BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006K21

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006363772.1|  PREDICTED: metal tolerance protein C2-like         305   2e-98   Solanum tuberosum [potatoes]
ref|XP_009765282.1|  PREDICTED: metal tolerance protein C2 isofor...    304   5e-98   Nicotiana sylvestris
ref|XP_009765283.1|  PREDICTED: metal tolerance protein C2 isofor...    304   5e-98   Nicotiana sylvestris
gb|AHZ08765.1|  metal tolerance protein C2                              304   5e-98   Nicotiana tabacum [American tobacco]
ref|XP_009618767.1|  PREDICTED: metal tolerance protein C2 isofor...    301   5e-97   Nicotiana tomentosiformis
ref|XP_009618769.1|  PREDICTED: metal tolerance protein C2 isofor...    301   6e-97   Nicotiana tomentosiformis
emb|CDP10150.1|  unnamed protein product                                300   3e-96   Coffea canephora [robusta coffee]
ref|XP_010317909.1|  PREDICTED: metal tolerance protein C2 isofor...    299   4e-96   Solanum lycopersicum
ref|XP_010520030.1|  PREDICTED: metal tolerance protein C2 isofor...    299   4e-96   
dbj|BAH20279.1|  AT3G12100                                              291   2e-95   Arabidopsis thaliana [mouse-ear cress]
gb|KDO70913.1|  hypothetical protein CISIN_1g023355mg                   293   2e-95   Citrus sinensis [apfelsine]
ref|XP_006429885.1|  hypothetical protein CICLE_v10011987mg             296   3e-95   Citrus clementina [clementine]
ref|XP_010317908.1|  PREDICTED: metal tolerance protein C2 isofor...    294   3e-94   Solanum lycopersicum
gb|AAG51048.1|AC069473_10  unknown protein; 24862-27391                 293   7e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006492851.1|  PREDICTED: metal tolerance protein C2-like         293   7e-94   Citrus sinensis [apfelsine]
ref|XP_010498516.1|  PREDICTED: metal tolerance protein C2-like         293   8e-94   Camelina sativa [gold-of-pleasure]
ref|NP_187817.2|  metal tolerance protein 5                             293   8e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486899.1|  PREDICTED: metal tolerance protein C2-like         293   9e-94   Camelina sativa [gold-of-pleasure]
emb|CDY08456.1|  BnaA05g26920D                                          293   1e-93   Brassica napus [oilseed rape]
gb|KFK38575.1|  hypothetical protein AALP_AA3G131200                    292   2e-93   Arabis alpina [alpine rockcress]
ref|XP_009146647.1|  PREDICTED: metal tolerance protein C2              292   2e-93   Brassica rapa
emb|CDY01101.1|  BnaC05g40990D                                          291   4e-93   
ref|XP_002884882.1|  hypothetical protein ARALYDRAFT_897419             291   4e-93   Arabidopsis lyrata subsp. lyrata
ref|XP_010464960.1|  PREDICTED: metal tolerance protein C2              291   4e-93   Camelina sativa [gold-of-pleasure]
gb|EYU39946.1|  hypothetical protein MIMGU_mgv1a007675mg                291   6e-93   Erythranthe guttata [common monkey flower]
ref|XP_011033203.1|  PREDICTED: metal tolerance protein C2              290   1e-92   Populus euphratica
ref|XP_006407371.1|  hypothetical protein EUTSA_v10020889mg             290   2e-92   Eutrema salsugineum [saltwater cress]
gb|KDP24631.1|  hypothetical protein JCGZ_25547                         288   6e-92   Jatropha curcas
ref|XP_004304358.1|  PREDICTED: metal tolerance protein C2              287   1e-91   Fragaria vesca subsp. vesca
ref|XP_002323276.2|  hypothetical protein POPTR_0016s04430g             287   1e-91   Populus trichocarpa [western balsam poplar]
ref|XP_002530715.1|  cation efflux protein/ zinc transporter, put...    285   2e-91   
ref|XP_008240924.1|  PREDICTED: metal tolerance protein C2              286   5e-91   Prunus mume [ume]
ref|XP_007202062.1|  hypothetical protein PRUPE_ppa006837mg             286   6e-91   Prunus persica
ref|XP_009369486.1|  PREDICTED: metal tolerance protein C2 isofor...    285   1e-90   Pyrus x bretschneideri [bai li]
ref|XP_008358007.1|  PREDICTED: metal tolerance protein C2-like         284   3e-90   
ref|XP_004136564.1|  PREDICTED: metal tolerance protein C2-like         283   6e-90   Cucumis sativus [cucumbers]
ref|XP_002279787.1|  PREDICTED: metal tolerance protein C2              283   7e-90   Vitis vinifera
ref|XP_008380144.1|  PREDICTED: metal tolerance protein C2              282   1e-89   
ref|XP_008443044.1|  PREDICTED: metal tolerance protein C2              282   2e-89   Cucumis melo [Oriental melon]
ref|XP_010257477.1|  PREDICTED: metal tolerance protein C2 isofor...    281   7e-89   Nelumbo nucifera [Indian lotus]
gb|KJB16338.1|  hypothetical protein B456_002G224200                    279   2e-88   Gossypium raimondii
ref|XP_010911305.1|  PREDICTED: metal tolerance protein C2-like         271   3e-88   
gb|KHG01363.1|  Metal tolerance C2 -like protein                        278   9e-88   Gossypium arboreum [tree cotton]
ref|XP_007029003.1|  Cation efflux family protein                       279   1e-87   
ref|XP_010672644.1|  PREDICTED: metal tolerance protein C2              278   1e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008804789.1|  PREDICTED: metal tolerance protein C2              276   1e-86   Phoenix dactylifera
ref|XP_010058124.1|  PREDICTED: metal tolerance protein C2              273   5e-86   Eucalyptus grandis [rose gum]
ref|XP_010935336.1|  PREDICTED: metal tolerance protein C2-like         274   9e-86   Elaeis guineensis
ref|XP_011075260.1|  PREDICTED: metal tolerance protein C2              272   1e-85   Sesamum indicum [beniseed]
ref|XP_009382749.1|  PREDICTED: metal tolerance protein C2              273   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES81486.2|  metal tolerance-like protein                            271   4e-85   Medicago truncatula
ref|XP_003625268.1|  Metal tolerance protein                            271   4e-85   
ref|XP_003554213.1|  PREDICTED: metal tolerance protein C2-like         269   1e-84   Glycine max [soybeans]
gb|KHN45432.1|  Metal tolerance protein C2                              268   1e-84   Glycine soja [wild soybean]
ref|XP_007134921.1|  hypothetical protein PHAVU_010G086900g             269   1e-84   Phaseolus vulgaris [French bean]
gb|AFW63866.1|  hypothetical protein ZEAMMB73_373134                    262   4e-84   
ref|XP_004493594.1|  PREDICTED: metal tolerance protein C2-like         267   7e-84   Cicer arietinum [garbanzo]
ref|XP_006855603.1|  hypothetical protein AMTR_s00044p00068470          268   2e-83   
ref|XP_003520537.1|  PREDICTED: metal tolerance protein C2-like i...    266   2e-83   Glycine max [soybeans]
gb|KHN07434.1|  Metal tolerance protein C2                              264   7e-83   Glycine soja [wild soybean]
gb|EEC74309.1|  hypothetical protein OsI_09578                          258   1e-82   Oryza sativa Indica Group [Indian rice]
gb|AFW63870.1|  hypothetical protein ZEAMMB73_373134                    263   1e-82   
ref|XP_006576856.1|  PREDICTED: metal tolerance protein C2-like i...    259   6e-81   Glycine max [soybeans]
ref|NP_001048630.1|  Os02g0832700                                       256   8e-81   
dbj|BAB01958.1|  unnamed protein product                                258   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004954537.1|  PREDICTED: metal tolerance protein C2-like         257   3e-80   Setaria italica
ref|XP_002453105.1|  hypothetical protein SORBIDRAFT_04g038530          257   4e-80   Sorghum bicolor [broomcorn]
dbj|BAK01144.1|  predicted protein                                      256   1e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009369493.1|  PREDICTED: metal tolerance protein C2 isofor...    253   3e-78   Pyrus x bretschneideri [bai li]
ref|XP_008365630.1|  PREDICTED: LOW QUALITY PROTEIN: metal tolera...    253   7e-78   
ref|XP_006649212.1|  PREDICTED: metal tolerance protein C2-like         248   1e-76   Oryza brachyantha
gb|EPS69961.1|  hypothetical protein M569_04795                         248   1e-76   Genlisea aurea
ref|XP_003570736.1|  PREDICTED: metal tolerance protein C2              247   3e-76   Brachypodium distachyon [annual false brome]
gb|EEE58117.1|  hypothetical protein OsJ_09007                          224   3e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002982633.1|  hypothetical protein SELMODRAFT_116499             221   7e-67   
ref|XP_002981150.1|  hypothetical protein SELMODRAFT_114043             219   3e-66   
gb|EMT33211.1|  Metal tolerance protein C2                              218   3e-65   
ref|NP_001030676.1|  metal tolerance protein 5                          206   7e-61   
ref|XP_010111363.1|  Metal tolerance protein C2                         208   6e-59   
ref|XP_001755969.1|  predicted protein                                  181   2e-51   
gb|AFW63865.1|  hypothetical protein ZEAMMB73_373134                    169   6e-49   
ref|XP_010257479.1|  PREDICTED: metal tolerance protein C2 isofor...    122   5e-29   Nelumbo nucifera [Indian lotus]
dbj|BAD23018.1|  cation efflux family protein-like                    94.4    9e-21   Oryza sativa Japonica Group [Japonica rice]
gb|ABV89623.1|  cation efflux family protein                          95.9    1e-19   Brassica rapa
gb|KJB16337.1|  hypothetical protein B456_002G224200                  95.5    1e-19   Gossypium raimondii
ref|XP_006298286.1|  hypothetical protein CARUB_v10014351mg           94.0    4e-19   
gb|AFN53638.1|  hypothetical protein                                  92.0    2e-17   Linum usitatissimum
dbj|GAM26117.1|  hypothetical protein SAMD00019534_092920             79.0    2e-13   Acytostelium subglobosum LB1
ref|XP_002110512.1|  hypothetical protein TRIADDRAFT_22061            78.2    6e-13   Trichoplax adhaerens
ref|XP_784123.2|  PREDICTED: zinc transporter 5-like                  77.0    1e-12   Strongylocentrotus purpuratus [purple urchin]
gb|KFM59856.1|  Zinc transporter 7                                    75.1    3e-12   Stegodyphus mimosarum
ref|XP_001626717.1|  predicted protein                                75.5    4e-12   Nematostella vectensis
ref|XP_004989502.1|  zinc transporter 7                               73.6    9e-12   Salpingoeca rosetta
ref|XP_004637059.1|  PREDICTED: zinc transporter 7                    73.2    9e-12   Octodon degus
ref|XP_005141522.1|  PREDICTED: zinc transporter 7 isoform X2         73.2    1e-11   Melopsittacus undulatus
ref|XP_005141521.1|  PREDICTED: zinc transporter 7 isoform X1         73.2    1e-11   Melopsittacus undulatus
ref|NP_001084857.1|  zinc transporter 7-B                             73.2    2e-11   Xenopus laevis [clawed frog]
ref|NP_989256.1|  zinc transporter 7                                  73.2    2e-11   Xenopus tropicalis [western clawed frog]
gb|AFK10820.1|  solute carrier family 30 (zinc transporter), memb...  72.8    2e-11   Callorhinchus milii [Australian ghost shark]
ref|NP_001279436.1|  solute carrier family 30 (zinc transporter),...  72.8    2e-11   Callorhinchus milii [Australian ghost shark]
ref|XP_002427650.1|  Metal tolerance protein C2, putative             72.0    2e-11   Pediculus humanus corporis [human body lice]
ref|XP_008404702.1|  PREDICTED: zinc transporter 7                    70.5    2e-11   Poecilia reticulata
gb|KFQ80471.1|  Zinc transporter 7                                    72.0    3e-11   Phaethon lepturus
ref|XP_010114188.1|  PREDICTED: zinc transporter 7                    72.0    3e-11   Chlamydotis macqueenii
ref|XP_010290960.1|  PREDICTED: zinc transporter 7                    72.0    3e-11   Phaethon lepturus
ref|NP_001089424.1|  zinc transporter 7-A                             72.4    3e-11   Xenopus laevis [clawed frog]
ref|XP_009014302.1|  hypothetical protein HELRODRAFT_98434            72.8    4e-11   Helobdella robusta
ref|XP_011472633.1|  PREDICTED: zinc transporter 7 isoform X2         71.2    4e-11   Oryzias latipes [Japanese rice fish]
ref|XP_001742863.1|  hypothetical protein                             71.6    5e-11   Monosiga brevicollis MX1
ref|XP_004068210.1|  PREDICTED: zinc transporter 7 isoform X1         71.6    6e-11   Oryzias latipes [Japanese rice fish]
ref|XP_006882512.1|  PREDICTED: zinc transporter 7                    71.2    6e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005388862.1|  PREDICTED: zinc transporter 7                    71.2    8e-11   Chinchilla lanigera
ref|XP_007420311.1|  PREDICTED: zinc transporter 7 isoform X2         70.5    8e-11   
gb|KFV86877.1|  Zinc transporter 7                                    70.5    9e-11   Struthio camelus australis
ref|XP_009684314.1|  PREDICTED: zinc transporter 7                    70.5    9e-11   Struthio camelus australis
ref|XP_004227102.1|  PREDICTED: zinc transporter 7-like isoform X2    70.5    1e-10   
ref|XP_009580287.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   Fulmarus glacialis
ref|XP_005018821.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   
ref|XP_007062683.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   
ref|XP_008168825.1|  PREDICTED: zinc transporter 7 isoform X3         70.1    1e-10   Chrysemys picta bellii
ref|XP_009910536.1|  PREDICTED: zinc transporter 7                    70.1    1e-10   Haliaeetus albicilla
ref|XP_005237356.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  70.1    1e-10   
ref|XP_003747158.1|  PREDICTED: zinc transporter 7-like               70.5    1e-10   
ref|XP_010561929.1|  PREDICTED: zinc transporter 7 isoform X1         70.5    1e-10   Haliaeetus leucocephalus
ref|XP_005434213.1|  PREDICTED: zinc transporter 7                    70.1    1e-10   
ref|XP_007420310.1|  PREDICTED: zinc transporter 7 isoform X1         70.5    1e-10   Python bivittatus
ref|XP_005520996.1|  PREDICTED: zinc transporter 7 isoform X2         70.5    1e-10   
ref|XP_004420827.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007115222.1|  PREDICTED: zinc transporter 7 isoform X2         69.7    1e-10   
ref|XP_010163743.1|  PREDICTED: zinc transporter 7                    70.1    1e-10   Antrostomus carolinensis
ref|XP_006977880.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   Peromyscus maniculatus bairdii
ref|XP_002130805.1|  PREDICTED: zinc transporter 7-like isoform X1    70.5    1e-10   
ref|XP_003512838.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_009466567.1|  PREDICTED: zinc transporter 7                    70.1    1e-10   Nipponia nippon
ref|XP_009990197.1|  PREDICTED: zinc transporter 7                    70.1    1e-10   Tauraco erythrolophus
sp|Q8H329.2|MTP8_ORYSJ  RecName: Full=Metal tolerance protein 8; ...  69.7    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001488387.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   Equus caballus [domestic horse]
ref|XP_005520995.1|  PREDICTED: zinc transporter 7 isoform X1         70.5    1e-10   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_001381878.1|  PREDICTED: zinc transporter 7                    70.5    1e-10   Monodelphis domestica
ref|XP_005422162.1|  PREDICTED: zinc transporter 7                    69.7    1e-10   
ref|XP_009936299.1|  PREDICTED: zinc transporter 7                    70.1    1e-10   Opisthocomus hoazin [hoatzin]
ref|XP_007115221.1|  PREDICTED: zinc transporter 7 isoform X1         70.1    1e-10   
ref|XP_009563777.1|  PREDICTED: zinc transporter 7                    70.1    1e-10   Cuculus canorus
ref|XP_009697376.1|  PREDICTED: zinc transporter 7                    70.1    2e-10   Cariama cristata
ref|XP_009903666.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  70.1    2e-10   Picoides pubescens
ref|XP_005300950.1|  PREDICTED: zinc transporter 7 isoform X2         70.1    2e-10   Chrysemys picta bellii
ref|XP_005482090.1|  PREDICTED: zinc transporter 7 isoform X4         70.1    2e-10   
ref|NP_075703.1|  zinc transporter 7                                  70.1    2e-10   Mus musculus [mouse]
gb|KFW79594.1|  Zinc transporter 7                                    69.7    2e-10   Manacus vitellinus
gb|KFW02735.1|  Zinc transporter 7                                    69.7    2e-10   Eurypyga helias
ref|XP_010407798.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   
ref|XP_006762999.1|  PREDICTED: zinc transporter 7 isoform X2         70.1    2e-10   Myotis davidii
ref|XP_008263034.1|  PREDICTED: zinc transporter 7                    70.1    2e-10   Oryctolagus cuniculus [domestic rabbit]
gb|KFO56526.1|  Zinc transporter 7                                    69.7    2e-10   Corvus brachyrhynchos
ref|XP_005808439.1|  PREDICTED: zinc transporter 7-like               70.1    2e-10   Xiphophorus maculatus
ref|XP_006165035.1|  PREDICTED: zinc transporter 7                    70.1    2e-10   Tupaia chinensis
ref|XP_006762998.1|  PREDICTED: zinc transporter 7 isoform X1         70.1    2e-10   Myotis davidii
ref|XP_008695869.1|  PREDICTED: zinc transporter 7                    70.1    2e-10   Ursus maritimus [white bear]
gb|KFQ05347.1|  Zinc transporter 7                                    69.7    2e-10   Leptosomus discolor
ref|XP_009965043.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Tyto alba [Schleiereule]
ref|XP_010298478.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Balearica regulorum gibbericeps
ref|XP_004176257.1|  PREDICTED: zinc transporter 7                    69.3    2e-10   
ref|XP_007169579.1|  PREDICTED: zinc transporter 7 isoform X1         70.1    2e-10   Balaenoptera acutorostrata scammoni
ref|XP_002928201.1|  PREDICTED: zinc transporter 7 isoform X2         70.1    2e-10   Ailuropoda melanoleuca
ref|XP_010147218.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Eurypyga helias
ref|XP_005482089.1|  PREDICTED: zinc transporter 7 isoform X3         70.1    2e-10   
ref|XP_010141892.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Buceros rhinoceros silvestris
gb|KFV50673.1|  Zinc transporter 7                                    69.7    2e-10   Tyto alba [Schleiereule]
ref|XP_008920519.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   
ref|XP_006119869.1|  PREDICTED: zinc transporter 7 isoform X1         70.1    2e-10   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007569501.1|  PREDICTED: zinc transporter 7                    70.1    2e-10   Poecilia formosa
ref|XP_010074039.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Pterocles gutturalis
ref|XP_003784157.1|  PREDICTED: zinc transporter 7                    70.1    2e-10   Otolemur garnettii
ref|NP_001061826.1|  Os08g0422200                                     68.2    2e-10   
ref|XP_009807088.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Gavia stellata
ref|XP_002187573.1|  PREDICTED: zinc transporter 7 isoform 2          69.7    2e-10   Taeniopygia guttata
ref|XP_010561930.1|  PREDICTED: zinc transporter 7 isoform X2         69.7    2e-10   Haliaeetus leucocephalus
ref|XP_005482087.1|  PREDICTED: zinc transporter 7 isoform X1         69.7    2e-10   Zonotrichia albicollis
gb|KFP86270.1|  Zinc transporter 7                                    69.7    2e-10   Apaloderma vittatum
gb|AAH50193.1|  Solute carrier family 30 (zinc transporter), memb...  69.7    2e-10   Mus musculus [mouse]
ref|NP_001008788.1|  zinc transporter 7                               69.7    2e-10   Gallus gallus [bantam]
ref|XP_004263136.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Orcinus orca [Orca]
ref|XP_009865024.1|  PREDICTED: zinc transporter 7                    69.3    2e-10   Apaloderma vittatum
ref|XP_008941274.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Merops nubicus
gb|KGL76611.1|  Zinc transporter 7                                    69.3    2e-10   Tinamus guttatus
ref|XP_003479224.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  69.7    2e-10   Cavia porcellus [guinea pig]
ref|XP_009960056.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   Leptosomus discolor
ref|XP_008628696.1|  PREDICTED: zinc transporter 7                    69.7    2e-10   
ref|XP_008283577.1|  PREDICTED: zinc transporter 7 isoform X2         69.3    2e-10   Stegastes partitus
ref|XP_005339748.1|  PREDICTED: zinc transporter 7                    69.7    3e-10   Ictidomys tridecemlineatus
dbj|BAP46877.1|  solute carrier family 30 member 7-1                  69.7    3e-10   Cyprinus carpio [carp]
ref|XP_009883216.1|  PREDICTED: zinc transporter 7                    69.7    3e-10   Charadrius vociferus
ref|XP_008283576.1|  PREDICTED: zinc transporter 7 isoform X1         69.7    3e-10   Stegastes partitus
ref|XP_007934300.1|  PREDICTED: zinc transporter 7                    69.3    3e-10   Orycteropus afer afer
ref|XP_005878599.1|  PREDICTED: zinc transporter 7 isoform X2         69.3    3e-10   
ref|XP_004883474.1|  PREDICTED: zinc transporter 7                    69.3    3e-10   
ref|NP_001093556.1|  zinc transporter 7                               69.3    3e-10   Danio rerio [leopard danio]
ref|XP_009500259.1|  PREDICTED: zinc transporter 7                    69.3    3e-10   Phalacrocorax carbo [common cormorant]
gb|AAI54235.1|  Solute carrier family 30 (zinc transporter), memb...  69.3    3e-10   Danio rerio [leopard danio]
gb|AAH44151.1|  Solute carrier family 30 (zinc transporter), memb...  69.3    3e-10   Danio rerio [leopard danio]
ref|XP_006191009.1|  PREDICTED: zinc transporter 7                    69.3    3e-10   Camelus ferus
ref|XP_007449681.1|  PREDICTED: zinc transporter 7                    69.3    3e-10   Lipotes vexillifer [baiji]
gb|ENN78166.1|  hypothetical protein YQE_05319                        68.9    3e-10   Dendroctonus ponderosae
ref|XP_005878598.1|  PREDICTED: zinc transporter 7 isoform X1         69.3    3e-10   Myotis brandtii
ref|XP_004775230.1|  PREDICTED: zinc transporter 7                    69.3    3e-10   Mustela putorius furo [black ferret]
ref|XP_005482088.1|  PREDICTED: zinc transporter 7 isoform X2         68.9    4e-10   Zonotrichia albicollis
ref|XP_008049279.1|  PREDICTED: zinc transporter 7                    69.3    4e-10   Carlito syrichta
ref|XP_005678094.1|  PREDICTED: zinc transporter 7                    69.3    4e-10   Capra hircus [domestic goat]
ref|XP_006015046.1|  PREDICTED: zinc transporter 7                    68.9    4e-10   
ref|XP_011454602.1|  PREDICTED: zinc transporter 7-like               68.2    4e-10   
ref|XP_006103697.1|  PREDICTED: zinc transporter 7 isoform X2         68.9    4e-10   
ref|XP_004699282.1|  PREDICTED: zinc transporter 7                    68.9    4e-10   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_006273785.1|  PREDICTED: zinc transporter 7                    68.9    4e-10   Alligator mississippiensis
ref|XP_001375558.1|  PREDICTED: zinc transporter 10                   69.3    4e-10   Monodelphis domestica
ref|XP_010212032.1|  PREDICTED: zinc transporter 7                    68.9    4e-10   Tinamus guttatus
ref|XP_005978831.1|  PREDICTED: zinc transporter 7                    68.9    4e-10   Pantholops hodgsonii [Tibetan antelope]
ref|XP_009645830.1|  PREDICTED: zinc transporter 7                    68.9    4e-10   Egretta garzetta
ref|XP_010829271.1|  PREDICTED: zinc transporter 7                    68.9    5e-10   Bison bison bison
ref|NP_001077229.1|  zinc transporter 7                               68.9    5e-10   Bos taurus [bovine]
ref|XP_006103696.1|  PREDICTED: zinc transporter 7 isoform X1         68.9    5e-10   Myotis lucifugus
ref|XP_004401522.1|  PREDICTED: zinc transporter 7                    68.9    5e-10   Odobenus rosmarus divergens
ref|XP_009057902.1|  hypothetical protein LOTGIDRAFT_209561           68.6    5e-10   Lottia gigantea
ref|XP_007093685.1|  PREDICTED: zinc transporter 7                    68.9    5e-10   Panthera tigris altaica
ref|NP_001157070.1|  zinc transporter 7                               68.9    5e-10   Ovis aries [domestic sheep]
ref|XP_005498830.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  68.6    5e-10   
ref|XP_003990418.1|  PREDICTED: zinc transporter 7                    68.6    5e-10   Felis catus [cat]
ref|XP_001647887.1|  AAEL000077-PA                                    68.6    5e-10   Aedes aegypti
ref|XP_006919630.1|  PREDICTED: zinc transporter 7                    68.6    5e-10   Pteropus alecto
