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARRSIYHATFRDGASGGVASVY+VGP GWKKLSGDDVGELH+ YYPV    VE E
Sbjct  206  EAAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVGELHFKYYPVTENVVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILY+Y
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGY++D++VE
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYKYDMTVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARR+IYHAT+RDGASGGV SVYHVGP+GWKK++GDDVG+LH+ YYPV  A VE E
Sbjct  206  EASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKVTGDDVGDLHFQYYPVVPATVEQE  265

Query  252  MTEV  241
            M EV
Sbjct  266  MVEV  269



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   337 bits (863),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  789  KKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  610
            KKIIEIN YMLGTMAGGAADCQ WHRNLG+KCR HEL NKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINSYMLGTMAGGAADCQFWHRNLGIKCRRHELENKRRISVTGASKLLANILYSYR  147

Query  609  GMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  430
            GMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAY VLDNGY++DLSVEE
Sbjct  148  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYCVLDNGYQYDLSVEE  207

Query  429  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  250
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV    VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVVHDTVEQEM  267

Query  249  TEVPI  235
             EV +
Sbjct  268  IEVTV  272



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++++SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYEMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVPGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGR+KG+RFSVGSGSPYAYGVLD+GY++D++VE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRIKGDRFSVGSGSPYAYGVLDSGYKYDMTVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARRSIYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  +  E  
Sbjct  208  EAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVAPSTAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MAE  270



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++++SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYEMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++++SVE
Sbjct  148  RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYEMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  
Sbjct  208  EASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVPPAIAEQV  267

Query  252  MTE  244
            M E
Sbjct  268  MEE  270



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  789  KKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  610
            KKIIEIN YMLGTMAGGAADCQ WHRNLG+KCR HEL NKRRISV GASKLLANILYSYR
Sbjct  104  KKIIEINSYMLGTMAGGAADCQFWHRNLGIKCRRHELENKRRISVTGASKLLANILYSYR  163

Query  609  GMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  430
            GMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAY VLDNGY++DLSVEE
Sbjct  164  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYCVLDNGYQYDLSVEE  223

Query  429  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  250
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV    VE EM
Sbjct  224  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVVHDTVEQEM  283

Query  249  TEVPI  235
             EV +
Sbjct  284  IEVTV  288



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   335 bits (859),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  85   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  144

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMG SVGTMIAG DE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  145  RGMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVE  204

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARR+IYHATFRDGASGGVASVY+VGP G KKLSGDDVGELHYHY PV  + VE E
Sbjct  205  EASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHYHYNPVTPSTVEQE  264

Query  252  MTE  244
            M E
Sbjct  265  MVE  267



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSY
Sbjct  92   VRKIIEINPYMLGTMAGGAADCQFWHRNLGNKCRLHELSNKRRISIAGASKLLANILYSY  151

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL GN+FSVGSGS YAYGVLD+GYRF++SVE
Sbjct  152  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNKFSVGSGSLYAYGVLDDGYRFNMSVE  211

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRD ASGG  SVYHVGP+GW KLSGDDVGELHYHYYPV+   VE E
Sbjct  212  EAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHYYPVQKTPVEQE  271

Query  252  MTEVPIA  232
            MT+ P A
Sbjct  272  MTDAPTA  278



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSY
Sbjct  92   VRKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELSNKRRISIAGASKLLANILYSY  151

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL GNRFSVGSGS YAYG+LD+GYRF +SVE
Sbjct  152  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNRFSVGSGSLYAYGILDDGYRFSMSVE  211

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRD ASGG  SVYHVGP+GW KLSGDDVGELHYHYYPV+   VE E
Sbjct  212  EAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHYYPVQKTPVEQE  271

Query  252  MTEVPIA  232
            M + P A
Sbjct  272  MADAPTA  278



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   332 bits (850),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  37   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  96

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+LD+GYR+DLSV+
Sbjct  97   RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGILDSGYRYDLSVD  156

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA EL RR+IYHATFRDGASGGV SVYHVGP GWKK +GDDVG+LHY YYPV  + VE E
Sbjct  157  EAVELGRRAIYHATFRDGASGGVVSVYHVGPEGWKKWTGDDVGDLHYQYYPVVPSTVEQE  216

Query  252  MTE  244
            M E
Sbjct  217  MAE  219



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   330 bits (847),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRIS+AGASKLLANILYSY
Sbjct  38   VRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSY  97

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VE
Sbjct  98   RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVE  157

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE E
Sbjct  158  EAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQE  217

Query  252  MTEVPIA  232
            M + P A
Sbjct  218  MADAPAA  224



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSY
Sbjct  92   VRKIIEINPYMLGTMAGGAADCQFWHRNLGNKCRLHELSNKRRISIAGASKLLANILYSY  151

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL GNRFSVGSGS YAYG+LD GYRF++SVE
Sbjct  152  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNRFSVGSGSLYAYGILDEGYRFNMSVE  211

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA ELARR+IY ATFRD ASGG  SVYHVGP+GWKKLSGDDVGELHYHYYPV+   VE E
Sbjct  212  EAGELARRAIYGATFRDAASGGCVSVYHVGPDGWKKLSGDDVGELHYHYYPVQKTPVEQE  271

Query  252  MTEVPIA  232
            MT+ P A
Sbjct  272  MTDAPSA  278



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRIS+AGASKLLANILYSY
Sbjct  91   VRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VE
Sbjct  151  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE E
Sbjct  211  EAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQE  270

Query  252  MTEVPIA  232
            M + P A
Sbjct  271  MADAPAA  277



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   331 bits (849),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRIS+AGASKLLANILYSY
Sbjct  91   VRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VE
Sbjct  151  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE E
Sbjct  211  EAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQE  270

Query  252  MTEVPIA  232
            M + P A
Sbjct  271  MADAPAA  277



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   331 bits (849),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRIS+AGASKLLANILYSY
Sbjct  91   VRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VE
Sbjct  151  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE E
Sbjct  211  EAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQE  270

Query  252  MTEVPIA  232
            M + P A
Sbjct  271  MADAPAA  277



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   331 bits (848),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFD+S+E
Sbjct  147  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDMSIE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  277
            EAAEL RR+IYHATFRDGASGGVASVY+VGP+GWKKLSGDDV ELHY+YYPV
Sbjct  207  EAAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHYNYYPV  258



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   330 bits (847),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  87   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+LD+GYRFD+S+E
Sbjct  147  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGILDSGYRFDMSIE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  277
            EAAEL RR+IYHATFRDGASGGVASVY+VGP+GWKKLSGDDV ELHY+YYPV
Sbjct  207  EAAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHYNYYPV  258



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   330 bits (846),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRIS+AGASKLLANILYSY
Sbjct  91   VRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VE
Sbjct  151  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE E
Sbjct  211  EAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEAIPVEQE  270

Query  252  MTEVPIA  232
            M + P A
Sbjct  271  MADAPAA  277



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   330 bits (845),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISVAGASKLLANILYSY
Sbjct  90   VRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL G RFSVGSGS YAYG+LD GYR+ +SVE
Sbjct  150  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGTRFSVGSGSLYAYGILDEGYRYVMSVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA ELARR+IYHATFRDGASGG  SVYHVG +GWKKLSGDDVGELHY YYPV+A  VE E
Sbjct  210  EAGELARRAIYHATFRDGASGGCVSVYHVGADGWKKLSGDDVGELHYKYYPVQATPVEQE  269

Query  252  MTEVPIA  232
            M + P A
Sbjct  270  MADAPAA  276



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   328 bits (840),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  85   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  144

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMG SVGTMIAG DE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVE
Sbjct  145  RGMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVE  204

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  259
            EA+ELARR+IYHATFRDGASGGVASVY+VGP G KKLSGDDVGELHYHY PV  + VE
Sbjct  205  EASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHYHYNPVTPSTVE  262



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   328 bits (840),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 167/185 (90%), Gaps = 2/185 (1%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANIL+SY
Sbjct  89   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILFSY  148

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+LD+GYRFD+S+E
Sbjct  149  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGILDSGYRFDMSIE  208

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEH-  256
            EAAEL RR+IYHATFRDGASGGVASVY+VG NGW KLSGDDV ELHY YYPV +A     
Sbjct  209  EAAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHYKYYPVVSAETSEP  268

Query  255  -EMTE  244
             +M E
Sbjct  269  DQMVE  273



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   326 bits (835),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGG ADCQ WHRNLG+KCRLHELANKRRISV GASKLLANIL+SY
Sbjct  89   VKKIIEINPYMLGTMAGGGADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILFSY  148

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFD+S+E
Sbjct  149  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDMSIE  208

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAA  268
            EAAEL RR+IYHATFRDGASGGVASVY+VG NGW KLSGDDV ELHY YYPV +A
Sbjct  209  EAAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHYKYYPVVSA  263



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   320 bits (820),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRR SVAGASKLLANILYSY
Sbjct  12   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGASKLLANILYSY  71

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GYRFDLSVE
Sbjct  72   RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYRFDLSVE  131

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  304
            EAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG
Sbjct  132  EAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  174



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKI+EINPY+LGTMAGGAADCQ W RNLG +CRLHEL NKRRISV GASKLLAN LYSY
Sbjct  91   VKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELGNKRRISVTGASKLLANTLYSY  150

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD G+R+D++VE
Sbjct  151  RGMGLSMGTMIAGWDETGPGLYYVDSEGGRVKGRRFSVGSGSTYAYGVLDTGFRWDMTVE  210

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA ELARRSIYHATFRDGASGGVASVY+VGP+GWKK+SGDDVGELHY YYPV  A  E E
Sbjct  211  EAVELARRSIYHATFRDGASGGVASVYYVGPDGWKKMSGDDVGELHYKYYPVSDAPAEQE  270

Query  252  M  250
            +
Sbjct  271  V  271



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   341 bits (875),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  792   VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
             V+KIIEINPYMLGTMAGGAADCQ WHRNLGVKCRLHELANKRRIS+AG+SK LANILYSY
Sbjct  1332  VRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  1391

Query  612   RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
             RGMGLS+GTMIAG DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVE
Sbjct  1392  RGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVE  1451

Query  432   EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
             EAAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE E
Sbjct  1452  EAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQE  1511