ref|XP_009281503.1|  PREDICTED: zinc transporter 7                    68.6    5e-10   
ref|XP_004354504.1|  putative zinc transporter                        68.9    5e-10   Cavenderia fasciculata
ref|XP_537050.3|  PREDICTED: zinc transporter 7                       68.6    6e-10   Canis lupus familiaris [dogs]
ref|XP_004385784.1|  PREDICTED: zinc transporter 7                    68.6    6e-10   Trichechus manatus latirostris
ref|XP_006643139.1|  PREDICTED: zinc transporter 7-like isoform X2    68.6    6e-10   
ref|XP_004582061.1|  PREDICTED: zinc transporter 7                    68.6    6e-10   Ochotona princeps [southern American pika]
ref|XP_007240170.1|  PREDICTED: zinc transporter 7                    68.6    6e-10   Astyanax mexicanus [blind cave fish]
gb|AAH91417.1|  Slc30a7 protein                                       66.6    6e-10   Rattus norvegicus [brown rat]
ref|XP_006643138.1|  PREDICTED: zinc transporter 7-like isoform X1    68.6    6e-10   Lepisosteus oculatus
ref|XP_003220036.1|  PREDICTED: zinc transporter 7                    68.2    7e-10   Anolis carolinensis [Carolina anole]
ref|XP_009087094.1|  PREDICTED: zinc transporter 7                    68.6    7e-10   
ref|XP_009424677.1|  PREDICTED: zinc transporter 7 isoform X2         67.8    8e-10   
ref|XP_004258151.1|  metal tolerance protein C2, putative             68.6    8e-10   Entamoeba invadens IP1
ref|XP_001136030.1|  PREDICTED: zinc transporter 7 isoform X1         68.2    8e-10   Pan troglodytes
ref|XP_003808530.1|  PREDICTED: zinc transporter 7                    68.2    9e-10   Pan paniscus [bonobo]
gb|EAZ42775.1|  hypothetical protein OsJ_27355                        68.6    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006830971.1|  PREDICTED: zinc transporter 7                    67.8    9e-10   Chrysochloris asiatica
ref|XP_005050600.1|  PREDICTED: zinc transporter 7                    68.2    9e-10   Ficedula albicollis
ref|XP_009245480.1|  PREDICTED: zinc transporter 7 isoform X1         67.8    1e-09   
ref|XP_007975991.1|  PREDICTED: zinc transporter 7                    67.8    1e-09   Chlorocebus sabaeus
ref|XP_002138677.2|  GA24914                                          68.2    1e-09   
dbj|BAC24961.1|  putative zinc transporter                            68.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009332129.1|  PREDICTED: zinc transporter 7                    68.2    1e-09   Pygoscelis adeliae
ref|NP_001253113.1|  zinc transporter 7                               67.8    1e-09   Macaca mulatta [rhesus macaque]
ref|XP_010005082.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  67.4    1e-09   Chaetura pelagica
ref|XP_005300948.1|  PREDICTED: zinc transporter 7 isoform X1         67.8    1e-09   
ref|NP_001178644.1|  zinc transporter 7                               67.8    1e-09   Rattus norvegicus [brown rat]
ref|XP_001864750.1|  cation efflux protein/ zinc transporter          67.8    1e-09   Culex quinquefasciatus
ref|XP_002751179.1|  PREDICTED: zinc transporter 7                    67.8    1e-09   Callithrix jacchus [common marmoset]
ref|XP_002435303.1|  Zn2+ transporter, putative                       67.8    1e-09   Ixodes scapularis [blacklegged tick]
ref|XP_003977527.1|  PREDICTED: zinc transporter 7-like isoform 1     67.4    1e-09   
ref|XP_008489111.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  67.4    1e-09   Calypte anna
ref|XP_003977528.1|  PREDICTED: zinc transporter 7-like isoform 2     67.4    1e-09   
ref|XP_002027101.1|  GL20059                                          67.4    2e-09   Drosophila persimilis
ref|XP_003977529.1|  PREDICTED: zinc transporter 7-like isoform 3     67.0    2e-09   
ref|XP_003933299.1|  PREDICTED: zinc transporter 7                    67.4    2e-09   Saimiri boliviensis boliviensis
emb|CAF92863.1|  unnamed protein product                              67.4    2e-09   Tetraodon nigroviridis
ref|XP_009009836.1|  hypothetical protein HELRODRAFT_62861            67.0    2e-09   Helobdella robusta
ref|XP_005655517.1|  PREDICTED: zinc transporter 7 isoform X1         66.6    2e-09   
ref|XP_010734147.1|  PREDICTED: zinc transporter 5                    67.4    2e-09   
ref|XP_010587814.1|  PREDICTED: zinc transporter 7 isoform X2         66.6    2e-09   
emb|CDQ64996.1|  unnamed protein product                              67.0    2e-09   Oncorhynchus mykiss
gb|ACI33740.1|  Zinc transporter 7                                    67.0    2e-09   Salmo salar
ref|XP_006728237.1|  PREDICTED: zinc transporter 7                    67.0    2e-09   Leptonychotes weddellii
ref|NP_598003.2|  zinc transporter 7                                  67.0    2e-09   Homo sapiens [man]
ref|XP_005357231.1|  PREDICTED: zinc transporter 7                    67.0    2e-09   Microtus ochrogaster [prairie voles]
ref|XP_008550396.1|  PREDICTED: zinc transporter 7                    67.0    2e-09   Microplitis demolitor
ref|XP_004689787.1|  PREDICTED: zinc transporter 7                    67.0    2e-09   Condylura cristata
ref|XP_010587813.1|  PREDICTED: zinc transporter 7 isoform X1         66.6    2e-09   
ref|XP_010750679.1|  PREDICTED: zinc transporter 7                    67.0    2e-09   
ref|NP_001129683.1|  zinc transporter 7                               66.6    2e-09   Sus scrofa [pigs]
ref|XP_010235134.1|  PREDICTED: uncharacterized protein LOC100826248  67.0    3e-09   
ref|XP_007528655.1|  PREDICTED: zinc transporter 7                    66.6    3e-09   
ref|XP_010876176.1|  PREDICTED: zinc transporter 5                    66.6    3e-09   
ref|XP_008581823.1|  PREDICTED: zinc transporter 7                    65.9    4e-09   
ref|XP_006009979.1|  PREDICTED: zinc transporter 7 isoform X3         66.2    4e-09   
ref|XP_003288444.1|  hypothetical protein DICPUDRAFT_92100            66.6    4e-09   
ref|XP_004471732.1|  PREDICTED: zinc transporter 7 isoform 5          65.9    4e-09   
ref|XP_004471728.1|  PREDICTED: zinc transporter 7 isoform 1          66.2    4e-09   
ref|XP_006009978.1|  PREDICTED: zinc transporter 7 isoform X2         65.9    4e-09   
gb|EFA81667.1|  putative zinc transporter                             66.2    5e-09   
gb|KDR14532.1|  Zinc transporter 5                                    65.9    5e-09   
ref|XP_005090105.1|  PREDICTED: zinc transporter 7-like               65.9    5e-09   
ref|XP_002609814.1|  hypothetical protein BRAFLDRAFT_219401           66.2    5e-09   
gb|ACI34190.1|  Zinc transporter 7                                    65.5    5e-09   
ref|XP_004659137.1|  PREDICTED: zinc transporter 7                    65.5    6e-09   
gb|AAL83716.1|AF233345_1  zinc transporter-like 2 protein             65.5    6e-09   
emb|CDQ69632.1|  unnamed protein product                              65.5    6e-09   
ref|XP_001785519.1|  predicted protein                                65.5    6e-09   
ref|XP_006009977.1|  PREDICTED: zinc transporter 7 isoform X1         65.5    6e-09   
ref|XP_004075128.1|  PREDICTED: zinc transporter 5                    65.9    6e-09   
ref|XP_004342658.1|  zinc transporter 5                               65.9    7e-09   
ref|XP_008423024.1|  PREDICTED: zinc transporter 5                    65.9    7e-09   
ref|XP_005095708.1|  PREDICTED: zinc transporter 5-like isoform X1    65.5    8e-09   
ref|XP_004927216.1|  PREDICTED: zinc transporter 7-like               65.1    8e-09   
ref|XP_655380.2|  cation transporter                                  65.1    9e-09   
ref|XP_003284571.1|  hypothetical protein DICPUDRAFT_45603            65.5    1e-08   
ref|XP_008841033.1|  PREDICTED: zinc transporter 7                    65.1    1e-08   
ref|XP_008335441.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  65.1    1e-08   
dbj|BAM64839.1|  hypothetical protein                                 65.5    1e-08   
ref|XP_011462441.1|  PREDICTED: probable zinc transporter protein...  65.5    1e-08   
ref|XP_004271073.1|  PREDICTED: zinc transporter 10                   65.1    1e-08   
ref|XP_003357675.1|  PREDICTED: zinc transporter 10                   64.7    1e-08   
ref|XP_005811705.1|  PREDICTED: zinc transporter 5-like               65.1    1e-08   
emb|CBI34990.3|  unnamed protein product                              65.1    1e-08   
gb|KFB35977.1|  hypothetical protein ZHAS_00002961                    64.7    1e-08   
ref|XP_008274607.1|  PREDICTED: zinc transporter 5                    65.1    1e-08   
ref|XP_002127955.1|  PREDICTED: zinc transporter 5-like               64.7    1e-08   
ref|XP_313758.4|  AGAP004461-PA                                       64.3    2e-08   
gb|ELR49193.1|  Zinc transporter 10                                   64.3    2e-08   
ref|XP_005470499.1|  PREDICTED: zinc transporter 5-like isoform X2    64.7    2e-08   
ref|XP_005640991.1|  PREDICTED: zinc transporter 10                   64.3    2e-08   
ref|XP_003440125.1|  PREDICTED: zinc transporter 5-like isoform X1    64.7    2e-08   
ref|XP_005905628.1|  PREDICTED: zinc transporter 10                   64.3    2e-08   
ref|XP_008216366.1|  PREDICTED: zinc transporter 7                    63.9    2e-08   
ref|XP_007172137.1|  PREDICTED: zinc transporter 10                   64.3    2e-08   
ref|XP_008124065.1|  PREDICTED: zinc transporter 10                   64.3    2e-08   
ref|XP_010671192.1|  PREDICTED: uncharacterized protein LOC104888058  64.3    2e-08   
ref|NP_001002322.1|  zinc transporter 5                               64.3    2e-08   
gb|ELT96504.1|  hypothetical protein CAPTEDRAFT_20619                 64.3    2e-08   
gb|AAH96996.1|  Solute carrier family 30 (zinc transporter), memb...  64.3    2e-08   
ref|XP_006803538.1|  PREDICTED: zinc transporter 5-like               64.3    2e-08   
ref|XP_010660980.1|  PREDICTED: zinc transporter 5                    64.3    2e-08   
ref|XP_005181400.1|  PREDICTED: zinc transporter 7                    63.9    2e-08   
gb|ETN60040.1|  cation efflux protein/ zinc transporter               63.9    2e-08   
ref|XP_004014030.1|  PREDICTED: zinc transporter 10                   63.9    2e-08   
ref|XP_004670176.1|  PREDICTED: zinc transporter 10                   63.9    2e-08   
ref|XP_004538528.1|  PREDICTED: zinc transporter 5-like               64.3    2e-08   
ref|XP_005725623.1|  PREDICTED: zinc transporter 5-like               64.3    2e-08   
ref|XP_005921775.1|  PREDICTED: zinc transporter 5-like               64.3    2e-08   
ref|XP_002073209.1|  GK13273                                          63.5    3e-08   
ref|XP_645883.1|  hypothetical protein DDB_G0269332                   63.9    3e-08   
gb|ELU06402.1|  hypothetical protein CAPTEDRAFT_112400                63.5    3e-08   
ref|XP_004520782.1|  PREDICTED: probable zinc transporter protein...  63.9    3e-08   
ref|XP_010851572.1|  PREDICTED: zinc transporter 10                   63.5    3e-08   
ref|NP_001179109.1|  zinc transporter 10                              63.5    3e-08   
ref|XP_002138041.1|  GA26171                                          63.5    3e-08   
ref|XP_005734323.1|  PREDICTED: zinc transporter 7-like isoform X4    63.5    3e-08   
ref|XP_004518505.1|  PREDICTED: zinc transporter 7-like isoform X1    63.2    3e-08   
ref|XP_002019752.1|  GL12040                                          63.2    3e-08   
ref|XP_005734321.1|  PREDICTED: zinc transporter 7-like isoform X2    63.2    3e-08   
ref|XP_005948478.1|  PREDICTED: zinc transporter 7-like isoform X1    63.2    4e-08   
ref|XP_005981375.1|  PREDICTED: zinc transporter 10                   63.5    4e-08   
ref|XP_007575903.1|  PREDICTED: zinc transporter 5                    63.5    4e-08   
ref|XP_005734320.1|  PREDICTED: zinc transporter 7-like isoform X1    63.2    4e-08   
ref|XP_010218653.1|  PREDICTED: zinc transporter 5                    63.5    4e-08   
gb|EYU44685.1|  hypothetical protein MIMGU_mgv1a001493mg              63.5    4e-08   
ref|XP_004569382.1|  PREDICTED: zinc transporter 7-like isoform X1    63.2    4e-08   
ref|XP_006056009.1|  PREDICTED: zinc transporter 10                   63.2    4e-08   
ref|XP_006972127.1|  PREDICTED: zinc transporter 10                   63.2    4e-08   
gb|EDL13064.1|  mCG12390, isoform CRA_a                               63.2    5e-08   
ref|NP_001028458.1|  zinc transporter 10                              63.2    5e-08   
ref|XP_008664678.1|  PREDICTED: uncharacterized protein LOC103643305  63.2    5e-08   
ref|XP_006198966.1|  PREDICTED: zinc transporter 10                   63.2    5e-08   
gb|EFX89240.1|  hypothetical protein DAPPUDRAFT_190490                62.8    5e-08   
ref|XP_003216392.1|  PREDICTED: zinc transporter 5                    63.2    5e-08   
ref|XP_005948479.1|  PREDICTED: zinc transporter 7-like isoform X2    62.8    5e-08   
ref|XP_008266636.1|  PREDICTED: zinc transporter 10                   62.8    5e-08   
ref|XP_007032328.1|  Cation efflux family protein                     63.2    6e-08   
gb|EQB78583.1|  solute carrier family 30, member 10                   62.8    6e-08   
ref|XP_006010327.1|  PREDICTED: zinc transporter 5                    63.2    6e-08   
ref|XP_010972377.1|  PREDICTED: zinc transporter 10                   62.8    6e-08   
ref|XP_005734324.1|  PREDICTED: zinc transporter 7-like isoform X5    62.4    6e-08   
dbj|BAP46874.1|  solute carrier family 30 member 5-1                  62.8    6e-08   
ref|XP_004569383.1|  PREDICTED: zinc transporter 7-like isoform X2    62.4    6e-08   
ref|XP_006188251.1|  PREDICTED: zinc transporter 10                   62.8    6e-08   
ref|XP_010009724.1|  PREDICTED: zinc transporter 7                    62.4    6e-08   
ref|XP_001980596.1|  GG17239                                          62.4    6e-08   
ref|XP_010723802.1|  PREDICTED: zinc transporter 5                    62.8    6e-08   
ref|XP_002097178.1|  GE24639                                          62.4    6e-08   
ref|XP_010991629.1|  PREDICTED: zinc transporter 10                   62.8    6e-08   
ref|XP_002031660.1|  GM26118                                          62.4    7e-08   
ref|XP_009076890.1|  PREDICTED: zinc transporter 5-like               61.6    7e-08   
ref|XP_002103900.1|  GD20678                                          62.4    7e-08   
ref|NP_650049.1|  zinc transporter 86D                                62.4    7e-08   
ref|XP_003965154.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  62.8    7e-08   
ref|XP_005475712.1|  PREDICTED: zinc transporter 7-like               62.4    7e-08   
ref|XP_007935116.1|  PREDICTED: zinc transporter 10                   62.4    7e-08   
ref|XP_005009974.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  62.8    8e-08   
ref|XP_002402576.1|  Zn2+ transporter, putative                       62.4    8e-08   
ref|XP_001741484.1|  metal tolerance protein C2                       62.0    8e-08   
gb|KDR85068.1|  hypothetical protein GALMADRAFT_233675                62.4    8e-08   
ref|NP_001026590.2|  zinc transporter 5                               62.4    8e-08   
ref|XP_004608599.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  62.4    9e-08   
ref|XP_010637386.1|  PREDICTED: zinc transporter 7                    62.0    9e-08   
gb|EPQ15336.1|  Zinc transporter 7                                    62.4    9e-08   
ref|XP_008858407.1|  cation transporter, putative                     62.4    9e-08   
ref|XP_007636785.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  62.4    9e-08   
gb|ETE69804.1|  Zinc transporter 5                                    62.4    9e-08   
gb|KGL87432.1|  Zinc transporter 10                                   62.0    1e-07   
ref|XP_002445505.1|  hypothetical protein SORBIDRAFT_07g020630        62.4    1e-07   
ref|XP_007422338.1|  PREDICTED: zinc transporter 5                    62.4    1e-07   
gb|KFU87451.1|  Zinc transporter 10                                   62.0    1e-07   
ref|XP_011193440.1|  PREDICTED: zinc transporter 7                    61.6    1e-07   
ref|XP_003785931.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
gb|KFO79553.1|  Zinc transporter 7                                    61.6    1e-07   
ref|XP_001954427.1|  GF18257                                          61.6    1e-07   
ref|XP_002600575.1|  hypothetical protein BRAFLDRAFT_276675           61.6    1e-07   
ref|XP_003495020.1|  PREDICTED: zinc transporter 10 isoform X1        62.0    1e-07   
ref|XP_009686919.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
gb|EHH50531.1|  hypothetical protein EGM_01379                        62.0    1e-07   
ref|XP_001990402.1|  GH19326                                          61.6    1e-07   
ref|XP_010561931.1|  PREDICTED: zinc transporter 7 isoform X3         61.6    1e-07   
gb|ERE73008.1|  zinc transporter 10                                   61.6    1e-07   
ref|XP_002056320.1|  GJ10296                                          61.6    1e-07   
ref|XP_003419918.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  61.6    1e-07   
gb|KFV88337.1|  Zinc transporter 5                                    62.0    1e-07   
ref|XP_011500943.1|  PREDICTED: zinc transporter 7                    61.6    1e-07   
ref|XP_008825024.1|  PREDICTED: zinc transporter 10                   61.6    1e-07   
ref|XP_006021504.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
gb|KFR13449.1|  Zinc transporter 7                                    61.2    1e-07   
ref|XP_009989083.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
ref|XP_007059072.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
gb|KFV03371.1|  Zinc transporter 5                                    62.0    1e-07   
gb|KFZ50173.1|  Zinc transporter 7                                    61.2    1e-07   
gb|KFP98918.1|  Zinc transporter 7                                    61.2    1e-07   
gb|EMP36535.1|  Zinc transporter 5                                    62.0    1e-07   
gb|KFQ99569.1|  Zinc transporter 5                                    62.0    1e-07   
gb|KFO05022.1|  Zinc transporter 10                                   60.5    1e-07   
gb|KJB11433.1|  hypothetical protein B456_001G258800                  62.0    1e-07   
ref|XP_011269724.1|  PREDICTED: zinc transporter 7-A                  61.6    1e-07   
ref|XP_006263766.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
ref|XP_009934586.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
ref|XP_002168729.2|  PREDICTED: zinc transporter 7-like               61.6    1e-07   
ref|XP_010309987.1|  PREDICTED: zinc transporter 5                    62.0    1e-07   
gb|KGL93147.1|  Zinc transporter 7                                    61.2    1e-07   
ref|XP_005690634.1|  PREDICTED: zinc transporter 10                   62.0    1e-07   
gb|KFR00429.1|  Zinc transporter 7                                    61.2    1e-07   
ref|XP_003474576.1|  PREDICTED: zinc transporter 10                   61.6    1e-07   
gb|KFP64496.1|  Zinc transporter 7                                    61.2    1e-07   
ref|XP_009892647.1|  PREDICTED: zinc transporter 10                   61.6    2e-07   
ref|XP_011309397.1|  PREDICTED: zinc transporter 7                    61.2    2e-07   
gb|KFQ88086.1|  Zinc transporter 7                                    61.2    2e-07   
gb|KFO03703.1|  Zinc transporter 5                                    61.6    2e-07   
gb|EGV92543.1|  Zinc transporter 10                                   61.2    2e-07   
ref|XP_006627080.1|  PREDICTED: zinc transporter 5-like               61.6    2e-07   
gb|KFV39667.1|  Zinc transporter 7                                    61.2    2e-07   
gb|KFU98393.1|  Zinc transporter 7                                    61.2    2e-07   
gb|KFO04511.1|  Zinc transporter 7                                    61.2    2e-07   
gb|EOB01901.1|  Zinc transporter 7                                    61.2    2e-07   
gb|KFO94380.1|  Zinc transporter 7                                    61.2    2e-07   
ref|XP_010003683.1|  PREDICTED: zinc transporter 5                    61.6    2e-07   
ref|XP_005335923.1|  PREDICTED: zinc transporter 10                   61.2    2e-07   
ref|XP_005540937.1|  PREDICTED: zinc transporter 10 isoform X2        61.2    2e-07   
gb|KGL81266.1|  Zinc transporter 5                                    61.6    2e-07   
emb|CEF65576.1|  Zinc transporter 5                                   61.6    2e-07   
ref|XP_008587782.1|  PREDICTED: zinc transporter 10                   60.5    2e-07   
ref|NP_001099874.1|  zinc transporter 5                               61.6    2e-07   
ref|XP_007670637.1|  PREDICTED: zinc transporter 10                   60.5    2e-07   
gb|KFP23132.1|  Zinc transporter 7                                    60.8    2e-07   
ref|XP_011234296.1|  PREDICTED: zinc transporter 7 isoform X1         61.2    2e-07   
ref|XP_009459342.1|  PREDICTED: zinc transporter 5                    60.8    2e-07   
ref|XP_010149493.1|  PREDICTED: zinc transporter 5-like               58.9    2e-07   
gb|EFB17345.1|  hypothetical protein PANDA_018119                     60.8    2e-07   
ref|XP_007455448.1|  PREDICTED: zinc transporter 10                   61.2    2e-07   
ref|XP_004626998.1|  PREDICTED: zinc transporter 10                   61.2    2e-07   
ref|XP_005152140.1|  PREDICTED: zinc transporter 5                    61.2    2e-07   
ref|XP_009993103.1|  PREDICTED: zinc transporter 10                   60.8    2e-07   
ref|NP_001288071.1|  solute carrier family 30 (zinc transporter),...  61.2    2e-07   
gb|KFU97549.1|  Zinc transporter 10                                   59.7    2e-07   
gb|EMC86486.1|  Zinc transporter 5                                    61.2    2e-07   
gb|KFW96254.1|  Zinc transporter 7                                    60.8    2e-07   
gb|KFV94221.1|  Zinc transporter 7                                    60.8    2e-07   
gb|KFZ49685.1|  Zinc transporter 10                                   59.7    2e-07   
ref|XP_005506008.1|  PREDICTED: zinc transporter 5                    61.2    2e-07   
ref|XP_009873932.1|  PREDICTED: zinc transporter 5                    61.2    2e-07   
ref|XP_011213725.1|  PREDICTED: probable zinc transporter protein...  60.8    2e-07   
gb|ELK31187.1|  Zinc transporter 5                                    60.8    2e-07   
ref|XP_005432767.1|  PREDICTED: zinc transporter 5                    61.2    2e-07   
gb|KFW81627.1|  Zinc transporter 5                                    61.2    3e-07   
gb|KFP78911.1|  Zinc transporter 5                                    60.8    3e-07   
ref|XP_002801929.1|  PREDICTED: zinc transporter 10 isoform 2         60.8    3e-07   
ref|XP_008053502.1|  PREDICTED: zinc transporter 10                   60.8    3e-07   
gb|ETE74044.1|  Zinc transporter 7                                    60.8    3e-07   
ref|XP_011098535.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  61.2    3e-07   
ref|XP_001998385.1|  GI23936                                          60.5    3e-07   
ref|XP_008922957.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_005244440.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_010015517.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
gb|KFV93848.1|  Zinc transporter 10                                   59.3    3e-07   
ref|XP_008160286.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_009820695.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_009635552.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_003759474.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
gb|AAI23968.1|  solute carrier family 30 (zinc transporter), memb...  60.8    3e-07   
gb|KFQ49608.1|  Zinc transporter 5                                    60.8    3e-07   
ref|XP_008934741.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_011051796.1|  PREDICTED: zinc transporter 7                    60.5    3e-07   
ref|XP_004403465.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_009926542.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_009882587.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   
ref|XP_005301082.1|  PREDICTED: zinc transporter 5                    60.8    3e-07   



>ref|XP_006363772.1| PREDICTED: metal tolerance protein C2-like [Solanum tuberosum]
Length=387

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTLG
Sbjct  215  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTLG  274

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVF LV+PLF+ T G+LLQ APP IPSS L+KCWRQV+S + V+E+
Sbjct  275  VKNAEVLCLGLVSATVFFLVLPLFRTTGGILLQMAPPRIPSSALSKCWRQVSSREDVSEV  334

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSISLQVK+GVDDRP+LQYV DLYH+LG+QDLT+QI+
Sbjct  335  SQARFWELVPGHVIGSISLQVKEGVDDRPILQYVHDLYHELGIQDLTIQID  385



>ref|XP_009765282.1| PREDICTED: metal tolerance protein C2 isoform X1 [Nicotiana sylvestris]
Length=397

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTLG
Sbjct  225  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTLG  284

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVF LVMPLF+AT G+LLQ APP IPSS L+KCWRQV+S + V+E+
Sbjct  285  VKNAEVLCLGLVSATVFFLVMPLFRATGGILLQMAPPRIPSSALSKCWRQVSSCEDVSEV  344

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSI LQVK+GVDDRP+LQYV DLYH+LG+QDLTVQI+
Sbjct  345  SQARFWELVPGHVIGSILLQVKEGVDDRPILQYVHDLYHELGIQDLTVQID  395



>ref|XP_009765283.1| PREDICTED: metal tolerance protein C2 isoform X2 [Nicotiana sylvestris]
Length=385

 Score =   304 bits (778),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTLG
Sbjct  213  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTLG  272

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVF LVMPLF+AT G+LLQ APP IPSS L+KCWRQV+S + V+E+
Sbjct  273  VKNAEVLCLGLVSATVFFLVMPLFRATGGILLQMAPPRIPSSALSKCWRQVSSCEDVSEV  332

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSI LQVK+GVDDRP+LQYV DLYH+LG+QDLTVQI+
Sbjct  333  SQARFWELVPGHVIGSILLQVKEGVDDRPILQYVHDLYHELGIQDLTVQID  383



>gb|AHZ08765.1| metal tolerance protein C2 [Nicotiana tabacum]
Length=395

 Score =   304 bits (778),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTLG
Sbjct  223  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTLG  282

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVF LVMPLF+AT G+LLQ APP IPSS L+KCWRQV+S + V+E+
Sbjct  283  VKNAEVLCLGLVSATVFFLVMPLFRATGGILLQMAPPRIPSSALSKCWRQVSSCEDVSEV  342

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSI LQVK+GVDDRP+LQYV DLYH+LG+QDLTVQI+
Sbjct  343  SQARFWELVPGHVIGSILLQVKEGVDDRPILQYVHDLYHELGIQDLTVQID  393



>ref|XP_009618767.1| PREDICTED: metal tolerance protein C2 isoform X1 [Nicotiana tomentosiformis]
Length=397

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTLG
Sbjct  225  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTLG  284

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVF LVMPLF+AT G+LLQ APP IPSS L+KC RQV+S + V+E+
Sbjct  285  VKNAEVLCLGLVSATVFFLVMPLFRATGGILLQMAPPRIPSSALSKCLRQVSSREDVSEV  344

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSI LQVK+GVDDRP+LQYV DLYH+LG+QDLTVQI+
Sbjct  345  SQARFWELVPGHVIGSILLQVKEGVDDRPILQYVHDLYHELGIQDLTVQID  395



>ref|XP_009618769.1| PREDICTED: metal tolerance protein C2 isoform X2 [Nicotiana tomentosiformis]
Length=385

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTLG
Sbjct  213  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTLG  272

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVF LVMPLF+AT G+LLQ APP IPSS L+KC RQV+S + V+E+
Sbjct  273  VKNAEVLCLGLVSATVFFLVMPLFRATGGILLQMAPPRIPSSALSKCLRQVSSREDVSEV  332

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSI LQVK+GVDDRP+LQYV DLYH+LG+QDLTVQI+
Sbjct  333  SQARFWELVPGHVIGSILLQVKEGVDDRPILQYVHDLYHELGIQDLTVQID  383



>emb|CDP10150.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYR AEDMNYHSVCLHV+ADS+RSAGLILASWLL LG
Sbjct  238  AVTNLLVNLIGVWFFRNYARINLVYRNAEDMNYHSVCLHVLADSIRSAGLILASWLLALG  297

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLV+PLFKAT G+LLQ APP++PSS L+KCWRQV++ + ++E+
Sbjct  298  VRNAEVLCLGLVSFTVFMLVIPLFKATGGILLQMAPPSMPSSALSKCWRQVSTREEISEV  357

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSISLQVKKG++DRPVLQYV +LYH+LGVQDLTVQ++
Sbjct  358  SQARFWELVPGHVIGSISLQVKKGIEDRPVLQYVHNLYHELGVQDLTVQVD  408



>ref|XP_010317909.1| PREDICTED: metal tolerance protein C2 isoform X2 [Solanum lycopersicum]
Length=387

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTLG
Sbjct  215  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTLG  274

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVF LVMPLF+ T G+LLQ APP IPSS  +KCWRQV+S + V+E+
Sbjct  275  VKNAEVLCLGLVSATVFFLVMPLFRTTGGILLQMAPPRIPSSAWSKCWRQVSSREDVSEV  334

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH IGSI+LQVK+GVDD PVLQYV DLYH+LG+QDLTVQI+
Sbjct  335  SQARFWELVPGHVIGSIALQVKEGVDDWPVLQYVHDLYHELGIQDLTVQID  385



>ref|XP_010520030.1| PREDICTED: metal tolerance protein C2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010520031.1| PREDICTED: metal tolerance protein C2 isoform X2 [Tarenaya hassleriana]
Length=400

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYAR+NLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASW L++G
Sbjct  228  AVTNLLVNLIGVWFFRNYARVNLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWFLSIG  287

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS LNKC RQ+ S + VTE+
Sbjct  288  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALNKCLRQITSREEVTEV  347

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPG+ +GS++LQVK G DDRP+LQ+V DLYHDLGVQDLTVQ +
Sbjct  348  LQARFWELVPGYTVGSLTLQVKSGTDDRPLLQFVYDLYHDLGVQDLTVQTD  398