Query  252   MTEVPIA*T  226
             M E P A T
Sbjct  1512  MAEAPSAST  1520



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKI+EINPY+LGTMAGGAADCQ W RNLG +CRLHELANKRRISV GASKLLAN LYSY
Sbjct  84   VKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSY  143

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD G+ +D+S++
Sbjct  144  RGMGLSMGTMIAGWDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYGVLDTGFNWDMSID  203

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA ELARRSIYHATFRDGASGGV SVY+VGP GWKK+SGDDVGELHY YYPV+    E E
Sbjct  204  EAVELARRSIYHATFRDGASGGVVSVYYVGPGGWKKMSGDDVGELHYSYYPVQEVPAEAE  263

Query  252  MTE  244
            M E
Sbjct  264  MGE  266



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   310 bits (794),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKI+EINPY+LGTMAGGAADCQ W RNLG +CRLHELANKRRISVAGASKLLAN LYSY
Sbjct  88   VKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVAGASKLLANTLYSY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GP L+YVDSEGGR KG  FSVGSGS YAYG+LD+GY+F++SVE
Sbjct  148  RGMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFSVGSGSTYAYGILDSGYKFEMSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA EL RR+IYHATFRDGASGGVASVYH+GP GWKK+SGDDV ELHY YYP E+ A   +
Sbjct  208  EAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHYQYYPPESQASAPD  267

Query  252  MTE  244
            + E
Sbjct  268  VVE  270



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   308 bits (790),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKI+EINPY+LGTMAGGAADCQ W RNLG +CRLHELANKRRISVAGASKLLAN LYSY
Sbjct  86   VKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVAGASKLLANTLYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DE GP L+YVDSEGGR KG  FSVGSGS YAYG+LD+GY++++SVE
Sbjct  146  RGMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFSVGSGSTYAYGILDSGYKYEMSVE  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA EL RR+IYHATFRDGASGGVASVYH+GP GWKK+SGDDV ELHY YYP E+ A   +
Sbjct  206  EAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHYQYYPPESQASAPD  265

Query  252  MTE  244
            + E
Sbjct  266  VVE  268



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   308 bits (790),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKI+EINPYM+ T+AGGAADC  WHRNLG+KCRL+EL NKRRISVAGASKLL N+LYSY
Sbjct  86   VKKIVEINPYMIATVAGGAADCIFWHRNLGMKCRLYELENKRRISVAGASKLLTNMLYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTM+AG DE GP LYYVDSEGGRLKG+RFSVGSGSPYAY VLDNGYR+D+   
Sbjct  146  RGMGLSIGTMVAGCDEMGPSLYYVDSEGGRLKGSRFSVGSGSPYAYAVLDNGYRYDMPTG  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVA VYHVGP+GWKK+SGDDV ELH  YYP      E E
Sbjct  206  EAAELARRAIYHATFRDGASGGVAVVYHVGPDGWKKISGDDVRELHDKYYPAVQVPPEQE  265

Query  252  MTEVP  238
            M +VP
Sbjct  266  MMQVP  270



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = -1

Query  738  AADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKG  559
            AADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE G
Sbjct  70   AADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETG  129

Query  558  PGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDG  379
            PGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY++D+S+EEA+ELARR+IYHATFRDG
Sbjct  130  PGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKYDMSIEEASELARRAIYHATFRDG  189

Query  378  ASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  244
            ASGGVASVY+VGP GWKKLSGDDVGELHYHY PV  + VE EM E
Sbjct  190  ASGGVASVYYVGPTGWKKLSGDDVGELHYHYNPVTPSTVEQEMVE  234



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKI+EINP+M+ T+AGGAADC  WHRNLGVKCRL+EL NKRRISVAGASKLL N+LYSY
Sbjct  86   VKKIVEINPHMIATVAGGAADCIFWHRNLGVKCRLYELENKRRISVAGASKLLTNMLYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGM LSVGTMIAG DE GP LYYVDSEGGRLKG+RFSVGSGSPYAY VLDNGYR+D+ + 
Sbjct  146  RGMELSVGTMIAGWDEMGPSLYYVDSEGGRLKGSRFSVGSGSPYAYAVLDNGYRYDMPLG  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IYHATFRDGASGGVA V HVGP+GWKKLSGDDV ELH  YYP      E E
Sbjct  206  EAAELARRAIYHATFRDGASGGVAIVCHVGPDGWKKLSGDDVKELHDKYYPAVQVPAEQE  265

Query  252  MTEV  241
            M ++
Sbjct  266  MMQI  269



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 151/187 (81%), Gaps = 17/187 (9%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V+KIIEINPYMLGTMAGGAADCQ WHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSY
Sbjct  92   VRKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELSNKRRISIAGASKLLANILYSY  151

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG DEKGPGLYYVDSEG RL G                 N YRF +SVE
Sbjct  152  RGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVG-----------------NSYRFSMSVE  194

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EAAELARR+IY ATFRD ASGG  SVYHVGP+GW KLSGDDVGELHYHYYPV+   VE E
Sbjct  195  EAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHYYPVQKTPVEQE  254

Query  252  MTEVPIA  232
            M + P A
Sbjct  255  MADAPTA  261



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   289 bits (739),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 156/189 (83%), Gaps = 3/189 (2%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKI+EINPY+LGTMAGGAADCQ W RNLG +CRLHELANKR ISV GASKLLAN LYSY
Sbjct  48   VKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSY  107

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGL +GTMIAG DE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD  ++ D+S++
Sbjct  108  RGMGLFMGTMIAGWDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYGVLDTVFKQDMSID  167

Query  432  EAAELARRSIYHATFRDGASGGVASV---YHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  262
            EA ELARRSIYHAT RDGASGGV  +      GP+GWKK+SGDD GELH+ YYPV+    
Sbjct  168  EAVELARRSIYHATLRDGASGGVTLLKCSLLCGPSGWKKMSGDDGGELHHSYYPVQETPA  227

Query  261  EHEMTEVPI  235
            E EM+E  +
Sbjct  228  EAEMSEASV  236



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINP++LGTMAGGAADCQ W RNLG++CRLHEL N +RI+V  ASKLLAN LYSY
Sbjct  94   VKKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRITVRAASKLLANTLYSY  153

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +G GLS+GTMIAG D  GPGLYYVDSEG RLKG RFSVGSGS +AYGVLD GYR+DLSV+
Sbjct  154  KGRGLSMGTMIAGWDLNGPGLYYVDSEGTRLKGQRFSVGSGSLFAYGVLDQGYRWDLSVK  213

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  274
            EA EL RR+IYHATFRD  SGG  SVYHVG NGW K++GDDVGELH+HYYP E
Sbjct  214  EACELGRRAIYHATFRDAFSGGTVSVYHVGKNGWTKVTGDDVGELHFHYYPSE  266



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W RNLG++CRLHEL N +RISV+GASKLL+N LY Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRISVSGASKLLSNTLYGY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RG GLS+GTM+AG D  GPGLYYVDS+G RLKG RFSVGSGS +AYGVLD GYR+DLSVE
Sbjct  150  RGQGLSMGTMVAGWDLNGPGLYYVDSDGTRLKGKRFSVGSGSLFAYGVLDQGYRWDLSVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  274
            +A EL RR+IYHATFRD  SGG  SVYHVGP+GW K+SG DVGELHY YYP +
Sbjct  210  DACELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHYEYYPAD  262



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W RNLG++CRLHEL N +RISVAGASKLLAN LY Y
Sbjct  93   VKKVIEINPYLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRISVAGASKLLANTLYGY  152

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RG GLS+GTM+AG D KGPGLYYVDS+G RLKG RFSVGSGS +AYGVLD GYR+DLSVE
Sbjct  153  RGQGLSMGTMVAGWDLKGPGLYYVDSDGTRLKGQRFSVGSGSLFAYGVLDQGYRWDLSVE  212

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  274
            EA EL RR+IYHATFRD  SGG  SVYHV  NGW K+SG DVGELH+ YYP +
Sbjct  213  EACELGRRAIYHATFRDAFSGGTISVYHVNENGWTKVSGTDVGELHFEYYPAD  265



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINP++LGTMAGGAADCQ W RNLG++CRLHEL   +RI+V GASKLLAN LY Y
Sbjct  96   VKKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGY  155

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RG GLS+GTM+AG D  GPGL+YVDS+G RLKG RFSVGSGS +AYGVLD G+R DLS++
Sbjct  156  RGRGLSMGTMVAGWDTTGPGLFYVDSDGTRLKGKRFSVGSGSLFAYGVLDQGFRHDLSIK  215

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAA  268
            EAAEL RR+IYHATFRD  SGG  SVYHVGP+GW K+SG DVGELHY YYP +A 
Sbjct  216  EAAELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHYEYYPADAV  270



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   278 bits (710),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINP++LGTMAGGAADCQ W RNLG++CRLHEL N +RI+V  ASKLLAN LYSY
Sbjct  95   VKKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRITVRAASKLLANTLYSY  154

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +G GLS+GTM+AG D  GPGLYYVDSEG RLKG RFSVGSGS +AYGVLD GY++DL+VE
Sbjct  155  KGKGLSMGTMVAGWDLNGPGLYYVDSEGTRLKGQRFSVGSGSLFAYGVLDQGYKWDLTVE  214

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            EA EL RR+IYHATFRD  SGG  SVYHVG NGW K++GDDVGELH+ YYP
Sbjct  215  EACELGRRAIYHATFRDAFSGGTVSVYHVGANGWTKVTGDDVGELHFSYYP  265



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 143/184 (78%), Gaps = 25/184 (14%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILY+Y
Sbjct  88   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTM+AG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+G        
Sbjct  148  RGMGLSVGTMVAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSG--------  199

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
                             G +     VY+VGPNGWKKLSGDDVGELHYHYYPV  + VE E
Sbjct  200  -----------------GLTKFYVLVYYVGPNGWKKLSGDDVGELHYHYYPVMPSTVEQE  242