>dbj|BAH20279.1| AT3G12100 [Arabidopsis thaliana]
Length=218

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+ YRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  46   AVTNLLVNLLGVWFFRNYARVNIAYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  105

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+N EVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + VTE+
Sbjct  106  VENTEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVTEV  165

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  166  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  216



>gb|KDO70913.1| hypothetical protein CISIN_1g023355mg [Citrus sinensis]
Length=283

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYR  EDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  111  AVTNLLVNLIGVWFFRNYARINLVYRNPEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  170

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLVMPLFK T G+LLQ APP+IPSS L+KCWRQ+ S + VTE+
Sbjct  171  VQNAEVLCLGIVSVAVFMLVMPLFKVTGGILLQMAPPSIPSSALSKCWRQIVSREDVTEV  230

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+SLQV KGVDDRP+LQ+V  LYHDLGVQDLTVQI+
Sbjct  231  SQARFWELVPGHVVGSLSLQVNKGVDDRPILQFVHGLYHDLGVQDLTVQID  281



>ref|XP_006429885.1| hypothetical protein CICLE_v10011987mg [Citrus clementina]
 gb|ESR43125.1| hypothetical protein CICLE_v10011987mg [Citrus clementina]
Length=373

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYR  EDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  201  AVTNLLVNLIGVWFFRNYARINLVYRNPEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  260

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLVMPLFK T G+LLQ APP+IPSS L+KCWRQ+ S + VTE+
Sbjct  261  VQNAEVLCLGIVSVAVFMLVMPLFKVTGGILLQMAPPSIPSSALSKCWRQIVSREDVTEV  320

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+SLQVKKGVDDRP+LQ+V  LYHDLGVQDLTVQI+
Sbjct  321  SQARFWELVPGHVVGSLSLQVKKGVDDRPILQFVHGLYHDLGVQDLTVQID  371



>ref|XP_010317908.1| PREDICTED: metal tolerance protein C2 isoform X1 [Solanum lycopersicum]
Length=388

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINL-VYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTL  595
            AVTNLLVNLIGVWFFRNYARINL VYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLLTL
Sbjct  215  AVTNLLVNLIGVWFFRNYARINLAVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLTL  274

Query  594  GVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTE  415
            GVKNAEVLC+GLVS TVF LVMPLF+ T G+LLQ APP IPSS  +KCWRQV+S + V+E
Sbjct  275  GVKNAEVLCLGLVSATVFFLVMPLFRTTGGILLQMAPPRIPSSAWSKCWRQVSSREDVSE  334

Query  414  LFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            + Q R WE+VPGH IGSI+LQVK+GVDD PVLQYV DLYH+LG+QDLTVQI+
Sbjct  335  VSQARFWELVPGHVIGSIALQVKEGVDDWPVLQYVHDLYHELGIQDLTVQID  386



>gb|AAG51048.1|AC069473_10 unknown protein; 24862-27391 [Arabidopsis thaliana]
Length=381

 Score =   293 bits (750),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+ YRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  209  AVTNLLVNLLGVWFFRNYARVNIAYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  268

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + VTE+
Sbjct  269  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVTEV  328

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  329  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  379



>ref|XP_006492851.1| PREDICTED: metal tolerance protein C2-like [Citrus sinensis]
Length=373

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINL YR  EDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  201  AVTNLLVNLIGVWFFRNYARINLFYRSPEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  260

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLVMPLFK T G+LLQ APP+IPSS L+KCWRQ+ S + VTE+
Sbjct  261  VQNAEVLCLGIVSVAVFMLVMPLFKVTGGILLQMAPPSIPSSALSKCWRQIVSREDVTEV  320

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+SLQV KGVDDRP+LQ+V  LYHDLGVQDLTVQI+
Sbjct  321  SQARFWELVPGHVVGSLSLQVNKGVDDRPILQFVHGLYHDLGVQDLTVQID  371



>ref|XP_010498516.1| PREDICTED: metal tolerance protein C2-like [Camelina sativa]
Length=393

 Score =   293 bits (751),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  221  AVTNLLVNLLGVWFFRNYARVNIVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT G+LLQ APPNIPSS L+KC RQ+ S + VTE+
Sbjct  281  VENAEVLCLGLVSVTVFMLVMPLFKATGGILLQMAPPNIPSSALSKCLRQITSREDVTEV  340

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  341  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  391



>ref|NP_187817.2| metal tolerance protein 5 [Arabidopsis thaliana]
 sp|Q6ICY4.1|MTPC2_ARATH RecName: Full=Metal tolerance protein C2; Short=AtMTPc2; AltName: 
Full=AtMTP5 [Arabidopsis thaliana]
 gb|AAT44130.1| At3g12100 [Arabidopsis thaliana]
 gb|AAU84686.1| At3g12100 [Arabidopsis thaliana]
 dbj|BAE99771.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75149.1| metal tolerance protein 5 [Arabidopsis thaliana]
Length=393

 Score =   293 bits (750),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+ YRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  221  AVTNLLVNLLGVWFFRNYARVNIAYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + VTE+
Sbjct  281  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVTEV  340

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  341  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  391



>ref|XP_010486899.1| PREDICTED: metal tolerance protein C2-like [Camelina sativa]
Length=393

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  221  AVTNLLVNLLGVWFFRNYARVNIVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT G+LLQ APPNIPSS L+KC RQ+ S + VTE+
Sbjct  281  VENAEVLCLGLVSVTVFMLVMPLFKATGGILLQMAPPNIPSSALSKCLRQITSREDVTEV  340

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  341  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  391



>emb|CDY08456.1| BnaA05g26920D [Brassica napus]
Length=389

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  217  AVTNLLVNLLGVWFFRNYARMNIVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  276

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + V E+
Sbjct  277  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVIEV  336

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ +QVK G+D+RP+LQYV D+YHDLGVQDLT+Q E
Sbjct  337  LQARFWEVVPGHTVGSLRIQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTE  387



>gb|KFK38575.1| hypothetical protein AALP_AA3G131200 [Arabis alpina]
Length=389

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFR+YAR+N+VYRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  217  AVTNLLVNLIGVWFFRHYARVNIVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  276

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S D V E+
Sbjct  277  VENAEVLCLGLVSITVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSRDDVMEV  336

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  337  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  387



>ref|XP_009146647.1| PREDICTED: metal tolerance protein C2 [Brassica rapa]
Length=390

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  218  AVTNLLVNLLGVWFFRNYARMNIVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  277

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + V E+
Sbjct  278  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVIEV  337

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ +QVK G+D+RP+LQYV D+YHDLGVQDLT+Q E
Sbjct  338  LQARFWEVVPGHTVGSLRIQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTE  388



>emb|CDY01101.1| BnaC05g40990D [Brassica napus]
Length=391

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  219  AVTNLLVNLLGVWFFRNYARMNIVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  278

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + V E+
Sbjct  279  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVIEV  338

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ +QVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  339  LQARFWEVVPGHTVGSLRIQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  389



>ref|XP_002884882.1| hypothetical protein ARALYDRAFT_897419 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61141.1| hypothetical protein ARALYDRAFT_897419 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+ YRKAEDMNYHSVCLHVIADS+RSAGLILASWLL+LG
Sbjct  221  AVTNLLVNLLGVWFFRNYARVNIAYRKAEDMNYHSVCLHVIADSIRSAGLILASWLLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + V E+
Sbjct  281  VENAEVLCLGLVSITVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVMEV  340

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  341  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  391



>ref|XP_010464960.1| PREDICTED: metal tolerance protein C2 [Camelina sativa]
Length=393

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  221  AVTNLLVNLLGVWFFRNYARVNIVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT G+LLQ APPNIPSS L+KC RQ+ S + V E+
Sbjct  281  VENAEVLCLGLVSVTVFMLVMPLFKATGGILLQMAPPNIPSSALSKCLRQITSREDVIEV  340

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  341  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  391



>gb|EYU39946.1| hypothetical protein MIMGU_mgv1a007675mg [Erythranthe guttata]
Length=399

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIG+WFFRNYAR+NL YRKAEDMNYHSVCLHVIADS+RSAGLILASW+L+LG
Sbjct  227  AVTNLLVNLIGIWFFRNYARVNLAYRKAEDMNYHSVCLHVIADSIRSAGLILASWMLSLG  286

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVFM+VMPLFKA+ GVLLQ APP++PSS L+KC RQV+S + V E+
Sbjct  287  VKNAEVLCLGLVSFTVFMIVMPLFKASGGVLLQMAPPSVPSSALSKCRRQVSSREDVEEV  346

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GSISLQVK G+DD+P+LQYV  +YH+LGVQDLTVQ E
Sbjct  347  SQARFWEVVPGHVVGSISLQVKSGMDDQPILQYVHGVYHELGVQDLTVQTE  397



>ref|XP_011033203.1| PREDICTED: metal tolerance protein C2 [Populus euphratica]
Length=386

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARIN+VYRKAEDMN+HSVCLHVIADS+RSAGLILASW L+LG
Sbjct  214  AVTNLLVNLIGVWFFRNYARINIVYRKAEDMNFHSVCLHVIADSIRSAGLILASWFLSLG  273

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  V MLV+PLFKAT G+LLQ APP+IPSS L+KC RQV++ + V E+
Sbjct  274  VENAEVLCLGLVSAAVVMLVLPLFKATGGILLQMAPPSIPSSALSKCLRQVSAREDVAEV  333

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQI  262
             + R WE+VPGH +GSISLQVKKGVDDRPVLQ V  LYHDLGVQDLTVQI
Sbjct  334  SEARFWELVPGHVVGSISLQVKKGVDDRPVLQSVHGLYHDLGVQDLTVQI  383



>ref|XP_006407371.1| hypothetical protein EUTSA_v10020889mg [Eutrema salsugineum]
 dbj|BAJ34578.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48824.1| hypothetical protein EUTSA_v10020889mg [Eutrema salsugineum]
Length=393

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYARIN+VYRKAEDMNYHSVCLHVIADS+RSAGLILASWLL+LG
Sbjct  221  AVTNLLVNLLGVWFFRNYARINIVYRKAEDMNYHSVCLHVIADSIRSAGLILASWLLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMP+FKAT GVLLQ APPNIP S L+KC RQ+ S + V E+
Sbjct  281  VENAEVLCLGLVSVTVFMLVMPIFKATGGVLLQMAPPNIPPSALSKCLRQITSREDVMEV  340

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ +QVK G+D+RP+LQ+V DLYHDLGVQDLT+Q +
Sbjct  341  LQARFWEVVPGHTVGSLRIQVKSGIDERPLLQFVYDLYHDLGVQDLTLQTD  391



>gb|KDP24631.1| hypothetical protein JCGZ_25547 [Jatropha curcas]
Length=397

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFR+YARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  225  AVTNLLVNLIGVWFFRSYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  284

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFMLVMPLFK+TAGVLLQ APP+IP S L+KC RQV + + VTE+
Sbjct  285  VENAEVLCLGLVSVAVFMLVMPLFKSTAGVLLQMAPPSIPYSALSKCLRQVTAREDVTEV  344

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +G++SLQVKKG+DDRP LQ+V  LYHDLGV+DLTVQ +
Sbjct  345  SQARFWELVPGHVVGTLSLQVKKGMDDRPTLQFVHGLYHDLGVRDLTVQTD  395



>ref|XP_004304358.1| PREDICTED: metal tolerance protein C2 [Fragaria vesca subsp. 
vesca]
Length=383

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYR AEDMN HSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  211  AVTNLLVNLIGVWFFRNYARINLVYRNAEDMNNHSVCLHVLADSIRSAGLILASWFLSLG  270

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC GLV+  VFMLVMPLF+AT G+LLQ APPN+P+S L+KCWRQ+A+ + V+E+
Sbjct  271  VQNAEVLCFGLVAVVVFMLVMPLFRATGGILLQMAPPNVPTSALSKCWRQIAAREDVSEV  330

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+SLQVKKG+DDRPVLQ V  LYHDLG+QDL VQ +
Sbjct  331  SQARFWEVVPGHVVGSLSLQVKKGIDDRPVLQLVHGLYHDLGIQDLAVQAD  381



>ref|XP_002323276.2| hypothetical protein POPTR_0016s04430g [Populus trichocarpa]
 gb|EEF05037.2| hypothetical protein POPTR_0016s04430g [Populus trichocarpa]
Length=386

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARIN+VYRKAEDMN+HSVCLHVIADS+RSAGLILASW L+LG
Sbjct  214  AVTNLLVNLIGVWFFRNYARINIVYRKAEDMNFHSVCLHVIADSIRSAGLILASWFLSLG  273

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  V MLV+PLFKAT G+LLQ APP+IPSS L+KC RQV++ + V E+
Sbjct  274  VENAEVLCLGLVSAAVVMLVLPLFKATGGILLQMAPPSIPSSALSKCLRQVSAREDVAEV  333

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQ  265
             + R WE+VPGH IGSISLQVK+GVDDRP+LQ+V  LYHDLGVQDLTVQ
Sbjct  334  SEARFWELVPGHVIGSISLQVKEGVDDRPILQWVHGLYHDLGVQDLTVQ  382



>ref|XP_002530715.1| cation efflux protein/ zinc transporter, putative [Ricinus communis]
 gb|EEF31669.1| cation efflux protein/ zinc transporter, putative [Ricinus communis]
Length=321

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYR AEDMNYHSVCLHV+ADS+RS+GLILASWLL+LG
Sbjct  149  AVTNLLVNLIGVWFFRNYARINLVYRTAEDMNYHSVCLHVLADSIRSSGLILASWLLSLG  208

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V NAEVLC+GLVS  VFMLVMPLFK TAGVLLQ APP +PSS L+KC RQV + + V E+
Sbjct  209  VANAEVLCLGLVSVAVFMLVMPLFKTTAGVLLQMAPPRVPSSALSKCLRQVTAREDVNEV  268

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS++LQ+KKGVDDRP+L++V  LYHDLGVQDL VQ +
Sbjct  269  SQARFWELVPGHVVGSLTLQLKKGVDDRPILEFVHGLYHDLGVQDLIVQTD  319



>ref|XP_008240924.1| PREDICTED: metal tolerance protein C2 [Prunus mume]
Length=392

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYAR+NLVYR AEDMN HSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  220  AVTNLLVNLIGVWFFRNYARVNLVYRNAEDMNNHSVCLHVLADSIRSAGLILASWFLSLG  279

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC GLVS  VFMLVMPLF+A+ G+LLQ APPN+P+S L+KCWRQ+ + + V+E+
Sbjct  280  VQNAEVLCFGLVSVAVFMLVMPLFRASGGILLQMAPPNVPTSALSKCWRQITAREDVSEV  339

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+S+QVKKG+DDRP+LQ V  LYHDLG+QDLTVQ +
Sbjct  340  SQARFWELVPGHVVGSLSIQVKKGIDDRPILQLVHGLYHDLGIQDLTVQAD  390



>ref|XP_007202062.1| hypothetical protein PRUPE_ppa006837mg [Prunus persica]
 gb|EMJ03261.1| hypothetical protein PRUPE_ppa006837mg [Prunus persica]
Length=393

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYAR+NLVYR AEDMN HSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  221  AVTNLLVNLIGVWFFRNYARVNLVYRNAEDMNNHSVCLHVLADSIRSAGLILASWFLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC GLVS  VFMLVMPLF+A+ G+LLQ APPN+P+S L+KCWRQ+ + + V+E+
Sbjct  281  VQNAEVLCFGLVSVAVFMLVMPLFRASGGILLQMAPPNVPTSALSKCWRQITAREDVSEV  340

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+S+QVKKG+DDRP+LQ V  LYHDLG+QDLTVQ +
Sbjct  341  SQARFWELVPGHVVGSLSIQVKKGIDDRPILQLVHGLYHDLGIQDLTVQAD  391



>ref|XP_009369486.1| PREDICTED: metal tolerance protein C2 isoform X1 [Pyrus x bretschneideri]
Length=394

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYAR+NLVYR AEDMN HSVCLHV+ADS+RSAGLILASW L++G
Sbjct  222  AVTNLLVNLIGVWFFRNYARVNLVYRNAEDMNNHSVCLHVLADSIRSAGLILASWFLSIG  281

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC GLVS  VFMLVMPLF+A+ G+LLQ APPN+P S L+KCWRQ+ + + V+E+
Sbjct  282  VQNAEVLCFGLVSVAVFMLVMPLFRASGGILLQMAPPNVPPSALSKCWRQITACEDVSEV  341

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIEA  256
             Q R WE+VPGH +GS+S+QVKKG+DDRPVL+YV  LYHDLG+QDLTVQ ++
Sbjct  342  SQARFWELVPGHVVGSLSVQVKKGIDDRPVLRYVHGLYHDLGIQDLTVQADS  393



>ref|XP_008358007.1| PREDICTED: metal tolerance protein C2-like [Malus domestica]
Length=394

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYAR+NLVYR AEDMN HSVCLHV+ADS+RSAGLILASW L++G
Sbjct  222  AVTNLLVNLIGVWFFRNYARVNLVYRNAEDMNNHSVCLHVLADSIRSAGLILASWFLSIG  281

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC GLVS  VFMLVMPLF+A+ G+LLQ APPN+P S L+KCWRQVA+ + V+E+
Sbjct  282  VQNAEVLCFGLVSVAVFMLVMPLFRASGGILLQMAPPNVPPSALSKCWRQVAAREDVSEV  341

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIEA  256
             Q R WE+VPGH +GS+S+QVKKG+DDRP+L+ V  LYHDLG+QDLTVQ ++
Sbjct  342  SQARFWELVPGHVVGSLSVQVKKGIDDRPILRCVHGLYHDLGIQDLTVQADS  393



>ref|XP_004136564.1| PREDICTED: metal tolerance protein C2-like [Cucumis sativus]
 ref|XP_004163929.1| PREDICTED: metal tolerance protein C2-like [Cucumis sativus]
 gb|KGN59295.1| hypothetical protein Csa_3G806270 [Cucumis sativus]
Length=400

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHS+CLHV+ADS+RSAGLILASW L+LG
Sbjct  228  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSICLHVLADSIRSAGLILASWFLSLG  287

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFM+VMPLFKAT+GVLLQ APP+IP+S L+KCWRQ+ S + + E+
Sbjct  288  VQNAEVLCLGLVSITVFMIVMPLFKATSGVLLQMAPPSIPTSALSKCWRQITSREDIVEI  347

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPG  IGS+SL  KKG D R  L++  D+YH+LG+QDLTVQ E
Sbjct  348  TQARFWELVPGQVIGSLSLTTKKGTDSRQALEFAHDMYHELGIQDLTVQTE  398



>ref|XP_002279787.1| PREDICTED: metal tolerance protein C2 [Vitis vinifera]
 emb|CBI30011.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   283 bits (724),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASW LTLG
Sbjct  216  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWFLTLG  275

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS  VFMLVMPLFK T G+LLQ APP+IP S L+KC RQ+ +H+ V E+
Sbjct  276  VKNAEVLCLGLVSVAVFMLVMPLFKTTGGILLQMAPPSIPPSALSKCRRQITAHEDVLEV  335

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q   WE+VPGH +GS++LQVK G+DD P+LQYV DLYHDLGV++LTVQ +
Sbjct  336  SQACFWELVPGHVVGSVTLQVKDGIDDCPMLQYVHDLYHDLGVKELTVQAD  386



>ref|XP_008380144.1| PREDICTED: metal tolerance protein C2 [Malus domestica]
Length=394

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYAR+NLVYR AEDMN HSVCLHV+ADS+RSAGLILASW L++G
Sbjct  222  AVTNLLVNLIGVWFFRNYARVNLVYRNAEDMNNHSVCLHVLADSIRSAGLILASWFLSIG  281

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC GLVS  VFMLVMPLF+A+ G+LLQ APPN+P S L+KCWRQV + + V+E+
Sbjct  282  VQNAEVLCFGLVSVAVFMLVMPLFRASGGILLQMAPPNVPPSALSKCWRQVXAREDVSEV  341

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIEA  256
             Q R WE+VPGH +GS+S+QVKKG+DDRP+L+ V  LYHDLG+QDLTVQ ++
Sbjct  342  SQARFWELVPGHVVGSLSVQVKKGIDDRPILRCVHGLYHDLGIQDLTVQADS  393



>ref|XP_008443044.1| PREDICTED: metal tolerance protein C2 [Cucumis melo]
Length=400

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHS+CLHV+ADS+RSAGLILASW L+LG
Sbjct  228  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSICLHVLADSIRSAGLILASWFLSLG  287

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFM+VMPLF+AT+GVLLQ APP+IP+S L+KCWRQ+ SH+ + E+
Sbjct  288  VQNAEVLCLGLVSVAVFMIVMPLFRATSGVLLQMAPPSIPTSALSKCWRQITSHEDIVEI  347

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPG  IGS+SL  KKG+  R  L++V D+YH+LG+QDLTVQ E
Sbjct  348  TQARFWELVPGQVIGSLSLTTKKGMGSRQALEFVHDMYHELGIQDLTVQTE  398



>ref|XP_010257477.1| PREDICTED: metal tolerance protein C2 isoform X1 [Nelumbo nucifera]
 ref|XP_010257478.1| PREDICTED: metal tolerance protein C2 isoform X1 [Nelumbo nucifera]
Length=426

 Score =   281 bits (720),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYARINLVYR AEDMNYHSVCLHV+ADS+RSAGLILASW LTLG
Sbjct  254  AVTNLLVNLLGVWFFRNYARINLVYRNAEDMNYHSVCLHVLADSIRSAGLILASWFLTLG  313

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVFMLV+PLF+ T G+LLQ APPNIPSS L+KC RQ+ + + V E+
Sbjct  314  VKNAEVLCLGLVSVTVFMLVIPLFRTTGGILLQMAPPNIPSSALSKCHRQITALEGVNEV  373

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             + R WE+VPGH +GS+SLQVKKG DD P+L YV  LYHDLGVQDLTVQ +
Sbjct  374  SEARFWELVPGHVVGSLSLQVKKGEDDHPILVYVYGLYHDLGVQDLTVQTD  424



>gb|KJB16338.1| hypothetical protein B456_002G224200 [Gossypium raimondii]
Length=398

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+NLVYRK EDMNYHSVCLHV+ADSVRSAGLILASW L+LG
Sbjct  226  AVTNLLVNLMGVWFFRNYARVNLVYRKPEDMNYHSVCLHVLADSVRSAGLILASWFLSLG  285

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V NAEVLC+GLVS  VFMLVMPLFKA+ GVLLQ APPNI SS L KCW Q+ SH+ V E+
Sbjct  286  VNNAEVLCLGLVSVAVFMLVMPLFKASGGVLLQMAPPNISSSALAKCWWQIKSHEDVIEV  345

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+SLQVKK +DDR +L+YV +LYH+LG+ DLTVQ +
Sbjct  346  SQARFWELVPGHVVGSLSLQVKKEMDDRRILEYVHNLYHELGIHDLTVQTD  396



>ref|XP_010911305.1| PREDICTED: metal tolerance protein C2-like, partial [Elaeis guineensis]
Length=186

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR YAR+N+VYRKAEDMNYHSVCLHV++DS+RSAGLILASW LTLG
Sbjct  14   AVTNLLVNLLGVWFFRAYARVNIVYRKAEDMNYHSVCLHVLSDSIRSAGLILASWFLTLG  73

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFM+V+PLFKAT G+LLQ AP N+  S  +KCWRQV + + V+E+
Sbjct  74   VENAEVLCLGLVSVAVFMVVLPLFKATGGILLQMAPANVSPSAFSKCWRQVTALEDVSEV  133

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHAIGS+ +QVK+G +D P+L YV  LYHDLGVQDLTVQ+E
Sbjct  134  SQARFWELVPGHAIGSLLIQVKRGANDGPILHYVHGLYHDLGVQDLTVQME  184



>gb|KHG01363.1| Metal tolerance C2 -like protein [Gossypium arboreum]
Length=398

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+NLVYRK EDMNYHSVCLHV+ADSVRSAGLILASW L+LG
Sbjct  226  AVTNLLVNLMGVWFFRNYARVNLVYRKPEDMNYHSVCLHVLADSVRSAGLILASWFLSLG  285

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V NAEVLC+GLVS  VFMLVMPLFKA+ GVLLQ APPNI SS L KCW Q+ SH+ V E+
Sbjct  286  VNNAEVLCLGLVSVAVFMLVMPLFKASGGVLLQMAPPNISSSALAKCWWQITSHEDVIEV  345

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+SLQVKK +DDR +L+Y  +LYH+LG+ DLTVQ +
Sbjct  346  SQARFWELVPGHVVGSLSLQVKKEMDDRRILEYAHNLYHELGMHDLTVQTD  396



>ref|XP_007029003.1| Cation efflux family protein [Theobroma cacao]
 gb|EOY09505.1| Cation efflux family protein [Theobroma cacao]
Length=436

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 154/204 (75%), Gaps = 33/204 (16%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLV---------------------------------YRK  691
            AVTNLLVNLIGVWFFRNYARINLV                                 YRK
Sbjct  231  AVTNLLVNLIGVWFFRNYARINLVMRFMDGPKNCATDAAMLCLNHGNLAMLCLICLVYRK  290

Query  690  AEDMNYHSVCLHVIADSVRSAGLILASWLLTLGVKNAEVLCMGLVSGTVFMLVMPLFKAT  511
             EDM+YHSVCLHV+ADS+RSAGLILASW L+LGV NAEVLC+GLVSG VFMLV+PLFKAT
Sbjct  291  PEDMSYHSVCLHVLADSIRSAGLILASWFLSLGVNNAEVLCLGLVSGAVFMLVLPLFKAT  350

Query  510  AGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDD  331
            AGVLLQTAPPNIPSS L+K WRQ+ SH+ VTE+ Q R WE+VPGH +GSISLQ+KK +DD
Sbjct  351  AGVLLQTAPPNIPSSALSKYWRQITSHEDVTEVSQARFWELVPGHVVGSISLQMKKEMDD  410

Query  330  RPVLQYVRDLYHDLGVQDLTVQIE  259
            RP+L+YV  LYH+LG+ DLTVQ +
Sbjct  411  RPILEYVHSLYHELGIHDLTVQTD  434



>ref|XP_010672644.1| PREDICTED: metal tolerance protein C2 [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR NL YR AEDMNYHSVCLHVIADS+RSAGLILASWLL LG
Sbjct  228  AVTNLLVNLVGVWFFRNYARRNLAYRNAEDMNYHSVCLHVIADSIRSAGLILASWLLALG  287

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            ++NAEVLCMGLVS  VFMLVMPLFKAT GVLLQ APP+IPSS ++KC RQ+A+ + VTE+
Sbjct  288  IQNAEVLCMGLVSVAVFMLVMPLFKATGGVLLQMAPPSIPSSAMSKCSRQIAALEDVTEI  347

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            +  R WE+VPG+ +GS+SLQ+K G DDR + Q+V  LYHDLGVQDLT+Q +
Sbjct  348  YASRFWELVPGYLVGSLSLQLKAGADDRSIRQFVHGLYHDLGVQDLTLQTD  398



>ref|XP_008804789.1| PREDICTED: metal tolerance protein C2 [Phoenix dactylifera]
Length=427

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR YAR+N+VYRKAEDMNYHSVCLHV++DS+RSAGLILASW LTLG
Sbjct  255  AVTNLLVNLLGVWFFRGYARVNIVYRKAEDMNYHSVCLHVLSDSIRSAGLILASWFLTLG  314

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFM+V+PLFKAT G+LLQ AP N+  S  +KCWRQV + + V+E+
Sbjct  315  VENAEVLCLGLVSVAVFMVVLPLFKATGGILLQMAPANVSPSAFSKCWRQVTALEDVSEV  374

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHAIGS+S+QVK+G +D P+L YV  LYHDLGVQDLTVQ++
Sbjct  375  SQARFWELVPGHAIGSLSIQVKRGANDSPILHYVHGLYHDLGVQDLTVQMD  425



>ref|XP_010058124.1| PREDICTED: metal tolerance protein C2 [Eucalyptus grandis]
 gb|KCW90311.1| hypothetical protein EUGRSUZ_A02454 [Eucalyptus grandis]
Length=392

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNLIGVWFFRNYARIN+VYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLL++G
Sbjct  220  AVTNLSVNLIGVWFFRNYARINIVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLSIG  279

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFMLVMPLFKA+ G+LLQ APP++P++ L+KC RQ+ + + V E+
Sbjct  280  VQNAEVLCLGLVSVAVFMLVMPLFKASGGILLQMAPPSMPTTALSKCCRQITAREDVKEI  339

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q RLWE+VPGH IGS+S+QVK G+ D+ ++Q+V  LYHDLG+QDLTVQ++
Sbjct  340  SQARLWELVPGHVIGSLSVQVKDGMSDQSLIQFVHGLYHDLGIQDLTVQVD  390



>ref|XP_010935336.1| PREDICTED: metal tolerance protein C2-like [Elaeis guineensis]
Length=427

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR YAR+N+VYRKAEDMNYHSVCLHV++DS+RSAGLILASW LTLG
Sbjct  255  AVTNLLVNLLGVWFFRAYARVNIVYRKAEDMNYHSVCLHVLSDSIRSAGLILASWFLTLG  314

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFM+V+PLFKAT G+LLQ AP N+  S  +KCWRQV + + V+E+
Sbjct  315  VENAEVLCLGLVSVAVFMVVLPLFKATGGILLQMAPANVSPSAFSKCWRQVTALEDVSEV  374

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHAIGS+ +QVK+G +D P+L YV  LYHDLGVQDLTVQ+E
Sbjct  375  SQARFWELVPGHAIGSLLIQVKRGANDGPILHYVHGLYHDLGVQDLTVQME  425



>ref|XP_011075260.1| PREDICTED: metal tolerance protein C2 [Sesamum indicum]
Length=378

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 13/171 (8%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHV+ADS+RSAGLILASWLL+LG
Sbjct  219  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVLADSIRSAGLILASWLLSLG  278

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAEVLC+GLVS TVFMLVMPLFKAT G+LL             KCWRQ++S + + E+
Sbjct  279  VKNAEVLCLGLVSATVFMLVMPLFKATGGILL-------------KCWRQISSREDIGEV  325

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GSISLQVK+G+DD P+LQYV  +YHDLG+QDLTVQ +
Sbjct  326  SQARFWELVPGHVVGSISLQVKQGMDDYPILQYVHGMYHDLGIQDLTVQTD  376



>ref|XP_009382749.1| PREDICTED: metal tolerance protein C2 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVN++GVWFFR+YAR+N+VYRKAEDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  245  AVTNLLVNILGVWFFRSYARVNIVYRKAEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  304

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  +FM+VMPLF+A+  +LLQ AP +IPSS  +KCWRQ+ S + V+E+
Sbjct  305  VENAEVLCLGLVSVAIFMVVMPLFRASGNILLQMAPASIPSSAFSKCWRQITSLEDVSEV  364

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             + R WE+VPGH IGS+S+QVK+G +D P+L+YV  LYHDLG+QDLTVQ+E
Sbjct  365  SEARFWELVPGHCIGSLSVQVKRGAEDLPILRYVHGLYHDLGIQDLTVQVE  415



>gb|AES81486.2| metal tolerance-like protein [Medicago truncatula]
Length=390

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNLIGVWFFRNYARINL YR AEDMN HSV LHV+ DS+RSAGLILASWLL++G
Sbjct  218  AVTNLFVNLIGVWFFRNYARINLAYRNAEDMNCHSVFLHVLTDSIRSAGLILASWLLSIG  277

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VF+LV+PLF+AT G+LLQ APP+IP++  +KC RQ+++H+ V ++
Sbjct  278  VENAEVLCLGLVSVAVFILVLPLFRATGGILLQMAPPSIPTTAFSKCLRQISAHEDVLDV  337

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+S+QVKKGVDDRP+L++V  LYHD GVQDLTVQI+
Sbjct  338  SQARFWELVPGHVVGSLSMQVKKGVDDRPILEFVHRLYHDFGVQDLTVQID  388



>ref|XP_003625268.1| Metal tolerance protein [Medicago truncatula]
Length=388

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNLIGVWFFRNYARINL YR AEDMN HSV LHV+ DS+RSAGLILASWLL++G
Sbjct  216  AVTNLFVNLIGVWFFRNYARINLAYRNAEDMNCHSVFLHVLTDSIRSAGLILASWLLSIG  275

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VF+LV+PLF+AT G+LLQ APP+IP++  +KC RQ+++H+ V ++
Sbjct  276  VENAEVLCLGLVSVAVFILVLPLFRATGGILLQMAPPSIPTTAFSKCLRQISAHEDVLDV  335

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+S+QVKKGVDDRP+L++V  LYHD GVQDLTVQI+
Sbjct  336  SQARFWELVPGHVVGSLSMQVKKGVDDRPILEFVHRLYHDFGVQDLTVQID  386



>ref|XP_003554213.1| PREDICTED: metal tolerance protein C2-like [Glycine max]
Length=363

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNL+GVWFFRNYARINL YR AEDMN+HSV LHV+ADS+RSAGLILASWLL++G
Sbjct  191  AVTNLFVNLVGVWFFRNYARINLAYRNAEDMNHHSVFLHVLADSIRSAGLILASWLLSIG  250

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFMLV+PLF+AT G+LLQ APP+IP++ LNKC RQ+++ + V E+
Sbjct  251  VQNAEVLCLGLVSVAVFMLVLPLFRATGGILLQMAPPSIPTTALNKCLRQISAREDVMEV  310

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPG+ +GS+ +QVKKG +DRP+L++V  LYHDLGVQDLTVQ +
Sbjct  311  SQARFWELVPGYVVGSLIIQVKKGTNDRPILEFVHGLYHDLGVQDLTVQTD  361



>gb|KHN45432.1| Metal tolerance protein C2 [Glycine soja]
Length=363

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNL+GVWFFRNYARINL YR AEDMN+HSV LHV+ADS+RSAGLILASWLL++G
Sbjct  191  AVTNLFVNLVGVWFFRNYARINLAYRNAEDMNHHSVFLHVLADSIRSAGLILASWLLSIG  250

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFMLV+PLF+AT G+LLQ APP+IP++ LNKC RQ+++ + V E+
Sbjct  251  VQNAEVLCLGLVSVAVFMLVLPLFRATGGILLQMAPPSIPTTALNKCLRQISAREDVMEV  310

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPG+ +GS+ +QVKKG +DRP+L++V  LYHDLGVQDLTVQ +
Sbjct  311  SQARFWELVPGYVVGSLIIQVKKGTNDRPILEFVHGLYHDLGVQDLTVQTD  361



>ref|XP_007134921.1| hypothetical protein PHAVU_010G086900g [Phaseolus vulgaris]
 gb|ESW06915.1| hypothetical protein PHAVU_010G086900g [Phaseolus vulgaris]
Length=369

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNL+GVWFFRNYARINL YR AEDMN+HSV LHV+ADS+RSAGLILASWLL++ 
Sbjct  197  AVTNLFVNLVGVWFFRNYARINLAYRNAEDMNHHSVFLHVLADSIRSAGLILASWLLSIR  256

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFMLV+PLF+AT G+LLQ APP+IP++ LNKC RQ+++ + V E+
Sbjct  257  VQNAEVLCLGLVSVAVFMLVLPLFRATGGILLQMAPPSIPTTALNKCLRQISAREDVVEV  316

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             QVR WE+VPGH IGS+ +QVK+G +DRP+L++V  LYHDLGVQDLTVQ +
Sbjct  317  SQVRFWELVPGHVIGSLIVQVKEGTNDRPILEFVHGLYHDLGVQDLTVQTD  367



>gb|AFW63866.1| hypothetical protein ZEAMMB73_373134 [Zea mays]
Length=213

 Score =   262 bits (670),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYR AEDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  36   AVTNLLVNLLGVWFFRNYARVNIVYRNAEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  95

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            ++NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S   KC RQ+A+ + V+E+
Sbjct  96   IENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPSNVPPSAFTKCSRQIAACEDVSEV  155

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            +Q R WE+VPG A+GS+S++VK G DDR VL+Y   LY DLG+QDLTVQ +
Sbjct  156  WQGRFWELVPGQAVGSLSIRVKSGADDRAVLEYTHGLYQDLGIQDLTVQTD  206



>ref|XP_004493594.1| PREDICTED: metal tolerance protein C2-like [Cicer arietinum]
Length=385

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNLIGVWFFRNYARINL YR AEDMN HSV LHV+ADS+RSAGL+LASWLL++G
Sbjct  213  AVTNLFVNLIGVWFFRNYARINLAYRNAEDMNCHSVFLHVLADSIRSAGLVLASWLLSIG  272

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VF+LV+PLF+AT G+LLQ APP+IP++  +KC RQ+++ + V E+
Sbjct  273  VENAEVLCLGLVSVAVFILVLPLFRATGGILLQMAPPSIPTTAFSKCLRQISALEDVLEV  332

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPG  +GS+S+QVKKGVDDRP+L++V  LYHDLGVQDLTVQI+
Sbjct  333  SQARFWELVPGRTVGSLSIQVKKGVDDRPILEFVHGLYHDLGVQDLTVQID  383



>ref|XP_006855603.1| hypothetical protein AMTR_s00044p00068470 [Amborella trichopoda]
 gb|ERN17070.1| hypothetical protein AMTR_s00044p00068470 [Amborella trichopoda]
Length=437