Query  252  MTEV  241
            M EV
Sbjct  243  MVEV  246



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W RNLG +CRL+EL N +RISV  ASKLLAN+++SY
Sbjct  90   VKKVIEINPYLLGTMAGGAADCQFWQRNLGQQCRLYELNNGKRISVRAASKLLANVMFSY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +G GLS+GTM+AG D  GPGLYYVDS+G R KG  FSVGSGS YAYGVLDNGY++D+ VE
Sbjct  150  KGYGLSMGTMVAGYDPTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYGVLDNGYKWDMDVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            +A EL RRSIYHATFRD  SGG  SVYHV  +GWKK+ GDDVGELHY YYP   A   H 
Sbjct  210  DAIELGRRSIYHATFRDAVSGGTVSVYHVTADGWKKVRGDDVGELHYEYYPTPEAHPCHR  269

Query  252  MTEVPIA  232
               +  A
Sbjct  270  ADPLETA  276



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 152/192 (79%), Gaps = 8/192 (4%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINP++LGTMAGGAADCQ W RNLG +CRL+ELAN +RI+V GASKLLAN ++SY
Sbjct  90   VKKVIEINPHLLGTMAGGAADCQFWERNLGRQCRLYELANGKRITVRGASKLLANTMFSY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTM+AG DE GPGLYYVDS+G R KG  FSVGSGS YAYGVLD GYR+DLSVE
Sbjct  150  RGMGLSMGTMVAGWDEAGPGLYYVDSDGQRTKGKLFSVGSGSLYAYGVLDEGYRWDLSVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA EL +RSIYHATFRD ASGG  S YHV   GW K+ G+DVG+LH++YYP   A  EH 
Sbjct  210  EAVELGQRSIYHATFRDAASGGTVSAYHVTQEGWTKVRGEDVGQLHFNYYP---APEEH-  265

Query  252  MTEVPIA*TDPF  217
                P    DP 
Sbjct  266  ----PCNSKDPL  273



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   260 bits (665),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAAD Q WHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSY
Sbjct  12   VKKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  71

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLSVGTMIAG DE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  72   RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  131

Query  432  EAAELARRSIYHATFRDGA  376
            EA+ELARRSIYHATFRDGA
Sbjct  132  EASELARRSIYHATFRDGA  150



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEIN +++GTMAGGAADCQ W RNLG++CRL+EL N +RI+V  ASKLLAN ++SY
Sbjct  89   VKKVIEINKHLIGTMAGGAADCQFWQRNLGMRCRLYELNNGKRITVCAASKLLANTMFSY  148

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTM+AG D  GPGLYYVDS+G R KG  FSVGSGS YAYGVLD+GYR+DLSVE
Sbjct  149  RGMGLSMGTMVAGWDSTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYGVLDSGYRWDLSVE  208

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA EL RRSIYHA FRD ASGG  SVYHV  +GW K+ GDDV ELHY YYP  A   +H 
Sbjct  209  EAIELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDVTELHYQYYPDPA---QHP  265

Query  252  MTEVPI  235
             T   +
Sbjct  266  ATATSV  271



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   261 bits (667),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEIN ++LGTMAGGAADCQ W RNLG++CRL+EL N +RI+V  ASKLL+N+++SY
Sbjct  90   VKKVIEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTM+AG D  GPGLYYVDS+G R KG  FSVGSGS YAYGVLD GYR+D+ VE
Sbjct  150  RGMGLSMGTMVAGWDPTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYGVLDAGYRWDMPVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            EA EL RRSIYHA FRD ASGG  SVYHV  +GW K+ GDD+ ELHY YYP
Sbjct  210  EAVELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDISELHYQYYP  260



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLG---VKCRLHELANKRRISVAGASKLLANIL  622
            VKK+IEINP++LGTMAGGAADCQ W RNLG   V CRL+EL N +RI+V GASKLLAN +
Sbjct  89   VKKVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRITVRGASKLLANTM  148

Query  621  YSYRGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDL  442
            +SYRGMGLS+GTM+AG D  GPGLYYVDS+G R KG RFSVGSGS YAYGVLD GY +D+
Sbjct  149  FSYRGMGLSMGTMVAGWDVAGPGLYYVDSDGQRTKGQRFSVGSGSLYAYGVLDAGYSWDM  208

Query  441  SVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            SVE+A EL +R+IYHAT RD ASGG ASVYHV   GW K+ G+ VGELHY YYP
Sbjct  209  SVEDAVELGQRAIYHATARDAASGGTASVYHVTEAGWTKVRGESVGELHYKYYP  262



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W RNLG +CRL+EL   RRI+V  ASKLLAN ++SY
Sbjct  56   VKKVIEINPYLLGTMAGGAADCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSY  115

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMIAG D  GPGLYYVDS+G R  G RFSVGSGS YAYGVLD GY +D+SVE
Sbjct  116  RGMGLSMGTMIAGWDIGGPGLYYVDSDGQRTGGQRFSVGSGSLYAYGVLDTGYSWDMSVE  175

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            +A EL +R+I+HAT RD ASGG ASVYHV  +GW K+ GD VG+L+Y Y P
Sbjct  176  DAVELGQRAIFHATSRDAASGGTASVYHVTESGWTKVRGDAVGDLYYKYNP  226



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score =   250 bits (638),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  KCRL+EL NK RISVA ASKLLANILY Y
Sbjct  72   VKKVIEINPYLLGTMAGGAADCSFWQRFLAEKCRLYELRNKERISVAAASKLLANILYGY  131

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLSVGTMI G D++GPGLYYVDS+G RL    FSVGSGS YAYGVLD+GYR+DLS +
Sbjct  132  KGMGLSVGTMIVGWDKRGPGLYYVDSDGTRLSSVMFSVGSGSTYAYGVLDSGYRYDLSDD  191

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L RR+IYHAT+RD  SGG+ S+YH+  +GW K+S DDV +LHY Y
Sbjct  192  EAYDLGRRAIYHATYRDAYSGGIVSLYHMKESGWVKISQDDVSDLHYTY  240



>gb|EIE87710.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=187

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W R LG +CRLHEL NK RISVA ASKLLAN++YSY
Sbjct  10   VKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSY  69

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY +DLSV+
Sbjct  70   KGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDYDLSVK  129

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  259
            +A EL RRSIYHAT RD  SGG  ++YHV  NGW      DVGELH+ Y    A  ++
Sbjct  130  DALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHWEYQDENAKGMQ  187



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W R LG +CRLHEL NK RISVA ASKLLAN++YSY
Sbjct  100  VKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY +DLSV+
Sbjct  160  KGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYNYDLSVK  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  259
            +A EL RRSIYHAT RD  SGG  ++YHV  NGW      DVGELH+ Y    A  ++
Sbjct  220  DALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHWEYQDENAKGMQ  277



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGT+AGGAADCQ W R LG +CRLHEL NK RISVA ASKLLAN++YSY
Sbjct  100  VKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY FDLSV+
Sbjct  160  KGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDFDLSVK  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  259
            +A EL RRSIYHAT RD  SGG  ++YHV  NGW+     DVG+LH+ Y    A +++
Sbjct  220  DALELGRRSIYHATHRDAMSGGSVNLYHVTENGWEYHGNHDVGQLHWDYQDENAKSMQ  277



>ref|XP_792356.3| PREDICTED: proteasome subunit beta type-5-like [Strongylocentrotus 
purpuratus]
Length=187

 Score =   245 bits (626),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN+LY+Y
Sbjct  14   VKKVIEINPYLLGTMAGGAADCAFWERVLAEQCRIYELRNKERISVAAASKLLANMLYNY  73

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLSVGTMI G D++GPGLYYVDS+G RL  N FSVGSGSPYAYGVLD GY+++LSVE
Sbjct  74   KGMGLSVGTMICGWDKRGPGLYYVDSDGNRLTNNIFSVGSGSPYAYGVLDEGYKWELSVE  133

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +L +R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  134  DALDLGQRAIYHATHRDAYSGGVVNLYHMQETGWVKISSTDVKDLHYRY  182



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R+L  +CRL+EL NK RISVA ASKLLAN +Y+Y
Sbjct  87   VKKVIEINPYLLGTMAGGAADCSFWERHLAKECRLYELRNKERISVAAASKLLANTVYNY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGPGLYYVDS+G RL  N FSVGSGS YAYGVLD+GY +DLSVE
Sbjct  147  KGMGLSMGTMIVGWDKKGPGLYYVDSDGERLTNNMFSVGSGSTYAYGVLDSGYSWDLSVE  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  271
            +A EL +RSIYHAT RD  SGGV ++YH+   GW K+S  DV ELHY Y   +A
Sbjct  207  DAYELGKRSIYHATHRDAYSGGVVNLYHMKQTGWIKVSQTDVKELHYKYQEEKA  260



>ref|XP_005110562.1| PREDICTED: proteasome subunit beta type-5-like [Aplysia californica]
Length=281

 Score =   246 bits (628),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLANI+Y Y
Sbjct  104  VKKVIEINPYLLGTMAGGAADCMFWERALARQCRIYELRNKERISVAAASKLLANIVYDY  163

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGPGLYYVD++G RL+G  FSVGSGS YAYGVLD+GY++DLSVE
Sbjct  164  KGMGLSMGTMIIGWDKKGPGLYYVDNDGERLEGKLFSVGSGSVYAYGVLDSGYKWDLSVE  223

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L RR+IYHAT RD  SGGV ++YH+   GW+K+S  D  ELHY Y
Sbjct  224  EAQDLGRRAIYHATHRDAYSGGVVNLYHMKQTGWEKISQTDTMELHYQY  272



>ref|XP_005994469.1| PREDICTED: proteasome subunit beta type-5-like [Latimeria chalumnae]
Length=260

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  88   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLY+VDSEG R+ G+ FSVGSGS YAYGVLD GY FDLSVE
Sbjct  148  KGMGLSMGTMICGWDKRGPGLYFVDSEGNRITGDNFSVGSGSVYAYGVLDRGYHFDLSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IYHAT+RD  SGGV ++YHV  +GW ++  DDV ELH  +
Sbjct  208  EAYDLARRAIYHATYRDAYSGGVVNIYHVREDGWFRVFQDDVLELHEEF  256



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W R LG +CRL+EL NK RISVA ASK+L+N++Y Y
Sbjct  101  VKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKILSNMVYDY  160

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+ GP L+YVDS+G R++G RFSVGSGS +AYGVLD GY F+LSV 
Sbjct  161  KGMGLSMGTMITGWDKTGPALFYVDSDGTRMRGERFSVGSGSTFAYGVLDTGYDFNLSVP  220