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YARIN+VYRK EDMNYHSVCLHV+ADS+RSAGLILASW LTLG
Sbjct  265  AVTNLLVNLLGVWFFRSYARINIVYRKPEDMNYHSVCLHVLADSIRSAGLILASWFLTLG  324

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEV+C+GLVS  VF++VMPLFKAT  VLLQTAP +IPSS L KCWRQ+++ + V+E+
Sbjct  325  VENAEVICLGLVSIAVFIVVMPLFKATGSVLLQTAPSSIPSSALAKCWRQISALEDVSEV  384

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPG+ +G++S+QVK G DD  +L++V  LYHD+G+QD+TVQ E
Sbjct  385  SQTRFWELVPGYVVGTLSIQVKNGADDHQILRHVHSLYHDIGIQDVTVQTE  435



>ref|XP_003520537.1| PREDICTED: metal tolerance protein C2-like isoform X1 [Glycine 
max]
Length=367

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNL+GVWFFRNYARINL YR AEDMN HSV LHV+ADS+RSAGLILASWLL++G
Sbjct  195  AVTNLFVNLVGVWFFRNYARINLTYRNAEDMNNHSVFLHVVADSIRSAGLILASWLLSIG  254

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFMLV+PLF+AT G+LLQ APP+IP++ LNKC RQ+++ + V E+
Sbjct  255  VQNAEVLCLGLVSVAVFMLVLPLFRATGGILLQMAPPSIPTTALNKCLRQISAREDVMEV  314

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE++PGH  GS+ +QVKKG +DRP+L++V  L+HDLGVQDLTVQ +
Sbjct  315  SQARFWELLPGHVFGSLIVQVKKGTNDRPILEFVHGLFHDLGVQDLTVQTD  365



>gb|KHN07434.1| Metal tolerance protein C2 [Glycine soja]
Length=363

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNL VNL+GVWFFRNYARINL YR AEDMN HSV LHV+ADS+RSAGLILASWLL++G
Sbjct  191  AVTNLFVNLVGVWFFRNYARINLTYRNAEDMNNHSVFLHVVADSIRSAGLILASWLLSIG  250

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS  VFMLV+PLF+AT G+LLQ APP+IP++ LNKC RQ++S + V E+
Sbjct  251  VQNAEVLCLGLVSVAVFMLVLPLFRATGGILLQMAPPSIPTTALNKCLRQISSREDVMEV  310

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
               R WE++PGH  GS+ +QVKKG +DRP+L++V  L+HDLGVQDLTVQ +
Sbjct  311  SLARFWELLPGHVFGSLIVQVKKGTNDRPILEFVHGLFHDLGVQDLTVQTD  361



>gb|EEC74309.1| hypothetical protein OsI_09578 [Oryza sativa Indica Group]
Length=191

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR+N+VYRKAEDMNYHSVCLHV+ADSVRSAGLILASW L+LG
Sbjct  20   AVTNLLVNLLGVWFFRSYARVNIVYRKAEDMNYHSVCLHVLADSVRSAGLILASWFLSLG  79

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S L KC+RQ+++ + V+E+
Sbjct  80   VENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPGNVPPSALTKCFRQISACEDVSEV  139

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHA+GS+ ++VK G D + VL YV  LY DLG+QDLT+Q +
Sbjct  140  CQGRFWELVPGHAVGSLDIRVKNGGDCQSVLDYVHGLYQDLGIQDLTIQTD  190



>gb|AFW63870.1| hypothetical protein ZEAMMB73_373134 [Zea mays]
Length=364

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+VYR AEDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  187  AVTNLLVNLLGVWFFRNYARVNIVYRNAEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  246

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            ++NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S   KC RQ+A+ + V+E+
Sbjct  247  IENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPSNVPPSAFTKCSRQIAACEDVSEV  306

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            +Q R WE+VPG A+GS+S++VK G DDR VL+Y   LY DLG+QDLTVQ +
Sbjct  307  WQGRFWELVPGQAVGSLSIRVKSGADDRAVLEYTHGLYQDLGIQDLTVQTD  357



>ref|XP_006576856.1| PREDICTED: metal tolerance protein C2-like isoform X2 [Glycine 
max]
Length=375

 Score =   259 bits (663),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 148/179 (83%), Gaps = 8/179 (4%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLV--------YRKAEDMNYHSVCLHVIADSVRSAGLIL  616
            AVTNL VNL+GVWFFRNYARINL+        YR AEDMN HSV LHV+ADS+RSAGLIL
Sbjct  195  AVTNLFVNLVGVWFFRNYARINLISSGICLAAYRNAEDMNNHSVFLHVVADSIRSAGLIL  254

Query  615  ASWLLTLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVA  436
            ASWLL++GV+NAEVLC+GLVS  VFMLV+PLF+AT G+LLQ APP+IP++ LNKC RQ++
Sbjct  255  ASWLLSIGVQNAEVLCLGLVSVAVFMLVLPLFRATGGILLQMAPPSIPTTALNKCLRQIS  314

Query  435  SHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            + + V E+ Q R WE++PGH  GS+ +QVKKG +DRP+L++V  L+HDLGVQDLTVQ +
Sbjct  315  AREDVMEVSQARFWELLPGHVFGSLIVQVKKGTNDRPILEFVHGLFHDLGVQDLTVQTD  373



>ref|NP_001048630.1| Os02g0832700 [Oryza sativa Japonica Group]
 dbj|BAD23017.1| cation efflux family protein-like [Oryza sativa Japonica Group]
 dbj|BAD28448.1| cation efflux family protein-like [Oryza sativa Japonica Group]
 dbj|BAF10544.1| Os02g0832700 [Oryza sativa Japonica Group]
 dbj|BAG94128.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score =   256 bits (654),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR+N+VYRKAEDMNYHSVCLHV+ADSVRSAGLILASW L+LG
Sbjct  105  AVTNLLVNLLGVWFFRSYARVNIVYRKAEDMNYHSVCLHVLADSVRSAGLILASWFLSLG  164

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S L KC+RQ+ + + V+E+
Sbjct  165  VENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPGNVPPSALTKCFRQITACEDVSEV  224

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHA+GS+ ++VK G D + VL YV  LY DLG+QDLT+Q +
Sbjct  225  CQGRFWELVPGHAVGSLDIRVKNGGDCQSVLDYVHGLYQDLGIQDLTIQTD  275



>dbj|BAB01958.1| unnamed protein product [Arabidopsis thaliana]
Length=371

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 13/171 (8%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+ YRKAEDMNYHSVCLHVI+DS+R              
Sbjct  212  AVTNLLVNLLGVWFFRNYARVNIAYRKAEDMNYHSVCLHVISDSIRR-------------  258

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQ+ S + VTE+
Sbjct  259  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVTEV  318

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGH +GS+ LQVK G+D+RP+LQYV D+YHDLGVQDLT+Q +
Sbjct  319  LQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTD  369



>ref|XP_004954537.1| PREDICTED: metal tolerance protein C2-like [Setaria italica]
Length=357

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR+N+VYR AEDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  185  AVTNLLVNLLGVWFFRSYARVNIVYRNAEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  244

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            ++NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S   KC RQ+ + + V+E+
Sbjct  245  IENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPGNVPPSAFAKCSRQITACEDVSEV  304

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            +Q R WE+VPG A+GS+S++VK G DDR VL++   LY DLG+QDLTVQ +
Sbjct  305  WQGRFWELVPGQAVGSLSIRVKSGADDRAVLEHAHGLYQDLGIQDLTVQTD  355



>ref|XP_002453105.1| hypothetical protein SORBIDRAFT_04g038530 [Sorghum bicolor]
 gb|EES06081.1| hypothetical protein SORBIDRAFT_04g038530 [Sorghum bicolor]
Length=359

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR N+VYR AEDMNYHSVCLHV+ADS+RSAGLILASW L+LG
Sbjct  187  AVTNLLVNLLGVWFFRSYARFNIVYRNAEDMNYHSVCLHVLADSIRSAGLILASWFLSLG  246

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            ++NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S   KC RQ+A+ + V+E+
Sbjct  247  IENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPSNVPPSAFTKCSRQIAACEDVSEV  306

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            +Q R WE+VPG A+GS+S++VK G DDR VL+Y   LY DLG+QD+TV  +
Sbjct  307  WQGRFWELVPGQAVGSVSIRVKSGADDRGVLEYTHGLYQDLGIQDVTVHTD  357



>dbj|BAK01144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 146/172 (85%), Gaps = 1/172 (1%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR+N+VYRKAEDMN+HS+CLHV+ADSVRSAGLILASW L+LG
Sbjct  189  AVTNLLVNLLGVWFFRSYARVNIVYRKAEDMNHHSICLHVLADSVRSAGLILASWFLSLG  248

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            ++NAEVLC+G+VS  VFMLVMPLFKAT  VLLQ AP N+P S L KC RQ+ +++ V+E+
Sbjct  249  IENAEVLCLGIVSVAVFMLVMPLFKATGNVLLQIAPGNVPPSALIKCSRQITAYEDVSEV  308

Query  411  FQVRLWEMVPGHAIGSISLQVKK-GVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHA+G +S++VKK   DD+ VL+YV  LY DLG+ DLT+Q E
Sbjct  309  SQARFWELVPGHAVGCLSIRVKKNSSDDQSVLEYVHGLYEDLGIHDLTIQAE  360



>ref|XP_009369493.1| PREDICTED: metal tolerance protein C2 isoform X2 [Pyrus x bretschneideri]
Length=381

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 139/172 (81%), Gaps = 13/172 (8%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVWFFRNYAR+NLVYR AEDMN HSVCLHV+ADS+R              
Sbjct  222  AVTNLLVNLIGVWFFRNYARVNLVYRNAEDMNNHSVCLHVLADSIRR-------------  268

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC GLVS  VFMLVMPLF+A+ G+LLQ APPN+P S L+KCWRQ+ + + V+E+
Sbjct  269  VQNAEVLCFGLVSVAVFMLVMPLFRASGGILLQMAPPNVPPSALSKCWRQITACEDVSEV  328

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIEA  256
             Q R WE+VPGH +GS+S+QVKKG+DDRPVL+YV  LYHDLG+QDLTVQ ++
Sbjct  329  SQARFWELVPGHVVGSLSVQVKKGIDDRPVLRYVHGLYHDLGIQDLTVQADS  380



>ref|XP_008365630.1| PREDICTED: LOW QUALITY PROTEIN: metal tolerance protein C2-like 
[Malus domestica]
Length=411

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 149/209 (71%), Gaps = 37/209 (18%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINL-----------------------------------VY  697
            AVTNLLVNLIGVW FRNYAR+NL                                    Y
Sbjct  202  AVTNLLVNLIGVWVFRNYARVNLGKFXAVFYVLSLRPFVIDLTIYEIHHGICFWDFPFNY  261

Query  696  RK--AEDMNYHSVCLHVIADSVRSAGLILASWLLTLGVKNAEVLCMGLVSGTVFMLVMPL  523
            RK   EDMN HSVCLHV+ADS+RSAGLILASW L++GV+NAEVLC GLVS  VFMLVMPL
Sbjct  262  RKIPQEDMNNHSVCLHVLADSIRSAGLILASWFLSIGVQNAEVLCFGLVSVAVFMLVMPL  321

Query  522  FKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKK  343
            F+A+ G+LLQ APPN+P S L+KCWRQV + + V+E+ Q R WE+VPGH +GS+S+QVKK
Sbjct  322  FRASGGILLQMAPPNVPPSALSKCWRQVXAREDVSEVSQARFWELVPGHVVGSLSVQVKK  381

Query  342  GVDDRPVLQYVRDLYHDLGVQDLTVQIEA  256
            G+DDRP+L+ V  LYHDLG+QDLTVQ ++
Sbjct  382  GIDDRPILRCVHGLYHDLGIQDLTVQADS  410



>ref|XP_006649212.1| PREDICTED: metal tolerance protein C2-like [Oryza brachyantha]
Length=350

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR+N+VYRK EDMNYHSVCLHV+ADS+RSAGLILASW LTLG
Sbjct  175  AVTNLLVNLLGVWFFRSYARVNIVYRKPEDMNYHSVCLHVLADSIRSAGLILASWFLTLG  234

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S L K  RQ+++ + V+E+
Sbjct  235  VENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPGNMPPSALMKYCRQISACEDVSEV  294

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHA+GS++++VK G + + VL YV  LY DLG+QDLTVQ +
Sbjct  295  CQGRFWELVPGHAVGSLAIRVKSGGNCQTVLDYVHGLYQDLGIQDLTVQTD  345



>gb|EPS69961.1| hypothetical protein M569_04795, partial [Genlisea aurea]
Length=350

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNLIGVW+FRNYARINLVYR AEDMN HS+CLHV+ADS+RSAGLILASWLL+LG
Sbjct  180  AVTNLLVNLIGVWYFRNYARINLVYRNAEDMNNHSICLHVLADSIRSAGLILASWLLSLG  239

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
             +NAEV+C+G VS  V M+++PLFK    +LLQ +P +I  S L KCWRQ++SH+ V E+
Sbjct  240  FENAEVVCLGAVSVAVLMIILPLFKTAGSILLQASPSDIHVSALRKCWRQMSSHEDVVEV  299

Query  411  FQVRLWEMVPGHAIGSISLQVKK-GVDDRPVLQYVRDLYHDLGVQDLTVQ  265
             Q R WE+VPGH +G ISL++KK GV ++ V+QYV  +YH+LGVQDLT+Q
Sbjct  300  CQARFWELVPGHVVGDISLRLKKQGVKEKEVVQYVHGVYHELGVQDLTLQ  349



>ref|XP_003570736.1| PREDICTED: metal tolerance protein C2 [Brachypodium distachyon]
Length=352

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR+++VYRKAEDMN+HS+CLHV+ADSVRSAGLILASW L+LG
Sbjct  180  AVTNLLVNLLGVWFFRSYARVSIVYRKAEDMNHHSICLHVLADSVRSAGLILASWFLSLG  239

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLV+PLFKA+  +LLQ AP N+  S   KC RQ+ +H+ V+E+
Sbjct  240  VENAEVLCLGIVSVAVFMLVLPLFKASGNILLQIAPGNVAPSAFIKCGRQITAHEDVSEV  299

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVD-DRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHA+G +S++VK G D D  VL+YV  LY DLG+Q+LT+Q E
Sbjct  300  CQGRFWELVPGHAVGCLSIRVKNGGDNDDSVLKYVHGLYEDLGIQELTIQTE  351



>gb|EEE58117.1| hypothetical protein OsJ_09007 [Oryza sativa Japonica Group]
Length=296

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 132/171 (77%), Gaps = 13/171 (8%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFR+YAR+N+VYRKAEDMNYHSVCLHV+ADSVR              
Sbjct  138  AVTNLLVNLLGVWFFRSYARVNIVYRKAEDMNYHSVCLHVLADSVRR-------------  184

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V+NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S L KC+RQ+ + + V+E+
Sbjct  185  VENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPGNVPPSALTKCFRQITACEDVSEV  244

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             Q R WE+VPGHA+GS+ ++VK G D + VL YV  LY DLG+QDLT+Q +
Sbjct  245  CQGRFWELVPGHAVGSLDIRVKNGGDCQSVLDYVHGLYQDLGIQDLTIQTD  295



>ref|XP_002982633.1| hypothetical protein SELMODRAFT_116499 [Selaginella moellendorffii]
 gb|EFJ16386.1| hypothetical protein SELMODRAFT_116499 [Selaginella moellendorffii]
Length=294

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 133/171 (78%), Gaps = 4/171 (2%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AV NL VN +GVWFFRNYARI+ VYRKAEDMN HS+CLHV++DS+RSAG+ILASWLL LG
Sbjct  122  AVANLCVNAMGVWFFRNYARISFVYRKAEDMNNHSICLHVLSDSIRSAGVILASWLLALG  181

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAE LC+G+VS  VF L +PLF A+ G+LLQ +PP I  S  +KC RQV S + V E 
Sbjct  182  VKNAETLCLGIVSVAVFFLALPLFNASGGLLLQMSPPGISPSAFSKCLRQVGSLEGVLEC  241

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            ++ R WE+VPG +    + QVK+G D++ +L++   +Y+D+GV+DLTV+++
Sbjct  242  YRARFWELVPGFS----NPQVKEGSDEQAILKHAHSVYNDIGVRDLTVELQ  288



>ref|XP_002981150.1| hypothetical protein SELMODRAFT_114043 [Selaginella moellendorffii]
 gb|EFJ17851.1| hypothetical protein SELMODRAFT_114043 [Selaginella moellendorffii]
Length=294

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AV NL VN +GVWFFRNYARI+ VYRKAEDMN HS+CLHV++DS+RS G+ILASWLL LG
Sbjct  122  AVANLCVNAMGVWFFRNYARISFVYRKAEDMNNHSICLHVLSDSIRSTGVILASWLLALG  181

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            VKNAE LC+G+VS  VF L +PLF A+ G+LLQ +PP I  S  +KC RQV S + V E 
Sbjct  182  VKNAETLCLGIVSVAVFFLALPLFNASGGLLLQMSPPGISPSAFSKCLRQVGSLEGVLEC  241

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            ++ R WE+VPG +    + QVK+G D++ +L++   +Y+D+GV+DLTV+++
Sbjct  242  YRARFWELVPGFS----NPQVKEGSDEQAILKHAHSVYNDIGVRDLTVELQ  288



>gb|EMT33211.1| Metal tolerance protein C2 [Aegilops tauschii]
Length=321

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 135/198 (68%), Gaps = 27/198 (14%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGL----------  622
            AVTNLLVNL+GVWFFR+YAR+N+VYRKAEDMN+HS+CLHV+ADSVR              
Sbjct  122  AVTNLLVNLLGVWFFRSYARVNIVYRKAEDMNHHSICLHVLADSVRRLDTSFLVSFIGVT  181

Query  621  ----ILASWLLTLG-------------VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
                 L S+++  G             ++NAEVLC+G+VS  VFMLVMPLFKAT  VLLQ
Sbjct  182  PLTAFLCSFMMAFGFWLSTCVCASVVRIENAEVLCLGIVSVAVFMLVMPLFKATGNVLLQ  241

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
             AP N+P S   KC RQ+ + + V+E+ Q R WE+VPGHA+G +S+++K   DD  VL+Y
Sbjct  242  IAPGNVPPSAFIKCGRQITACEDVSEVSQARFWELVPGHAVGCLSIRLKNSSDDESVLEY  301

Query  312  VRDLYHDLGVQDLTVQIE  259
            V  LY DLG+ DLT+Q E
Sbjct  302  VHGLYEDLGIHDLTIQTE  319



>ref|NP_001030676.1| metal tolerance protein 5 [Arabidopsis thaliana]
 gb|AEE75150.1| metal tolerance protein 5 [Arabidopsis thaliana]
Length=333