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  262
            +A EL RR+IYHAT RD  SGG  +V+HV   GW+ +   DVGELH+HY+     A+
Sbjct  221  DAIELGRRAIYHATHRDAYSGGSVNVFHVKETGWEFIGNYDVGELHWHYHAQPKGAI  277



>gb|AAI55951.1| LOC100127332 protein [Xenopus laevis]
Length=253

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  80   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  139

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G+ FSVGSGS YAYGVLD+GY ++L VE
Sbjct  140  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYGVLDSGYNYELEVE  199

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA ELARRSIY AT+RD  SGGV ++YHV  +GW ++S DDV ELH  Y
Sbjct  200  EAQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVLELHQKY  248



>ref|XP_011441202.1| PREDICTED: proteasome subunit beta type-5-like [Crassostrea gigas]
Length=275

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLANI+Y+Y
Sbjct  100  VKKVIEINPYLLGTMAGGAADCAYWERVLARQCRIYELRNKERISVAAASKLLANIVYNY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDS+G R+  N +SVGSGS YAYGVLD+GYR+DLSVE
Sbjct  160  KGMGLSMGTMICGWDKRGPGLYYVDSDGERMSNNIYSVGSGSVYAYGVLDSGYRYDLSVE  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L RRSIYHAT RD  SGGV ++YH+  +GW+ +S  DV +LHY Y
Sbjct  220  EAIDLGRRSIYHATHRDAYSGGVVNLYHMKESGWEFISQTDVFDLHYQY  268



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R LG +CRL+EL NK RISVA ASKLLAN++Y+Y
Sbjct  100  VKKVIEINPYLLGTMAGGAADCIFWQRELGRRCRLYELRNKERISVAAASKLLANMVYAY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+AG D+ GP ++Y+DS+G RLKG+ FSVGSGSP+AYGV+D+G+ +DLSV+
Sbjct  160  KGMGLSMGTMVAGWDKTGPSIFYIDSDGTRLKGDLFSVGSGSPFAYGVVDSGFDYDLSVQ  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RRSIYHA  RD ASGG  +VYHV  +GW+ +   DVG+LH+ Y
Sbjct  220  EAIELGRRSIYHAAHRDSASGGSINVYHVKQDGWEFIGNYDVGDLHWEY  268



>gb|ADQ00176.1| 20S proteasome beta subunit E type beta 5 [Chlamydomonas sp. 
ICE-L]
Length=170

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  750  MAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGS  571
            MAGGAADCQ W RNLG +CRL+EL N +RI+V  ASKLLAN ++SYRGMGLS+GTM+AG 
Sbjct  1    MAGGAADCQFWQRNLGKQCRLYELNNGKRITVCAASKLLANTMFSYRGMGLSMGTMVAGF  60

Query  570  DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHAT  391
            D  GPGLYYVDS+G R KG RFSVGSGS YAYG+LD+GY++D+ V+EA EL RR+IYHAT
Sbjct  61   DATGPGLYYVDSDGQRTKGQRFSVGSGSLYAYGILDSGYKWDMPVDEAIELGRRAIYHAT  120

Query  390  FRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            FRD ASGG  SVYHV  +GWKK+ GDDV ELHY YYP
Sbjct  121  FRDCASGGTVSVYHVTKDGWKKVHGDDVSELHYKYYP  157



>gb|AAY98499.1| LMP X [Swiftia exserta]
Length=268

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  95   VKKVIEINPYLLGTMAGGAADCSYWERVLAKQCRIYELRNKERISVAAASKLLANMVYYY  154

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMI G D++GPGLYYVDS+G RL  N FSVGSGS +AYGVLD+GYR DLSV+
Sbjct  155  RGMGLSMGTMICGWDKRGPGLYYVDSDGSRLSNNIFSVGSGSTFAYGVLDSGYRPDLSVQ  214

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L  R+IYHAT RD  SGGV ++YH+   GW K+S +DVG+LHY Y
Sbjct  215  EAYDLGERAIYHATHRDAYSGGVVNMYHMQETGWVKVSQNDVGQLHYKY  263



>ref|XP_002941560.1| PREDICTED: proteasome subunit beta type-5 [Xenopus (Silurana) 
tropicalis]
Length=257

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  84   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  143

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G+ FSVGSGS YAYGVLD GY +++ VE
Sbjct  144  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYGVLDRGYNYEMEVE  203

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA ELARRSIY AT+RD  SGGV ++YHV  +GW ++S DDV +LH  Y
Sbjct  204  EAQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVADLHQKY  252



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R LG + RL+EL NK RISVA ASKLL+N++Y Y
Sbjct  37   VKKVIEINPYLLGTMAGGAADCSFWERELGRRARLYELRNKERISVAAASKLLSNMVYGY  96

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGL+YVDS+G RLK + FSVGSGS YAYGVLD GY +DLSV 
Sbjct  97   KGMGLSMGTMITGWDKQGPGLFYVDSDGQRLKNHMFSVGSGSTYAYGVLDAGYDYDLSVN  156

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  292
            +A +LARRSIYHATFRD  SGG  +VYHV  +GWK +S  DV +LHY
Sbjct  157  DAIDLARRSIYHATFRDAYSGGSVNVYHVQQDGWKFISNTDVMDLHY  203



>gb|AAL74417.1| proteosome PSMB5/8 protein [Branchiostoma lanceolatum]
Length=194

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLANI+Y+Y
Sbjct  30   VKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISVAAASKLLANIVYNY  89

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDS+G RL  N FSVGSGS YAYGVLD+GY++D+SVE
Sbjct  90   KGMGLSMGTMIVGWDKRGPGLYYVDSDGTRLSNNMFSVGSGSTYAYGVLDSGYKWDMSVE  149

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGEL  298
            EA EL +RSIYHAT RD  SGGV ++YH+   GW K+S  DV +L
Sbjct  150  EAYELGKRSIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVMDL  194



>ref|XP_004994692.1| LMP X protein [Salpingoeca rosetta]
 gb|EGD72869.1| LMP X protein [Salpingoeca rosetta]
Length=292

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CRL EL N  RISVA ASK+LANI+Y Y
Sbjct  110  VKKVIEINPYLLGTMAGGAADCSYWERVLAKECRLFELRNGERISVAAASKILANIVYHY  169

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RGMGLS+GTMI G D+KGPGL+YVDS+G RL  N FSVGSGS YAYGVLD GYR+DLSVE
Sbjct  170  RGMGLSMGTMICGWDKKGPGLFYVDSDGTRLTNNLFSVGSGSTYAYGVLDAGYRWDLSVE  229

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKK-LSGDDVGELHYHY  286
            EA ELARR+IYHATFRD  SGG  ++YH+   GW++ L+  DVG LHY Y
Sbjct  230  EAHELARRAIYHATFRDAYSGGHINLYHMKETGWERILNMQDVGPLHYEY  279



>gb|ABQ50544.1| hypothetical protein [Brassica rapa]
Length=218

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 129/183 (70%), Gaps = 45/183 (25%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+K                            
Sbjct  77   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIK----------------------------  108

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
                             GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVE
Sbjct  109  -----------------GPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVE  151

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA+ELARRSIYHATFRDGASGGVASVYHVGPNGW KLSGDDVGELHYHYYPV  A  E  
Sbjct  152  EASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHYYPVPPAIAEQV  211

Query  252  MTE  244
            M E
Sbjct  212  MEE  214



>ref|XP_007439509.1| PREDICTED: proteasome subunit beta type-5 [Python bivittatus]
Length=265

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  88   VKKIIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  147

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY  DLSVE
Sbjct  148  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYGVMDRGYSHDLSVE  207

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  262
            EA +LARR+IY AT+RD  SGG  +VYHVGP+GW ++S DDV  L   +    + AV
Sbjct  208  EAYDLARRAIYQATYRDAYSGGSVNVYHVGPDGWIRVSSDDVSNLRELFRDTASEAV  264



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W R LG++CRL+EL NKRRISVA ASKLL+NI+Y Y
Sbjct  115  VKKVIEINPYLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQY  174

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +  GLS+GTMIAG D  GP L+ VD++G RLKG RFSVGSGS YAYGVLD GYR DL+ E
Sbjct  175  KDHGLSMGTMIAGWDHTGPNLFMVDNDGTRLKGTRFSVGSGSLYAYGVLDQGYRADLTEE  234

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEH  256
            EA EL RR+IYHAT RD  SGG+ +VY +  +GW K+S  D+ ELHY  Y  E   +++
Sbjct  235  EACELGRRAIYHATHRDAYSGGIINVYLIRSDGWTKISSTDMNELHYGKYAPEKGILDN  293



>ref|XP_005825075.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
 gb|EKX38095.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
Length=290

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK IEI PY+LGTMAGGAADC  W R+LG  CRL+EL NK RI+ A ASKLL NI+YSY
Sbjct  107  VKKCIEITPYLLGTMAGGAADCMFWERHLGRLCRLYELRNKERITTAAASKLLHNIMYSY  166

Query  612  RGMGLSVGTMIAGSDEK-GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSV  436
            +G GLS+GTMIAG D+  GP LYY DSEG R+KG +FSVGSGSPYAYGVLD GY+FD+S+
Sbjct  167  KGYGLSMGTMIAGWDKDIGPNLYYCDSEGTRVKGQKFSVGSGSPYAYGVLDEGYKFDMSI  226

Query  435  EEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            ++A EL RR+IYHATFRD  SGG  SVYHV  NGW K+S DDV  LH  Y
Sbjct  227  DDACELGRRAIYHATFRDAMSGGRVSVYHVHENGWTKISMDDVQLLHEKY  276



>pdb|3UNB|K Chain K, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|Y Chain Y, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|MM Chain m, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|1 Chain 1, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|K Chain K, Mouse Constitutive 20s Proteasome
 pdb|3UNE|Y Chain Y, Mouse Constitutive 20s Proteasome
 pdb|3UNE|MM Chain m, Mouse Constitutive 20s Proteasome
 pdb|3UNE|1 Chain 1, Mouse Constitutive 20s Proteasome
Length=205

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  31   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  90

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  91   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVE  150

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  277
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  151  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSV  202



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W R +  +CR++EL NK RISVA ASKLLANI+Y+Y
Sbjct  102  VKKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVAAASKLLANIVYNY  161

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGPGLYYVDS+G R+    FSVGSGS YAYGVLD+ YR+DLSVE
Sbjct  162  KGMGLSMGTMICGWDKKGPGLYYVDSDGTRMTNAMFSVGSGSTYAYGVLDSSYRWDLSVE  221

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA  L  R+IYHA  RD  +GGV ++YH+  +GW K+S +D+GELHY +
Sbjct  222  EAYALGERAIYHAAHRDAFTGGVVNMYHMKESGWVKVSQNDIGELHYKF  270



>emb|CAA66312.1| LMP7-like protein [Geodia cydonium]
Length=280

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L   CR++EL NK RISVA ASK+L+N++Y Y
Sbjct  105  VKKVIEINPYLLGTMAGGAADCAYWERQLAFSCRVYELRNKERISVAAASKILSNMVYRY  164

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGPGLYYVDS+G RL  + FSVGSGS YAYGVLD+GY +DLSVE
Sbjct  165  KGMGLSMGTMICGWDKKGPGLYYVDSDGSRLTHHMFSVGSGSTYAYGVLDSGYSYDLSVE  224

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L +R+IYHAT RD  SGGV ++YH+   GW K+S  DV ELHY Y
Sbjct  225  EARDLGKRAIYHATHRDAYSGGVVNLYHMMETGWVKVSQTDVKELHYQY  273



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   241 bits (615),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W R LG +CRL+EL NK RISVA ASKLL N++YSY
Sbjct  100  VKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKLLGNMVYSY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY FDLSV 
Sbjct  160  KGMGLSMGTMITGWDKTGPNLFYVDSDGQRLKGDLFSVGSGSTFAYGVLDSGYDFDLSVS  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A EL +RSIYHAT RD  SGG  ++YHV  +GW+     DVG LHY Y
Sbjct  220  DALELGKRSIYHATHRDAMSGGSVNLYHVTESGWEYHGNHDVGPLHYEY  268



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLANI+Y+Y
Sbjct  102  VKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISVAAASKLLANIVYNY  161

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDS+G RL  N FSVGSGS YAYGVLD+GY +D+ VE
Sbjct  162  KGMGLSMGTMIVGWDKRGPGLYYVDSDGTRLSNNMFSVGSGSTYAYGVLDSGYSWDMGVE  221

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL +R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  222  EAYELGKRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVMDLHYKY  270



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y+Y
Sbjct  102  VKKVIEINPYLLGTMAGGAADCSFWERVLSQQCRIYELRNKERISVAAASKLLANMVYNY  161

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDS+G R+    FSVGSGS YAYGVLD+GYR++LSV+
Sbjct  162  KGMGLSMGTMICGWDKRGPGLYYVDSDGTRITNYMFSVGSGSTYAYGVLDSGYRYELSVQ  221

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L +R+IYHAT RD  SGGV ++YH+   GW K+S +DV ELHY Y
Sbjct  222  EAYDLGQRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQNDVKELHYKY  270



>ref|XP_007258118.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Astyanax 
mexicanus]
 ref|XP_007258119.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Astyanax 
mexicanus]
Length=269

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  96   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  155

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G++F+VGSGS YAYGVLD+G R DL+VE
Sbjct  156  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRVCGDQFAVGSGSMYAYGVLDSGLRQDLTVE  215

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  271
            EA +L RR+IY AT+RD  SGG  ++YHV   GWK++S +DV +LH+ Y   +A
Sbjct  216  EACDLGRRAIYQATYRDAYSGGQVNLYHVHSEGWKRVSQEDVLQLHHQYQSQKA  269



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W   LG++CRLHEL NK RISVA ASK+L+N++YSY
Sbjct  92   VKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSY  151

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+ GP +YYVDSEG R+KG+ FSVGSGS +AYGVLD GY +DLS E
Sbjct  152  KGMGLSMGTMICGWDKSGPAIYYVDSEGSRMKGDLFSVGSGSTFAYGVLDQGYHWDLSEE  211

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  292
            EA +L RRSIY AT RD  SG   ++YH+GPNGW+ ++  DV +LHY
Sbjct  212  EALDLGRRSIYAATHRDAYSGNTINLYHMGPNGWRFIANYDVMQLHY  258



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASK+LAN++Y+Y
Sbjct  87   VKKVIEINPYLLGTMAGGAADCMFWERVLAKQCRIYELRNKERISVAAASKILANMVYNY  146

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+ GPGL+YVDS+G RLKGN FSVGSGS YAYGV+D+GYR+DLSV 
Sbjct  147  KGMGLSMGTMICGWDKHGPGLFYVDSDGQRLKGNMFSVGSGSTYAYGVMDSGYRYDLSVA  206

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  292
            EA +L +RSIYHAT RD  SGGV ++YH+   GW+ +S  DV ++HY
Sbjct  207  EALDLGKRSIYHATHRDAYSGGVVNLYHMKETGWEFISQTDVLDIHY  253



>ref|XP_008332973.1| PREDICTED: proteasome subunit beta type-5 [Cynoglossus semilaevis]
Length=278

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  99   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  158

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R+DLSV+
Sbjct  159  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVSGDLFAVGSGSMYAYGVMDSGLRYDLSVD  218

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            EA EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV +LH  Y   E      E
Sbjct  219  EACELGRRAIYQATYRDAYSGGQVNLYHVQSEGWTRVSQDDVLKLHQKYNDQEKLETAQE  278



>pdb|4R3O|L Chain L, Human Constitutive 20s Proteasome
 pdb|4R3O|Z Chain Z, Human Constitutive 20s Proteasome
 pdb|4R67|L Chain L, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|Z Chain Z, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|NN Chain n, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|3 Chain 3, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=201

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  31   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  90

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  91   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  150

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  151  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  199



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y
Sbjct  100  VKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY +DLS++
Sbjct  160  KGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDYDLSIK  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  220  EALELGRRSIYHATHRDAMSGGSVNLYHVTEKGWTYHGNHDVGSLHWEY  268



>pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|Z Chain Z, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
Length=204

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  31   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  90

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  91   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  150

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  151  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  199



>dbj|BAE93066.1| low molecular mass polypeptide [Lethenteron camtschaticum]
Length=204

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  32   VKKVIEINPYLLGTMAGGAADCMYWERVLAKQCRIYELRNKERISVAAASKLLANMVYQY  91

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGPGLYYVD EG RL G+ F+VGSGSPYA+GVLD+GYR DLS E
Sbjct  92   KGMGLSMGTMICGWDKKGPGLYYVDDEGMRLPGSMFAVGSGSPYAFGVLDSGYREDLSKE  151

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L RR+I  AT RD  SGGV ++YH+   GW K+S DDV EL Y +
Sbjct  152  EAYDLGRRAIASATHRDAYSGGVVNLYHMCQTGWIKVSQDDVSELQYKF  200



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINP++LGTMAGGAADC  W RNLG++CRL+EL N RRI+VA ASKLLAN++ +Y
Sbjct  105  VKKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVAAASKLLANVMSAY  164

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RG GLS+GTMI G DE GP LYYVD++G RLKG  FSVGSGS YAYGVLDN +R DLSVE
Sbjct  165  RGYGLSMGTMITGWDETGPQLYYVDNDGTRLKGKYFSVGSGSMYAYGVLDNHWREDLSVE  224

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L +R+IYHAT RD ASGG+ ++YHV  +GWK + G DV ++HY +
Sbjct  225  EAIDLGKRAIYHATHRDAASGGINNLYHVTADGWKYIHGIDVNDMHYEF  273



>gb|EPY87607.1| proteasome subunit beta type-5-like isoform 1 [Camelus ferus]
Length=198

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  25   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  84

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  85   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLEVE  144

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  145  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  193



>gb|ADL27419.1| proteasome subunit beta type [Pheronema raphanus]
Length=279

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
             KK+IEINPY+LGTMAGGAADC  W R L  +CRL+EL NK RISVA ASK+L+N LY Y
Sbjct  106  CKKVIEINPYLLGTMAGGAADCSYWERRLAQECRLYELRNKERISVAAASKVLSNFLYYY  165

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLSVGTMI G D+KGPGLYYVDS+G R+  + FSVGSGS YAYGVLD+GY++DLS +
Sbjct  166  KGMGLSVGTMICGWDKKGPGLYYVDSDGTRMTHHMFSVGSGSVYAYGVLDSGYKWDLSDD  225

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RRSIYHAT RD  SGGV ++YH+   GW K+S DDV  LHY Y
Sbjct  226  EARELGRRSIYHATHRDAYSGGVVNLYHMKETGWIKISQDDVMTLHYKY  274



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  131  VKKVIEINPYLLGTMAGGAADCSFWERELARRCRIYELRNKERISVAAASKLLANMVYGY  190

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            + MGLS+GTMI G D++GP LYYVDS+G RL G+ FSVGSGS YAYGVLD G+R+D++ E
Sbjct  191  KNMGLSMGTMITGWDKRGPELYYVDSDGTRLHGDMFSVGSGSTYAYGVLDAGFRYDMTPE  250

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RRSIYHAT RD  SGG  +VYHV   GW K+S  DV +LHY Y
Sbjct  251  EACELGRRSIYHATHRDAYSGGFVNVYHVREEGWVKISSTDVNQLHYGY  299



>ref|XP_001745267.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89845.1| predicted protein [Monosiga brevicollis MX1]
Length=247

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L ++CRL+EL N  RISVA ASK+LANI+++Y
Sbjct  70   VKKVIEINPYLLGTMAGGAADCSYWERYLAMQCRLYELRNGERISVAAASKVLANIVWNY  129

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            R MGLS+GTM+ G D+KGPGL+YVDS+G RL  N FSVGSGS YAYGVLD GY++DLS E
Sbjct  130  RNMGLSMGTMVCGWDKKGPGLFYVDSDGTRLTNNMFSVGSGSTYAYGVLDAGYKWDLSDE  189

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L RR+IYHATFRD  SGG  ++YH+   GW K+S D V +LHY Y
Sbjct  190  EAQDLGRRAIYHATFRDAYSGGTVNLYHMRQTGWVKISADSVHDLHYRY  238



>gb|EFA82937.1| proteasome subunit beta type 5 [Polysphondylium pallidum PN500]
Length=277