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYAR+N+ YRKAEDMNYHSVCLHVI+DS+RSAGLILASWLL+LG
Sbjct  221  AVTNLLVNLLGVWFFRNYARVNIAYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLG  280

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVAS  433
            V+NAEVLC+GLVS TVFMLVMPLFKAT GVLLQ APPNIPSS L+KC RQV S
Sbjct  281  VENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSSALSKCLRQVRS  333



>ref|XP_010111363.1| Metal tolerance protein C2 [Morus notabilis]
 gb|EXC30841.1| Metal tolerance protein C2 [Morus notabilis]
Length=624

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 116/148 (78%), Gaps = 13/148 (9%)
 Frame = -2

Query  702  VYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLGVKNAEVLCMGLVSGTVFMLVMPL  523
             YRKAEDMNYHSVCLHV+ADS+R              V+NAEVLC+G+VS  VFMLVMPL
Sbjct  489  AYRKAEDMNYHSVCLHVLADSIRR-------------VQNAEVLCLGIVSVAVFMLVMPL  535

Query  522  FKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKK  343
            F+AT G+LLQ APP+IP S L KCWRQ+ SH+ V+E+ Q R WE+VPGH +GS+S+Q KK
Sbjct  536  FRATGGILLQMAPPSIPPSALTKCWRQITSHEEVSEVSQARFWELVPGHVVGSLSIQAKK  595

Query  342  GVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            G+D+RP+LQYV  LYH+LG+ DLT+Q++
Sbjct  596  GMDERPILQYVHGLYHELGIHDLTLQVD  623



>ref|XP_001755969.1| predicted protein [Physcomitrella patens]
 gb|EDQ79254.1| predicted protein [Physcomitrella patens]
Length=291

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 126/171 (74%), Gaps = 0/171 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AV+NL+VNL+GVWFFR YAR    YR+A+D+N HS+CLHV++DS RSAG+ILASWLL LG
Sbjct  118  AVSNLVVNLLGVWFFRRYARRRFAYRRAQDINLHSICLHVLSDSFRSAGVILASWLLALG  177

Query  591  VKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTEL  412
            V  AE LC GLV+  VF   MPLF+A+  +L Q AP    ++ LNKC RQV   D V + 
Sbjct  178  VTYAETLCHGLVAAVVFYTAMPLFQASGAILSQMAPSGTTAAALNKCLRQVRMLDDVMQC  237

Query  411  FQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            +  R W++VPG  +G++ +QV++G D++ +L  V  +Y+D+GV+DLTV+IE
Sbjct  238  YNARFWDLVPGSIVGTLVMQVREGADEQSILSTVHSIYNDIGVKDLTVEIE  288



>gb|AFW63865.1| hypothetical protein ZEAMMB73_373134 [Zea mays]
Length=138

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  639  VRSAGLILASWLLTLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTL  460
            ++  GLILASW L+LG++NAEVLC+G+VS  VFMLV+PLFKAT  +LLQ AP N+P S  
Sbjct  5    IQYGGLILASWFLSLGIENAEVLCLGIVSVAVFMLVLPLFKATGNILLQIAPSNVPPSAF  64

Query  459  NKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQ  280
             KC RQ+A+ + V+E++Q R WE+VPG A+GS+S++VK G DDR VL+Y   LY DLG+Q
Sbjct  65   TKCSRQIAACEDVSEVWQGRFWELVPGQAVGSLSIRVKSGADDRAVLEYTHGLYQDLGIQ  124

Query  279  DLTVQIE  259
            DLTVQ +
Sbjct  125  DLTVQTD  131



>ref|XP_010257479.1| PREDICTED: metal tolerance protein C2 isoform X2 [Nelumbo nucifera]
Length=345

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLTLG  592
            AVTNLLVNL+GVWFFRNYARINLVYR AEDMNYHSVCLHV+ADS+RSAGLILASW LTLG
Sbjct  254  AVTNLLVNLLGVWFFRNYARINLVYRNAEDMNYHSVCLHVLADSIRSAGLILASWFLTLG  313

Query  591  VKN  583
             K+
Sbjct  314  TKD  316



>dbj|BAD23018.1| cation efflux family protein-like [Oryza sativa Japonica Group]
 dbj|BAD28449.1| cation efflux family protein-like [Oryza sativa Japonica Group]
Length=88

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVR  634
            AVTNLLVNL+GVWFFR+YAR+N+VYRKAEDMNYHSVCLHV+ADSVR
Sbjct  15   AVTNLLVNLLGVWFFRSYARVNIVYRKAEDMNYHSVCLHVLADSVR  60



>gb|ABV89623.1| cation efflux family protein [Brassica rapa]
Length=277

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSA  628
            AVTNLLVNL+GVWFFRNYAR+N+VYRKAEDMNYHSVCLHVI+DS+R +
Sbjct  219  AVTNLLVNLLGVWFFRNYARMNIVYRKAEDMNYHSVCLHVISDSIRRS  266



>gb|KJB16337.1| hypothetical protein B456_002G224200 [Gossypium raimondii]
Length=284

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVR  634
            AVTNLLVNL+GVWFFRNYAR+NLVYRK EDMNYHSVCLHV+ADSVR
Sbjct  226  AVTNLLVNLMGVWFFRNYARVNLVYRKPEDMNYHSVCLHVLADSVR  271



>ref|XP_006298286.1| hypothetical protein CARUB_v10014351mg [Capsella rubella]
 gb|EOA31184.1| hypothetical protein CARUB_v10014351mg [Capsella rubella]
Length=279

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVR  634
            AVTNLLVNL+GVWFFR+YAR+N+VYRKAEDMNYHSVCLHVI+DS+R
Sbjct  221  AVTNLLVNLLGVWFFRSYARVNIVYRKAEDMNYHSVCLHVISDSIR  266



>gb|AFN53638.1| hypothetical protein [Linum usitatissimum]
Length=685

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILAS  610
            AVTNL VNLIGVWFFRNYAR+ +VYR AEDMNYHSVCLHV+ADS+R   ++ A 
Sbjct  90   AVTNLAVNLIGVWFFRNYARVKIVYRNAEDMNYHSVCLHVLADSIRRFRIMTAE  143



>dbj|GAM26117.1| hypothetical protein SAMD00019534_092920 [Acytostelium subglobosum 
LB1]
Length=537

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 95/172 (55%), Gaps = 5/172 (3%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWL-LTL  595
            A  +LL+N+ G+ FFR ++ +N   R A   N+ ++  H+ ADS  S G+I ++ L  TL
Sbjct  266  AFVSLLINITGILFFRKHSVMNEKGR-ARHENFMTITSHIFADSCTSVGVIFSALLGSTL  324

Query  594  GVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTE  415
            G++ ++ L   +++  +   V+P+   T  VLLQT P  + +  LN   R+  S   V  
Sbjct  325  GIEISDSLISIIIACIIVYDVLPICLRTGKVLLQTTPQPLVAQ-LNSACRETESIGGVLA  383

Query  414  LFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            L     W    G  +GSI + VK   D++ +L+ VRD ++   +Q+LTVQ+E
Sbjct  384  LKDKHFWTQAHGSYVGSIHVVVKDDCDEQQILKSVRDNFN--FIQNLTVQVE  433



>ref|XP_002110512.1| hypothetical protein TRIADDRAFT_22061 [Trichoplax adhaerens]
 gb|EDV26516.1| hypothetical protein TRIADDRAFT_22061, partial [Trichoplax adhaerens]
Length=678

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 91/169 (54%), Gaps = 4/169 (2%)
 Frame = -2

Query  762  NLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLL-TLGVK  586
             LLVN++G++  R ++     +  + D N H V LHV+AD++ S G+I++S L+ T G  
Sbjct  496  GLLVNMVGIFSLR-HSHFE-AHGHSHDSNMHGVFLHVLADTLGSVGVIVSSLLIQTFGWL  553

Query  585  NAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQ  406
             A+ +C  L+S  +FM V+PL + +  VLL   P       L+   +QV S + V     
Sbjct  554  IADPICSLLISILIFMSVLPLLRQSISVLLLRVPFG-HEQKLSNLLKQVLSVNGVISYQN  612

Query  405  VRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             + W        G++ ++ K   +++ ++  +  ++ DLG++  TVQ+E
Sbjct  613  PQFWRHSSDTIAGTLHVRAKMSANEQSIITRIHAIFKDLGIKYFTVQVE  661



>ref|XP_784123.2| PREDICTED: zinc transporter 5-like [Strongylocentrotus purpuratus]
Length=776

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 83/146 (57%), Gaps = 2/146 (1%)
 Frame = -2

Query  693  KAEDMNYHSVCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFK  517
            +A++ N   V LHV+AD++ S G+I++++L+   G+  A+ +C   +S  + + V PL  
Sbjct  591  QAKNTNMQGVYLHVLADTMGSVGVIISAFLVEHFGLLVADPICSIFISVMILISVAPLLG  650

Query  516  ATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGV  337
             TA +LLQ  PP +    LN+   +V S   V    +   W      A G++ +Q+++  
Sbjct  651  DTAAILLQRIPPELEPG-LNEALFKVQSIKGVLSFRKPHFWRHSGDMATGTLHIQLEQEA  709

Query  336  DDRPVLQYVRDLYHDLGVQDLTVQIE  259
            +++ ++Q +  L+ + G+++ TVQ+E
Sbjct  710  NEQKIIQQITALFKEQGLKNFTVQVE  735



>gb|KFM59856.1| Zinc transporter 7, partial [Stegodyphus mimosarum]
Length=358

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
            H V LH++AD++ S G+I+++ L+   G   A+ +C   +S  +   V+PL K +  VL+
Sbjct  217  HGVFLHILADTLGSVGVIVSAILMNQFGWMIADPICSMFISTLIGFSVLPLLKDSTSVLM  276

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  P  +  S L  C+++V   + V  + + R W +     IG+I L+V    D R +L 
Sbjct  277  QRTPKAL-DSVLPGCYQRVMQLEGVYSVQEPRFWTLCSNVYIGTIKLEVAPTADARYLLS  335

Query  315  YVRDLYHDLGVQDLTVQIE  259
            +  +++  +GV+ L VQI+
Sbjct  336  HTHNIFTQVGVRQLYVQID  354



>ref|XP_001626717.1| predicted protein [Nematostella vectensis]
 gb|EDO34617.1| predicted protein, partial [Nematostella vectensis]
Length=724

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 76/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
            H V LHV+AD++ S G+I +S L+   G+  A+ +C   ++  +F+ V+PL K ++ VLL
Sbjct  561  HGVFLHVVADTLGSVGVIASSILIDQFGLFIADPVCSLFIASLIFLSVLPLLKESSLVLL  620

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  P ++  S L     ++ S D V        W+       G+I +QV     ++ ++Q
Sbjct  621  QRTPLDMEKS-LTGALNKILSFDGVLSFRDHHFWQHSESVVCGTIHVQVAPSASEQKIIQ  679

Query  315  YVRDLYHDLGVQDLTVQIE  259
             V  L+ + GV +L+VQ+E
Sbjct  680  QVTSLFKEYGVNNLSVQVE  698



>ref|XP_004989502.1| zinc transporter 7 [Salpingoeca rosetta]
 gb|EGD78553.1| zinc transporter 7 [Salpingoeca rosetta]
Length=348

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 75/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I +S L+   G   A+ +C   +S  +F+   PL + +  +L+Q 
Sbjct  211  VLLHIMADTLGSVGVIASSLLIHHFGWMIADPICSIFISVLIFVSTWPLLRDSGAILMQR  270

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             P ++  S L  C+R+V   D V        W + P + +GS+S+ +K   +D  V   V
Sbjct  271  TPAHL-ESKLYTCYRRVNHIDGVISYRDPHFWCLSPSYIVGSLSVVIKSEGNDSAVRNEV  329

Query  309  RDLYHDLGVQDLTVQIE  259
              +++D+GV  + VQ+E
Sbjct  330  LRIFNDVGVTKMVVQVE  346



>ref|XP_004637059.1| PREDICTED: zinc transporter 7 [Octodon degus]
Length=328

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 92/181 (51%), Gaps = 11/181 (6%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMN---------YHSVCLHVIADSVRSAGLI  619
            +V   +VNL+G++ F++    +        +             V LH++AD++ S G+I
Sbjct  145  SVLGFVVNLVGIFVFKHGGHGHSHGSDGPSLKETTGPSRQILQGVFLHILADTLGSVGVI  204

Query  618  LASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQ  442
             ++ ++   G+  A+ +C  L++  + + V+PL K + G+L+Q  PP +  +TL  C+++
Sbjct  205  ASAIMMQNFGLMIADPICSILIAILIVVSVIPLLKESVGILMQRTPP-LLENTLPHCYQR  263

Query  441  VASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQI  262
            V +   V  L +   W +     +G++ L V    D R +L    +++   GV+ L VQI
Sbjct  264  VQALQGVYSLQEQHFWTLCSDVYVGTVKLVVAPDADARWILSQTHNIFTQAGVRQLYVQI  323

Query  261  E  259
            +
Sbjct  324  D  324



>ref|XP_005141522.1| PREDICTED: zinc transporter 7 isoform X2 [Melopsittacus undulatus]
Length=376

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  235  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  294

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  295  QRTPPSL-ENTLPQCYQRVQQLQGVYSLHEPHFWTLCTDVYIGTLKLLVAPDADGRWILS  353

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  354  QTHNIFTQAGVRQLYIQID  372



>ref|XP_005141521.1| PREDICTED: zinc transporter 7 isoform X1 [Melopsittacus undulatus]
Length=378

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  237  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  297  QRTPPSL-ENTLPQCYQRVQQLQGVYSLHEPHFWTLCTDVYIGTLKLLVAPDADGRWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  356  QTHNIFTQAGVRQLYIQID  374



>ref|NP_001084857.1| zinc transporter 7-B [Xenopus laevis]
 sp|Q6NRI1.1|ZNT7B_XENLA RecName: Full=Zinc transporter 7-B; Short=ZnT-7-B; AltName: Full=Solute 
carrier family 30 member 7-B [Xenopus laevis]
 gb|AAH70769.1| MGC83798 protein [Xenopus laevis]
Length=390

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  +F+ V+PL K + G+L+Q 
Sbjct  251  VFLHIVADALGSVGVIISTILMQQYGLMIADPICSMLIALLIFVSVIPLLKQSIGILMQR  310

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++    L +C+++V     V  L +   W +     IG++ L +    D R +L   
Sbjct  311  TPPSL-DHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEADARWILSQT  369

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  370  HNIFTQAGVRQLYVQID  386



>ref|NP_989256.1| zinc transporter 7 [Xenopus (Silurana) tropicalis]
 sp|Q6P3N9.1|ZNT7_XENTR RecName: Full=Zinc transporter 7; Short=ZnT-7; AltName: Full=Solute 
carrier family 30 member 7 [Xenopus (Silurana) tropicalis]
 gb|AAH63918.1| solute carrier family 30 (zinc transporter), member 7 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81402.1| solute carrier family 30 (zinc transporter), member 7 [Xenopus 
(Silurana) tropicalis]
Length=390

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  +F+ V+PL K + G+L+Q 
Sbjct  251  VFLHIVADALGSVGVIISTILMQRYGLMIADPICSMLIALLIFVSVIPLLKQSIGILMQR  310

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++    L +C+++V     V  L +   W +     IG++ L +    D R +L   
Sbjct  311  TPPSL-DHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEADARWILSQT  369

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  370  HNIFTQAGVRQLYVQID  386



>gb|AFK10820.1| solute carrier family 30 (zinc transporter), member 7 isoform 
2 [Callorhinchus milii]
Length=383

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L+S  + + V+PL K + G+L+Q 
Sbjct  244  VFLHILADTLGSVGVIISALLMQNYGLMIADPICSMLISFLIGISVIPLLKQSIGILMQR  303

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++  S L +C+++V     V  +     W +     IG+I L V    D R +L   
Sbjct  304  TPPSL-DSILPQCYQRVQHLQGVYSVNDTHFWTLCSDVYIGTIKLLVAPDADARWILSQT  362

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  363  HNVFTQAGVRQLYVQID  379



>ref|NP_001279436.1| solute carrier family 30 (zinc transporter), member 7 [Callorhinchus 
milii]
 gb|AFM89570.1| solute carrier family 30 (zinc transporter), member 7 isoform 
2 [Callorhinchus milii]
Length=383

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L+S  + + V+PL K + G+L+Q 
Sbjct  244  VFLHILADTLGSVGVIISALLMQNYGLMIADPICSMLISFLIGISVIPLLKQSIGILMQR  303

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++  S L +C+++V     V  +     W +     IG+I L V    D R +L   
Sbjct  304  TPPSL-DSILPQCYQRVQHLQGVYSVNDTHFWTLCSDVYIGTIKLLVAPDADARWILSQT  362

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  363  HNVFTQAGVRQLYVQID  379



>ref|XP_002427650.1| Metal tolerance protein C2, putative [Pediculus humanus corporis]
 gb|EEB14912.1| Metal tolerance protein C2, putative [Pediculus humanus corporis]
Length=316

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 90/172 (52%), Gaps = 15/172 (9%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDMNYHSVCLHVIADSVRSAGLILASWLLT-L  595
            +V   LVNLIG++ F++              + HSV LH++AD++ S G+I++S L+   
Sbjct  146  SVLGFLVNLIGIYAFQH-------------GHSHSVFLHILADTLGSVGVIVSSLLMQYF  192

Query  594  GVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTE  415
            G   A+ +C   ++  +   + PL K +  +L+Q  P ++    L +C+ +V     V  
Sbjct  193  GWMIADPICSIFIAILITASIYPLIKDSYMILMQRQPVSL-DHVLPQCYNKVMQLAGVYS  251

Query  414  LFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
            + +   W +     +G I L+V K  D + ++++   ++ ++G++ L VQ++
Sbjct  252  VQEPHFWTLCSNTYVGGIKLEVSKSADHKYIIRHTHMIFAEIGIKQLYVQLD  303



>ref|XP_008404702.1| PREDICTED: zinc transporter 7 [Poecilia reticulata]
Length=225

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = -2

Query  675  YHSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVL  499
            +  V LH+IAD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL K + G+L
Sbjct  83   FAGVLLHIIADTLGSIGVIISALLMQKYDLMIADPICSMLIALLIGVSVVPLLKESIGIL  142

Query  498  LQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVL  319
            +Q  PP++  + L +C+++V     V  L +   W +     IG++ L V    D R +L
Sbjct  143  MQRTPPSL-DNALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADTRWIL  201

Query  318  QYVRDLYHDLGVQDLTVQIEA  256
                +++  +GV+ L VQI+ 
Sbjct  202  SQTHNIFTQVGVRQLYVQIDT  222



>gb|KFQ80471.1| Zinc transporter 7, partial [Phaethon lepturus]
Length=327

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  186  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  245