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEI PY+LGTMAGGAADC  W R LG +CRL EL NK  ISVA ASK+LANI+Y Y
Sbjct  93   VKKVIEITPYLLGTMAGGAADCSYWERELGRQCRLFELRNKEMISVAAASKILANIVYGY  152

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +G GLS+GTM+ G D+ GP LYYVDSEG RLKG RF+VGSGS YAYGVLD+G+ ++++ E
Sbjct  153  KGYGLSMGTMVTGWDKTGPCLYYVDSEGTRLKGLRFAVGSGSTYAYGVLDSGFDWNMTDE  212

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  259
            +A EL RRS+YHAT RD  SGG  +VYHV  +GWKK+S DD  +L+  YY V+A  V+
Sbjct  213  QACELGRRSVYHATHRDAMSGGFINVYHVQKDGWKKISSDDCFQLYQKYYNVKATGVD  270



>dbj|BAA08204.1| proteasome subunit RCX [Rattus rattus]
Length=208

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  35   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  94

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VE
Sbjct  95   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVE  154

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  155  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  203



>ref|XP_008292170.1| PREDICTED: proteasome subunit beta type-5 [Stegastes partitus]
Length=271

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  99   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  158

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G RFDL+VE
Sbjct  159  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGLRFDLTVE  218

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA ELARR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH  Y
Sbjct  219  EACELARRAIYQATYRDAYSGGQVNLYHVHGKGWTRVSQDDVLMLHQQY  267



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYTYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>dbj|BAA06097.1| proteasome subunit X [Homo sapiens]
 gb|AAP35423.1| proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|AIC59195.1| hypothetical protein, partial [synthetic construct]
Length=208

 Score =   237 bits (604),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  35   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  94

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  95   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  154

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  155  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  203



>gb|AAP36588.1| Homo sapiens proteasome (prosome, macropain) subunit, beta type, 
5 [synthetic construct]
Length=209

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  35   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  94

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  95   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  154

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  155  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  203



>ref|XP_004694702.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Condylura 
cristata]
Length=208

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  35   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  94

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  95   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVE  154

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  155  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  203



>dbj|GAM19629.1| hypothetical protein SAMD00019534_028040 [Acytostelium subglobosum 
LB1]
Length=280

 Score =   239 bits (609),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEI P +LGTMAGGAADC  W R LG +CRL++L NK  ISV+ ASK+LANI+YSY
Sbjct  94   VKKVIEITPNLLGTMAGGAADCSFWERELGRRCRLYQLRNKELISVSAASKILANIVYSY  153

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +G GLS+GTM+ G D+ GP LYYVD++G RLKG RFSVGSGS YAYGVLD+G+++++S E
Sbjct  154  KGYGLSMGTMVTGWDKTGPCLYYVDNDGTRLKGQRFSVGSGSTYAYGVLDSGFKWEMSNE  213

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  259
            EA EL RRS+YHAT RD  SGG  +VYHV  +GWKK+S DD  +L+  YY V AA V+
Sbjct  214  EAYELGRRSVYHATNRDAMSGGFINVYHVQKDGWKKISSDDCFQLYQKYYNVRAAGVD  271



>ref|XP_006835507.1| PREDICTED: proteasome subunit beta type-5 [Chrysochloris asiatica]
Length=263

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V ELH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVAELHDKY  258



>gb|EWM22648.1| proteasome subunit beta type 5 [Nannochloropsis gaditana]
Length=278

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W RNLG++CRL+EL +K RISVA ASKLLAN +  Y
Sbjct  100  VKKVIEINPYLLGTMAGGAADCSFWERNLGIQCRLYELRHKERISVAAASKLLANTVMQY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            RG GLS+GTMI G D+ GP L+YVD++G RLKGN FSVGSGS YAYGVLD  YR DLS +
Sbjct  160  RGYGLSMGTMITGWDKTGPQLFYVDNDGMRLKGNLFSVGSGSTYAYGVLDAHYRKDLSAD  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  262
            EA EL RR+IYHAT RD  SGG+ +VYHV   GW K+   D  ELHY Y   + A++
Sbjct  220  EAIELGRRAIYHATHRDAYSGGIINVYHVQEQGWVKVFSGDCNELHYKYQEEKTASM  276



>ref|XP_004698955.1| PREDICTED: proteasome subunit beta type-5 [Echinops telfairi]
Length=263

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_003421032.1| PREDICTED: proteasome subunit beta type-5 [Loxodonta africana]
Length=263

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_001626004.1| predicted protein [Nematostella vectensis]
 gb|EDO33904.1| predicted protein [Nematostella vectensis]
Length=279

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASK+LAN++Y Y
Sbjct  105  VKKVIEINPYLLGTMAGGAADCSFWERLLAKQCRIYELRNKERISVAAASKILANMVYYY  164

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGPGLYYVDS+G RL    FSVGSGS YAYGV+D+GY++D+S E
Sbjct  165  KGMGLSMGTMICGWDKKGPGLYYVDSDGTRLSNQMFSVGSGSTYAYGVMDSGYKYDMSPE  224

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L  RSIYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  225  EAYDLGVRSIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVAKLHYQY  273



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CRL++L NK RISVA ASKLLAN++Y Y
Sbjct  103  VKKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVAAASKLLANMVYQY  162

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDS+G RLKG+ FSVGSGS YAYGVLD  +++DL++E
Sbjct  163  KGMGLSMGTMICGWDKRGPGLYYVDSDGSRLKGDLFSVGSGSTYAYGVLDADHKWDLTLE  222

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L  R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  223  EAYDLGNRAIYHATHRDAGSGGVCNLYHMQETGWIKVSQTDVTDLHYKY  271



>ref|XP_004389982.1| PREDICTED: proteasome subunit beta type-5 [Trichechus manatus 
latirostris]
Length=263

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004313402.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Tursiops 
truncatus]
Length=208

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  35   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  94

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  95   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  154

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S ++V +LH  Y
Sbjct  155  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSNNVADLHDKY  203



>gb|EFX81688.1| hypothetical protein DAPPUDRAFT_303318 [Daphnia pulex]
Length=277

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEIN ++LGTMAGGAADC  W R L  +CRL+EL NK RISVA ASKLL N++Y+Y
Sbjct  101  VKKIIEINDFLLGTMAGGAADCTYWERVLSKQCRLYELRNKERISVAAASKLLVNMVYNY  160

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+G MIAG D+KGPGLYYVD++G R  G  FSVGSGS YAYGVLD+GYR DLS E
Sbjct  161  KGMGLSMGVMIAGWDKKGPGLYYVDNDGTRTPGQVFSVGSGSLYAYGVLDSGYRNDLSDE  220

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  274
            EA EL RR+IYHAT+RD +SGG+  VYH+   GW K+S  D  ELHY Y   E
Sbjct  221  EAYELGRRAIYHATYRDASSGGIIRVYHIKSTGWVKISEQDCTELHYQYEEAE  273



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y
Sbjct  100  VKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY  DLSV+
Sbjct  160  KGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDHDLSVK  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  220  DALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGNLHWDY  268



>ref|XP_005978061.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Pantholops 
hodgsonii]
Length=263

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y
Sbjct  100  VKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY  DLSV+
Sbjct  160  KGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDHDLSVK  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  220  DALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGSLHWDY  268



>ref|XP_007949373.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Orycteropus 
afer afer]
Length=263

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_003755883.1| PREDICTED: proteasome subunit beta type-5 [Sarcophilus harrisii]
Length=263

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY FDL+VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSFDLTVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +L+  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLNDKY  258



>ref|XP_005338834.1| PREDICTED: proteasome subunit beta type-5 [Ictidomys tridecemlineatus]
Length=208

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  35   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  94

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  95   KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLDVE  154

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW  +S D+V +LH  Y
Sbjct  155  QAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIHVSSDNVADLHDKY  203



>ref|NP_001032701.1| proteasome subunit beta type-5 [Bos taurus]
 ref|XP_005895501.1| PREDICTED: proteasome subunit beta type-5 [Bos mutus]
 ref|XP_010829574.1| PREDICTED: proteasome subunit beta type-5 [Bison bison bison]
 sp|Q32KL2.1|PSB5_BOVIN RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Bos taurus]
 gb|AAI10040.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Bos taurus]
 tpg|DAA25764.1| TPA: proteasome subunit beta type-5 precursor [Bos taurus]
Length=263

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004421295.1| PREDICTED: proteasome subunit beta type-5 [Ceratotherium simum 
simum]
Length=263

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>gb|ELR56586.1| Proteasome subunit beta type-5, partial [Bos mutus]
Length=266

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  93   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  152

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  153  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  212

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  213  EAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  261



>ref|XP_005933706.1| PREDICTED: proteasome subunit beta type-5-like [Haplochromis 
burtoni]
Length=281

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  109  VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  168

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VE
Sbjct  169  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVE  228

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  229  EACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLMLHHQY  277



>ref|XP_006066544.1| PREDICTED: proteasome subunit beta type-5 [Bubalus bubalis]
Length=263

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWVRVSSDNVADLHDKY  258



>ref|XP_004010385.1| PREDICTED: proteasome subunit beta type-5 [Ovis aries]
 ref|XP_005685312.1| PREDICTED: proteasome subunit beta type-5 [Capra hircus]
Length=263

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004565403.1| PREDICTED: proteasome subunit beta type-5-like [Maylandia zebra]
Length=271

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  99   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  158

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VE
Sbjct  159  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVE  218

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  219  EACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  267



>ref|XP_005707411.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
 gb|EME30891.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
Length=275

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 145/185 (78%), Gaps = 3/185 (2%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEIN Y+LGTMAGGAADC  W R LG++CR+ EL NK RISVA ASK+L N +Y Y
Sbjct  89   VKKVIEINKYLLGTMAGGAADCTFWERYLGMRCRIFELKNKERISVAAASKILCNTVYQY  148

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGP +YYVDSEG RLKG++FSVGSGS +A GVLD GY++++SVE
Sbjct  149  KGMGLSMGTMIMGWDKKGPHIYYVDSEGTRLKGSKFSVGSGSTHALGVLDQGYKWNMSVE  208

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG-ELHYHYYPVEA--AAV  262
            EA EL RRSIYHAT RD  SGG  +VY++GP+GWK +S +D G + HY Y   +A  A  
Sbjct  209  EACELGRRSIYHATHRDAFSGGYINVYYIGPDGWKFISHEDSGFDKHYQYAADKATEAQT  268

Query  261  EHEMT  247
            + +M+
Sbjct  269  QQQMS  273



>gb|KFH65162.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=276

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 139/178 (78%), Gaps = 2/178 (1%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGT+AGGAADCQ W R LG + RLHEL +  RISVA ASK+L+N++Y Y
Sbjct  99   VKKVIEINPYLLGTVAGGAADCQYWERELGRRARLHELRHHERISVAAASKMLSNMVYDY  158

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GM LS+GTMI G D+ GP LYYVDS+G R++G+RF+VGSGS +AYG+LD G+RFD+SV 
Sbjct  159  KGMDLSMGTMITGWDKTGPALYYVDSDGTRMQGDRFAVGSGSTFAYGILDTGFRFDMSVP  218

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY--YPVEAAA  265
            EA EL +R++YHATFRD  SGG   +YHV  +GW+     DV +LH+HY   P EA A
Sbjct  219  EALELGKRAVYHATFRDAYSGGSVHLYHVKSDGWEICGEFDVNQLHWHYKSQPKEAIA  276



>ref|XP_008121563.1| PREDICTED: proteasome subunit beta type-5 [Anolis carolinensis]
Length=279

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  102  VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  161

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY  +LSVE
Sbjct  162  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYGVMDRGYSHNLSVE  221

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH  295
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S DDV +LH
Sbjct  222  EAYDLARRAIYQATYRDAYSGGTVNLYHVRQDGWIRVSSDDVSKLH  267



>ref|XP_005740284.1| PREDICTED: proteasome subunit beta type-5-like [Pundamilia nyererei]
Length=281

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  109  VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  168

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VE
Sbjct  169  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVE  228

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  229  EACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>ref|XP_003457456.2| PREDICTED: proteasome subunit beta type-5-like [Oreochromis niloticus]
Length=281

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  109  VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  168

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VE
Sbjct  169  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVE  228

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  229  EACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>ref|XP_006988553.1| PREDICTED: proteasome subunit beta type-5 [Peromyscus maniculatus 
bairdii]
Length=263

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  NGW ++S D+V +LH  Y
Sbjct  210  DAYDLARRAIYQATYRDAYSGGAVNLYHVRENGWIRVSSDNVADLHDKY  258



>ref|XP_005875924.1| PREDICTED: proteasome subunit beta type-5-like [Myotis brandtii]
 gb|EPQ13719.1| Proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLL N+LY Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLVNMLYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLSVGTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSVGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_002753673.3| PREDICTED: proteasome subunit beta type-5 [Callithrix jacchus]
Length=268

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  95   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  154

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  155  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  214

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  215  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  263



>ref|NP_035316.1| proteasome subunit beta type-5 [Mus musculus]
 sp|O55234.3|PSB5_MOUSE RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Mus musculus]
 gb|AAD50536.1|AF060091_1 proteasome subunit X [Mus musculus]
 dbj|BAA24916.1| PSMB5 [Mus musculus]
 dbj|BAA24917.1| PSMB5 [Mus musculus]
 dbj|BAE21876.1| unnamed protein product [Mus musculus]
 gb|AAI06145.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
 gb|EDL36339.1| mCG8712, isoform CRA_b [Mus musculus]
Length=264

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  277
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSV  261



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   219 bits (559),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPYMLGTMAGGAADCQ WHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  86   VKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNG  457
            RGMGLSVGTMIAG DE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+G
Sbjct  146  RGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSG  197


 Score = 83.2 bits (204),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  470  FLIMGTGLICLLKKLQSWLGGLFIMQRSVMELVEVLPVFTMLGQMDGRNCRVMMLESFTT  291
            + ++ +GL CLLKKL+SWL  LFIMQ S M+ V VL  F M  QMDGR+C VMMLESFTT
Sbjct  191  YGVLDSGLTCLLKKLRSWLEELFIMQHSEMQPVVVLQAFIMWDQMDGRSCLVMMLESFTT  250

Query  290  ITTQLKQQQWSMK  252
            I  Q +  +WS K
Sbjct  251  IIIQSRPVRWSKK  263



>ref|XP_003924370.1| PREDICTED: proteasome subunit beta type-5 [Saimiri boliviensis 
boliviensis]
Length=263

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|EPY26658.1| 20S proteasome subunit beta 5 [Angomonas deanei]
Length=207

 Score =   234 bits (596),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V K++EIN Y+LGTMAGGAADCQ W R LG++CRL EL N  RISVA ASK+L+NI YSY
Sbjct  35   VMKVLEINEYLLGTMAGGAADCQYWERVLGMECRLWELRNGSRISVAAASKILSNITYSY  94

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            R  GLS+GTM+AG D+ GP LYYVD +G R+K N FSVGSGS YAYGVLD GYR +L+VE
Sbjct  95   RNHGLSMGTMVAGWDQFGPSLYYVDDKGSRVKQNLFSVGSGSIYAYGVLDAGYRKNLTVE  154

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            EA +LARRSI+HAT+RDGASGG+ +VYHV  +G+ ++S D+  +L Y Y+P
Sbjct  155  EACDLARRSIFHATYRDGASGGIVTVYHVHKDGYTRISRDNQTDLFYRYFP  205



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPY+LGTMAGGAADC  W R LG++CRLHEL ++ RISVA ASKLLANI+Y Y
Sbjct  101  VKKIIEINPYLLGTMAGGAADCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVYEY  160

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMIAG D+ GP L+YVDS+G RL+G RFSVGSGS +AYGVLD  YR+D+   
Sbjct  161  KGMGLSMGTMIAGWDKTGPQLFYVDSDGVRLRGTRFSVGSGSTFAYGVLDQFYRWDMDAA  220

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYY--------PV  277
            EAAEL RR+I+HAT RD  SGG  +VYHV  +GW  LS DD G   Y  Y        P 
Sbjct  221  EAAELGRRAIFHATHRDAYSGGYINVYHVKADGWVNLSHDDSGITKYAEYMGFRAQTAPT  280

Query  276  EAAAVE  259
             A+ V+
Sbjct  281  TASTVD  286



>ref|XP_008708757.1| PREDICTED: proteasome subunit beta type-5 [Ursus maritimus]
Length=263

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +L   Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWTRVSSDNVADLQDKY  258



>gb|AAH12246.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
Length=264

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  277
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSNDNVADLHDKYSSV  261



>ref|XP_002926051.1| PREDICTED: proteasome subunit beta type-5 [Ailuropoda melanoleuca]
 gb|EFB18962.1| hypothetical protein PANDA_015661 [Ailuropoda melanoleuca]
Length=263

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDEY  258



>dbj|BAA10932.1| LMPX of lamprey [Petromyzon marinus]
Length=273

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  101  VKKVIEINPYLLGTMAGGAADCMYWERVLAKQCRIYELRNKERISVAAASKLLANMVYQY  160

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D+KGPGLYYVD EG RL G+ F+VGSGSPYA+GVLD+GYR DLS E
Sbjct  161  KGMGLSMGTMICGWDKKGPGLYYVDDEGMRLPGSMFAVGSGSPYAFGVLDSGYREDLSKE  220

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +L RR+I  AT RD  SGGV ++YH+   GW K+S DDV EL Y +
Sbjct  221  EAYDLGRRAIASATHRDAYSGGVVNLYHMCQTGWIKVSQDDVSELQYKF  269



>ref|XP_002050049.1| GJ21921 [Drosophila virilis]
 gb|EDW61242.1| GJ21921 [Drosophila virilis]
Length=279

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            +KKI+EIN ++LGT+AGGAADC  W R L  +CRLHEL NK RISVA ASK++ANI + Y
Sbjct  104  MKKIVEINQFLLGTLAGGAADCVYWDRVLAKECRLHELRNKERISVAAASKIMANIAHEY  163

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+G M+AG D++GPGLYYVDSEG R  GN FSVGSGS YA+GVLD+GY +DL   
Sbjct  164  KGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNVFSVGSGSIYAFGVLDSGYHWDLKDT  223

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RR+IYHATFRD  SGG+  VYH+ PNGW K+S  D  ELHY Y
Sbjct  224  EAQELGRRAIYHATFRDAYSGGIVRVYHMTPNGWIKISETDCMELHYKY  272



>gb|ADO27969.1| proteasome subunit beta type-5 [Ictalurus furcatus]
Length=266

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  93   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  152

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGVLD+G+R DL++E
Sbjct  153  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDMFAVGSGSMYAYGVLDSGHRTDLTIE  212

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  271
            EA +L RR+IY ATFRD  SGG  ++Y V   GW+++S DDV  LH+ +   +A
Sbjct  213  EACDLGRRAIYQATFRDAYSGGQVNLYRVHSEGWERVSQDDVLALHHQFQSQKA  266



>ref|NP_001099197.2| proteasome subunit beta type-5 [Rattus norvegicus]
 gb|EDM14180.1| proteasome (prosome, macropain) subunit, beta type 5, isoform 
CRA_a [Rattus norvegicus]
Length=263

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_001379940.1| PREDICTED: proteasome subunit beta type-5 [Monodelphis domestica]
Length=263

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY FDLSVE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSFDLSVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +L+  Y
Sbjct  210  DAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLNDKY  258



>ref|XP_001568804.1| putative proteasome beta 5 subunit [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM43936.1| putative proteasome beta 5 subunit [Leishmania braziliensis MHOM/BR/75/M2904]
Length=302

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V K++EIN Y+LGT+AGGAADCQ W R LG++CRL EL N  RISVA ASK+LANI Y+Y
Sbjct  130  VLKVLEINDYLLGTLAGGAADCQYWERVLGMECRLWELRNGSRISVAAASKILANITYAY  189

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            R  GLS+GTM+AG D+ GP LYYVD +G R+K + FSVGSGS YAYGVLD GYR DLSVE
Sbjct  190  RNHGLSMGTMVAGWDQFGPSLYYVDDKGSRVKQDLFSVGSGSIYAYGVLDTGYRKDLSVE  249

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  274
            +A +LARRSI+HAT+RDGASGG+ +VYH+  NGW K+S DD  +L+  Y+P +
Sbjct  250  DACDLARRSIFHATYRDGASGGIVTVYHIHANGWTKISRDDQTKLYDRYFPFK  302



>sp|P28075.3|PSB5_RAT RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Rattus norvegicus]
Length=263

 Score =   235 bits (600),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score =   236 bits (602),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADCQ W R L ++CRL+EL NK RISVA ASKLLAN++Y Y
Sbjct  109  VKKVIEINPYLLGTMAGGAADCQFWERVLAMECRLYELRNKERISVAAASKLLANMVYQY  168

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D+KGPGLYYVD  G RL+G+ FSVGSGS +AYGVLD GY +D+ VE
Sbjct  169  KGMGLSMGTMVCGWDKKGPGLYYVDDGGQRLEGSLFSVGSGSLFAYGVLDEGYSYDIEVE  228

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEH  256
             A +LA RSIYHAT+RD ASGG  ++YH+   GW+     DV ELH+ Y+  + A  + 
Sbjct  229  AAKDLAIRSIYHATYRDAASGGFVNLYHMKETGWEHCGWMDVKELHWKYHDEKIARAQQ  287



>ref|XP_006883201.1| PREDICTED: proteasome subunit beta type-5 [Elephantulus edwardii]
Length=263

 Score =   235 bits (600),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTM GGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMTGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  KAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004694701.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Condylura 
cristata]
Length=263

 Score =   235 bits (600),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_007449602.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Lipotes 
vexillifer]
Length=263

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_003987515.1| PREDICTED: proteasome subunit beta type-5 [Felis catus]
 ref|XP_007098030.1| PREDICTED: proteasome subunit beta type-5 [Panthera tigris altaica]
Length=263

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_010376681.1| PREDICTED: proteasome subunit beta type-5 [Rhinopithecus roxellana]
Length=271

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  98   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  157

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  158  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  217

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  218  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  266



>ref|XP_006100131.1| PREDICTED: proteasome subunit beta type-5 [Myotis lucifugus]
Length=263

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004283228.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Orcinus 
orca]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006217298.1| PREDICTED: proteasome subunit beta type-5 [Vicugna pacos]
 ref|XP_010953019.1| PREDICTED: proteasome subunit beta type-5 [Camelus bactrianus]
 ref|XP_010987732.1| PREDICTED: proteasome subunit beta type-5 [Camelus dromedarius]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004402154.1| PREDICTED: proteasome subunit beta type-5 [Odobenus rosmarus 
divergens]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_007180616.1| PREDICTED: proteasome subunit beta type-5 [Balaenoptera acutorostrata 
scammoni]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>dbj|BAA10935.1| nurse shark LMPX [Ginglymostoma cirratum]
Length=259

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  86   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  145

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGVLD  YR D+S  
Sbjct  146  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGQIFSVGSGSVYAYGVLDRAYRHDMSPT  205

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA ELA+++IYHAT+RD  SGG+ S+YHV   GW ++  DDV +LH  Y
Sbjct  206  EAYELAKQAIYHATYRDAYSGGIVSLYHVKETGWVRICRDDVMDLHQKY  254



>ref|XP_010703107.1| proteasome beta 5 subunit, putative [Leishmania panamensis]
 gb|AIO02307.1| proteasome beta 5 subunit, putative [Leishmania panamensis]
Length=302

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V K++EIN Y+LGT+AGGAADCQ W R LG++CRL EL N  RISVA ASK+LANI Y+Y
Sbjct  130  VLKVLEINDYLLGTLAGGAADCQYWERVLGMECRLWELRNGSRISVAAASKILANITYAY  189

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            R  GLS+GTM+AG D+ GP LYYVD +G R+K + FSVGSGS YAYGVLD GYR DLSVE
Sbjct  190  RNHGLSMGTMVAGWDQFGPSLYYVDDKGSRVKQDLFSVGSGSIYAYGVLDTGYRKDLSVE  249

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            +A +LARRSI+HAT+RDGASGG+ +VYH+  NGW K+S DD  +L+  Y+P
Sbjct  250  DACDLARRSIFHATYRDGASGGIVTVYHIHANGWTKISRDDQTKLYDRYFP  300



>ref|XP_008156742.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Eptesicus 
fuscus]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006776843.1| PREDICTED: proteasome subunit beta type-5 [Myotis davidii]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLDVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  104  VKKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVAAASKLLANMVYYY  163

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDS+G R+    FSVGSGS YAYG+LD+G++ DL  E
Sbjct  164  KGMGLSMGTMICGWDKRGPGLYYVDSDGTRMTNYMFSVGSGSTYAYGILDSGFKHDLEDE  223

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+I+HAT RD  SGG  ++YHV   GW K+S DDVG L+Y Y
Sbjct  224  EAYDLARRAIFHATHRDAYSGGSVNLYHVKETGWVKISRDDVGPLYYQY  272



>ref|XP_003260670.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Nomascus 
leucogenys]
 ref|XP_004091952.1| PREDICTED: proteasome subunit beta type-5 [Nomascus leucogenys]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|EPY20654.1| 20S proteasome subunit beta 5 [Strigomonas culicis]
 gb|EPY20907.1| 20S proteasome subunit beta 5 [Strigomonas culicis]
 gb|EPY25672.1| 20S proteasome subunit beta 5 [Strigomonas culicis]
Length=308

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            V K++EIN Y+LGTMAGGAADCQ W R LG++CRL EL N  RI+VA ASK+LANI YSY
Sbjct  135  VMKVLEINDYLLGTMAGGAADCQYWERVLGMECRLWELRNGSRITVAAASKILANITYSY  194

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            R  GLS+GTM+AG D+ GP LYYVD +G R+K + FSVGSGS YAYGVLD GYR DL+VE
Sbjct  195  RNHGLSMGTMVAGWDQFGPSLYYVDDKGSRVKQDLFSVGSGSIYAYGVLDAGYRKDLTVE  254

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  280
            EA +LARRSI+HAT+RDGASGG+ +VYHV P GW ++S D+  +L   Y+P
Sbjct  255  EACDLARRSIFHATYRDGASGGIVTVYHVHPKGWTQISRDNQTDLFARYFP  305



>gb|EFX80663.1| hypothetical protein DAPPUDRAFT_303852 [Daphnia pulex]
Length=276

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEIN ++LGTMAGGAADC  W R L  +CRL+EL NK RISVA ASKLL N++Y+Y
Sbjct  100  VKKIIEINDFLLGTMAGGAADCTYWERVLSKQCRLYELRNKERISVAAASKLLVNMVYNY  159

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+G MIAG D+KGPGLYYVD++G R  G  FSVGSGS YAYGVLD+GY+ DL+ E
Sbjct  160  KGMGLSMGVMIAGWDKKGPGLYYVDNDGTRTPGQVFSVGSGSLYAYGVLDSGYKPDLTDE  219

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAA  265
            EA EL RR+IYHAT+RD +SGG+  VYH+   GW K+S  D  ELHY Y   E  +
Sbjct  220  EAYELGRRAIYHATYRDASSGGIIRVYHIKSTGWVKISEQDCTELHYQYEEAERTS  275



>ref|NP_002788.1| proteasome subunit beta type-5 isoform 1 [Homo sapiens]
 ref|NP_001126063.1| proteasome subunit beta type-5 precursor [Pongo abelii]
 ref|XP_003808166.1| PREDICTED: proteasome subunit beta type-5 [Pan paniscus]
 sp|P28074.3|PSB5_HUMAN RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit MB1; AltName: Full=Proteasome subunit X; Flags: 
Precursor [Homo sapiens]
 sp|Q5R8S2.3|PSB5_PONAB RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Pongo abelii]
 emb|CAA64838.1| proteasome [Homo sapiens]
 gb|AAH57840.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 emb|CAH91838.1| hypothetical protein [Pongo abelii]
 gb|AAI07721.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|EAW66193.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 gb|EAW66195.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 dbj|BAG34836.1| unnamed protein product [Homo sapiens]
 dbj|BAI47149.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
 gb|ADQ33015.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>ref|XP_006175925.1| PREDICTED: proteasome subunit beta type-5 [Camelus ferus]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_003474544.1| PREDICTED: proteasome subunit beta type-5 [Cavia porcellus]
Length=263

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLQVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  EAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_001494538.2| PREDICTED: proteasome subunit beta type-5 isoform 1 [Equus caballus]
Length=263

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004054980.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004054981.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004054983.1| PREDICTED: proteasome subunit beta type-5 isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004054984.1| PREDICTED: proteasome subunit beta type-5 isoform 5 [Gorilla 
gorilla gorilla]
Length=263

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|ETE64662.1| Proteasome subunit beta type-5, partial [Ophiophagus hannah]
Length=290

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKKIIEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  69   VKKIIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  128

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY  DLSVE
Sbjct  129  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYGVMDRGYSHDLSVE  188

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  253
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW  +S +DV +L   +    A A E E
Sbjct  189  DAYDLARRAIYQATYRDAYSGGSVNLYHVRSDGWIHVSSNDVSDLRELFLDTSAKAKESE  248

Query  252  MTE  244
              E
Sbjct  249  RGE  251



>ref|NP_001247774.1| proteasome subunit beta type-5 [Macaca mulatta]
 ref|XP_003901626.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Papio anubis]
 gb|EHH27742.1| hypothetical protein EGK_18013 [Macaca mulatta]
 gb|EHH63472.1| hypothetical protein EGM_16445 [Macaca fascicularis]
Length=263

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>ref|XP_010744420.1| PREDICTED: proteasome subunit beta type-5 [Larimichthys crocea]
Length=273

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  99   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  158

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTM+ G D++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DLSVE
Sbjct  159  KGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGLRHDLSVE  218

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            EA EL RR+IY AT+RD  SGG  ++YHV   GW ++S +DV  LH+ Y
Sbjct  219  EACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRVSQEDVLMLHHQY  267



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -1

Query  792  VKKIIEINPYMLGTMAGGAADCQXWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  613
            VKK+IEINPY+LGTMAGGAADC  W R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  90   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  149

Query  612  RGMGLSVGTMIAGSDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  433
            +GMGLS+GTMI G D++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE
Sbjct  150  KGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE  209

Query  432  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  286
            +A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  210  QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385