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  246  QRTPPSL-ENTLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  304

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  305  QTHNIFTQAGVRQLYIQID  323



>ref|XP_010114188.1| PREDICTED: zinc transporter 7, partial [Chlamydotis macqueenii]
Length=331

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  190  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  249

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  250  QRTPPSL-ENTLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  308

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  309  QTHNIFTQAGVRQLYIQID  327



>ref|XP_010290960.1| PREDICTED: zinc transporter 7 [Phaethon lepturus]
Length=331

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  190  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  249

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  250  QRTPPSL-ENTLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  308

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  309  QTHNIFTQAGVRQLYIQID  327



>ref|NP_001089424.1| zinc transporter 7-A [Xenopus laevis]
 sp|Q52KD7.1|ZNT7A_XENLA RecName: Full=Zinc transporter 7-A; Short=ZnT-7-A; AltName: Full=Solute 
carrier family 30 member 7-A [Xenopus laevis]
 gb|AAH94400.1| MGC84982 protein [Xenopus laevis]
Length=386

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  +F+ V+PL K + G+L+Q 
Sbjct  247  VFLHIVADTLGSVGVIFSTILMQRYGLMIADPICSMLIALLIFVSVIPLLKQSIGILMQR  306

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +    L +C+++V     V  L +   W +     IG++ L +    D R +L   
Sbjct  307  TPPAL-DHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEADARWILSQT  365

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  366  HNIFTQAGVRQLYVQID  382



>ref|XP_009014302.1| hypothetical protein HELRODRAFT_98434 [Helobdella robusta]
 gb|ESO07691.1| hypothetical protein HELRODRAFT_98434 [Helobdella robusta]
Length=783

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 76/144 (53%), Gaps = 2/144 (1%)
 Frame = -2

Query  687  EDMNYHSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKAT  511
             + N   V LH++AD++ S G+I+++ L+ T G + A+ LC   +S  +F+ V+PL K T
Sbjct  613  HNTNMEGVFLHILADTLGSVGVIISTILIQTFGWRIADPLCSVFISLLIFVSVLPLVKET  672

Query  510  AGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDD  331
            A +L+   P       L    +++ + D V      R W        G+I +QVK  V +
Sbjct  673  AKILILKTPDE-SMRNLASVLQKLNTMDEVVSYSDERFWRHSASVLCGTIHIQVKPDVAE  731

Query  330  RPVLQYVRDLYHDLGVQDLTVQIE  259
            + ++  +  ++ D+G  +L +QIE
Sbjct  732  QKIVHKITAMFKDIGFNNLCIQIE  755



>ref|XP_011472633.1| PREDICTED: zinc transporter 7 isoform X2 [Oryzias latipes]
Length=316

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH+IAD++ S G+I+++ L+    +  A+ +C  L+S  + + V+PL K + G+L+
Sbjct  175  QGVLLHIIADTLGSVGVIISALLMQKYDLMIADPICSMLISLLIGVSVVPLLKESIGILM  234

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ +S L +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  235  QRTPPSLDNS-LPECYQRVQQLQGVYNLQEPHFWTLCSDVYIGTLKLLVAPDADTRWILS  293

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  294  QTHNIFTQAGVRQLYVQID  312



>ref|XP_001742863.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ93101.1| predicted protein [Monosiga brevicollis MX1]
Length=389

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 74/143 (52%), Gaps = 14/143 (10%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILAS-------WLLTLGVKNAEVLCMGLVSGTVFMLVMPLFKATA  508
            V LHV+AD++ S G+I++S       W++      A+ +C   +S  +F+   PL + + 
Sbjct  252  VLLHVLADTMGSIGVIISSLLIHQYQWMI------ADPICSIFISVLIFVSTWPLLRDSF  305

Query  507  GVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDR  328
             +L+Q  P  +  + L  C+R++   D V        W M   + +G+I++ +K    D 
Sbjct  306  TILMQRTPAKL-DAELYTCYRRINLVDGVISYKDPHFWSMSGDYIVGTITIVIKTNASDT  364

Query  327  PVLQYVRDLYHDLGVQDLTVQIE  259
            P+   V D++  +GV  +TVQIE
Sbjct  365  PIQSAVHDIFRKVGVTQMTVQIE  387



>ref|XP_004068210.1| PREDICTED: zinc transporter 7 isoform X1 [Oryzias latipes]
Length=386

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH+IAD++ S G+I+++ L+    +  A+ +C  L+S  + + V+PL K + G+L+
Sbjct  245  QGVLLHIIADTLGSVGVIISALLMQKYDLMIADPICSMLISLLIGVSVVPLLKESIGILM  304

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ +S L +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  305  QRTPPSLDNS-LPECYQRVQQLQGVYNLQEPHFWTLCSDVYIGTLKLLVAPDADTRWILS  363

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  364  QTHNIFTQAGVRQLYVQID  382



>ref|XP_006882512.1| PREDICTED: zinc transporter 7 [Elephantulus edwardii]
Length=382

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  241  QGVFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILM  300

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  STL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  301  QRTPP-LLESTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  359

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  360  QTHNIFTQAGVRQLYVQID  378



>ref|XP_005388862.1| PREDICTED: zinc transporter 7 [Chinchilla lanigera]
Length=376

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL K + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLKESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL  C+++V     V  L +   W +     +G+I L V    D R +L   
Sbjct  297  TPPTL-ENTLPHCYQRVQELQGVYSLQEQHFWTLCSDVYVGTIKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIEA  256
             +++   GV+ L VQI++
Sbjct  356  HNIFTQAGVRQLYVQIDS  373



>ref|XP_007420311.1| PREDICTED: zinc transporter 7 isoform X2 [Python bivittatus]
Length=306

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  165  EGVFLHILADTLGSIGVIISALLMQNYGLMIADPICSMLIALLIGVSVVPLLRESIGILM  224

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  STL +C+++V     V  L     W +     IG++ L V    D + +L 
Sbjct  225  QRTPPSL-ESTLPQCYQRVQQLQGVYNLHDPHFWTLCTDVYIGTLKLFVAPDADVKWILS  283

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  284  QTHNIFTQAGVRQLYVQID  302



>gb|KFV86877.1| Zinc transporter 7, partial [Struthio camelus australis]
Length=327

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL K + G+L+
Sbjct  186  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSVVPLLKESIGILM  245

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  246  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADARWILS  304

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  305  QTHNIFTQAGVRQLYVQID  323



>ref|XP_009684314.1| PREDICTED: zinc transporter 7 [Struthio camelus australis]
Length=342

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL K + G+L+
Sbjct  201  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSVVPLLKESIGILM  260

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  261  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADARWILS  319

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  320  QTHNIFTQAGVRQLYVQID  338



>ref|XP_004227102.1| PREDICTED: zinc transporter 7-like isoform X2 [Ciona intestinalis]
Length=332

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
            HSV LH++AD++ SAG+I+++ L+   G   A+ +C  ++   + + V+PL + + G+L+
Sbjct  191  HSVFLHILADTLGSAGVIVSTLLMQFFGWMIADPICSLMIGILIAISVIPLLQDSVGILM  250

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  P ++  + L+ C ++V   + V  + +   W +     IG+I +Q+  G +   +  
Sbjct  251  QRTPRSL-DNKLHGCHQRVMQIEGVYRIHEPHFWTLCSDVMIGTIKVQIAPGANPSYIQS  309

Query  315  YVRDLYHDLGVQDLTVQIE  259
             V  +Y  +G++ L VQI+
Sbjct  310  QVHGIYSQVGIRQLYVQID  328



>ref|XP_009580287.1| PREDICTED: zinc transporter 7, partial [Fulmarus glacialis]
Length=331

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  190  QGVFLHIVADTLGSIGVIVSAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  249

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  250  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  308

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++  +GV+ L +QI+
Sbjct  309  QTHNIFTQVGVRQLYIQID  327



>ref|XP_005018821.1| PREDICTED: zinc transporter 7 [Anas platyrhynchos]
Length=335

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  194  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  253

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  254  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  312

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  313  QTHNIFTQAGVRQLYVQID  331



>ref|XP_007062683.1| PREDICTED: zinc transporter 7 [Chelonia mydas]
Length=349

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LHV+AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  210  VFLHVVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGISVVPLLRESIGILMQR  269

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++  S L +C+++V     V  L     W +     IG++ L V    D + +L   
Sbjct  270  TPPSL-ESALPQCYQRVQQLQGVYSLHDPHFWTLCSDVYIGTLKLFVAPDADAKWILSQT  328

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  329  HNIFTQAGVRQLYVQID  345



>ref|XP_008168825.1| PREDICTED: zinc transporter 7 isoform X3 [Chrysemys picta bellii]
Length=310

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  170  GVFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGISVVPLLRESIGILMQ  229

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++ S+ L +C+++V     V  L     W +     IG++ L V    D + +L  
Sbjct  230  RTPPSLESA-LPQCYQRVQQLQGVYSLHDPHFWTLCSDVYIGTLKLFVAPDADAKWILSQ  288

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  289  THNIFTQAGVRQLYVQID  306



>ref|XP_009910536.1| PREDICTED: zinc transporter 7, partial [Haliaeetus albicilla]
Length=326

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  185  QGVFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  244

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  245  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  303

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  304  QTHNIFTQAGVRQLYIQID  322



>ref|XP_005237356.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 7 [Falco peregrinus]
Length=332

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  191  QGVFLHIVADTLGSIGVIISALLMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  250

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  251  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  309

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  310  QTHNIFTQAGVRQLYIQID  328



>ref|XP_003747158.1| PREDICTED: zinc transporter 7-like [Metaseiulus occidentalis]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH+IAD++ S G+I+++ L+   G   A+ +C   ++  + + V PL K +  VL+
Sbjct  252  QGVLLHIIADTMGSVGVIVSAILMQQFGWMIADPICSMFIALLILISVYPLLKESVSVLM  311

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  P  +  + L  C+++VAS D V  +     W +  G  IG++ L+V +  D   +L 
Sbjct  312  QRVPHTL-DNQLQSCFQRVASLDGVYSVQDKHFWTLCSGVYIGNLKLEVARRADLNAILL  370

Query  315  YVRDLYHDLGVQDLTVQIE  259
            +   ++  +GV  L VQ E
Sbjct  371  HTHAIFKQIGVDKLFVQTE  389



>ref|XP_010561929.1| PREDICTED: zinc transporter 7 isoform X1 [Haliaeetus leucocephalus]
Length=380

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  239  QGVFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  298

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  299  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  357

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  358  QTHNIFTQAGVRQLYIQID  376



>ref|XP_005434213.1| PREDICTED: zinc transporter 7, partial [Falco cherrug]
Length=327

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  186  QGVFLHIVADTLGSIGVIISALLMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  245

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  246  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  304

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  305  QTHNIFTQAGVRQLYIQID  323



>ref|XP_007420310.1| PREDICTED: zinc transporter 7 isoform X1 [Python bivittatus]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  235  EGVFLHILADTLGSIGVIISALLMQNYGLMIADPICSMLIALLIGVSVVPLLRESIGILM  294

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  STL +C+++V     V  L     W +     IG++ L V    D + +L 
Sbjct  295  QRTPPSL-ESTLPQCYQRVQQLQGVYNLHDPHFWTLCTDVYIGTLKLFVAPDADVKWILS  353

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  354  QTHNIFTQAGVRQLYVQID  372



>ref|XP_005520996.1| PREDICTED: zinc transporter 7 isoform X2 [Pseudopodoces humilis]
Length=372

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  231  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  290

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  291  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  349

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  350  QTHNIFTQAGVRQLYIQID  368



>ref|XP_004420827.1| PREDICTED: zinc transporter 7 [Ceratotherium simum simum]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L+S  + + V+PL + + GVL+
Sbjct  235  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILISMLIVVSVIPLLRESVGVLM  294

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  295  QRTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  353

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  354  QTHNIFTQAGVRQLYVQID  372



>ref|XP_007115222.1| PREDICTED: zinc transporter 7 isoform X2 [Physeter catodon]
Length=306

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  166  GVFLHIVADTLGSIGVIVSAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQ  225

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     IG++ L V    D R +L  
Sbjct  226  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYIGTLKLVVAPDADARWILSQ  284

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  285  THNIFTQAGVRQLYVQID  302



>ref|XP_010163743.1| PREDICTED: zinc transporter 7, partial [Caprimulgus carolinensis]
Length=330

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  189  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  248

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  249  QRTPPSL-ENVLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADSRWILS  307

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  308  QTHNIFTQAGVRQLYIQID  326



>ref|XP_006977880.1| PREDICTED: zinc transporter 7 [Peromyscus maniculatus bairdii]
Length=382

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  241  QGVFLHILADTLGSVGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILM  300

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  301  QRTPPSL-ENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILS  359

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  360  QTHNIFTQAGVRQLYVQID  378



>ref|XP_002130805.1| PREDICTED: zinc transporter 7-like isoform X1 [Ciona intestinalis]
Length=379

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
            HSV LH++AD++ SAG+I+++ L+   G   A+ +C  ++   + + V+PL + + G+L+
Sbjct  238  HSVFLHILADTLGSAGVIVSTLLMQFFGWMIADPICSLMIGILIAISVIPLLQDSVGILM  297

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  P ++  + L+ C ++V   + V  + +   W +     IG+I +Q+  G +   +  
Sbjct  298  QRTPRSL-DNKLHGCHQRVMQIEGVYRIHEPHFWTLCSDVMIGTIKVQIAPGANPSYIQS  356

Query  315  YVRDLYHDLGVQDLTVQIE  259
             V  +Y  +G++ L VQI+
Sbjct  357  QVHGIYSQVGIRQLYVQID  375



>ref|XP_003512838.1| PREDICTED: zinc transporter 7 [Cricetulus griseus]
 ref|XP_007609592.1| PREDICTED: zinc transporter 7 [Cricetulus griseus]
 gb|EGW10371.1| Zinc transporter 7 [Cricetulus griseus]
 gb|ERE86900.1| zinc transporter 7-like protein [Cricetulus griseus]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  235  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILM  294

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  295  QRTPPSL-ENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLLVAPDADARWILS  353

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  354  QTHNIFTQAGVRQLYVQID  372



>ref|XP_009466567.1| PREDICTED: zinc transporter 7, partial [Nipponia nippon]
Length=323

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  182  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  241

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  242  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  300

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  301  QTHNIFTQAGVRQLYIQID  319



>ref|XP_009990197.1| PREDICTED: zinc transporter 7, partial [Tauraco erythrolophus]
Length=325

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  184  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  243

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  244  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  302

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  303  QTHNIFTQAGVRQLYIQID  321



>sp|Q8H329.2|MTP8_ORYSJ RecName: Full=Metal tolerance protein 8; Short=OsMTP8 [Oryza 
sativa Japonica Group]
Length=316

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 74/147 (50%), Gaps = 2/147 (1%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILASWLLTL-GVKNAEVLCMGLVSGTVFMLVMPLF  520
            R   D N   + LHV+AD++ S G+++++ L+   G   A+ +C   +S  +   V+PL 
Sbjct  167  RHHIDHNMEGIFLHVLADTMGSVGVVISTLLIKYKGWLIADPICSVFISIMIVSSVLPLL  226

Query  519  KATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG  340
            + +A +LLQ  P ++    + +    V     V  +    +W +     +G+  L +   
Sbjct  227  RNSAEILLQRVPRSLEKD-IKEALDDVMKIKGVIGVHNFHVWNLTNTDIVGTFHLHITTE  285

Query  339  VDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             D   + +   D++H+ G+QDLT+QIE
Sbjct  286  ADKSSIREKASDIFHEAGIQDLTIQIE  312



>ref|XP_001488387.1| PREDICTED: zinc transporter 7 [Equus caballus]
 ref|XP_008517010.1| PREDICTED: zinc transporter 7 [Equus przewalskii]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L+S  + + V+PL + + G+L+
Sbjct  235  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILISMLIVISVIPLLRESVGILM  294

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  295  QRTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  353

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  354  QTHNIFTQAGVRQLYVQID  372



>ref|XP_005520995.1| PREDICTED: zinc transporter 7 isoform X1 [Pseudopodoces humilis]
Length=378

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  237  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  297  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  356  QTHNIFTQAGVRQLYIQID  374



>ref|XP_001381878.1| PREDICTED: zinc transporter 7 [Monodelphis domestica]
Length=382

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL K + G+L+Q 
Sbjct  243  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIALLIVVSVIPLLKESVGILMQR  302

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++ S+ L +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  303  TPPSLESA-LPQCYQRVLQLQGVYHLQEQHFWTLCTDVFVGTLKLVVAPDADSRWILSQT  361

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  362  HNIFTQAGVRQLYVQID  378



>ref|XP_005422162.1| PREDICTED: zinc transporter 7 [Geospiza fortis]
Length=308

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  167  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  226

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  227  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  285

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  286  QTHNIFTQAGVRQLYIQID  304



>ref|XP_009936299.1| PREDICTED: zinc transporter 7 [Opisthocomus hoazin]
Length=328

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  187  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  246

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  247  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  305

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  306  QTHNIFTQAGVRQLYIQID  324



>ref|XP_007115221.1| PREDICTED: zinc transporter 7 isoform X1 [Physeter catodon]
Length=376

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHIVADTLGSIGVIVSAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     IG++ L V    D R +L  
Sbjct  296  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYIGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_009563777.1| PREDICTED: zinc transporter 7 [Cuculus canorus]
Length=341

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  200  QGVFLHIVADTLGSIGVIISALLMQNYGLMIADPICSMLIAILIGVSIVPLLKESIGILM  259

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  260  QRTPPSL-ENVLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  318

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  319  QTHNIFTQAGVRQLYIQID  337



>ref|XP_009697376.1| PREDICTED: zinc transporter 7 [Cariama cristata]
Length=356

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  215  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  274

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  275  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  333

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  334  QTHNIFTQAGVRQLYVQID  352



>ref|XP_009903666.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 7 [Picoides 
pubescens]
Length=380

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  239  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  298

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  299  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  357

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  358  QTHNIFTQAGVRQLYIQID  376



>ref|XP_005300950.1| PREDICTED: zinc transporter 7 isoform X2 [Chrysemys picta bellii]
Length=380

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  241  VFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGISVVPLLRESIGILMQR  300

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++  S L +C+++V     V  L     W +     IG++ L V    D + +L   
Sbjct  301  TPPSL-ESALPQCYQRVQQLQGVYSLHDPHFWTLCSDVYIGTLKLFVAPDADAKWILSQT  359

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  360  HNIFTQAGVRQLYVQID  376



>ref|XP_005482090.1| PREDICTED: zinc transporter 7 isoform X4 [Zonotrichia albicollis]
Length=340

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q
Sbjct  200  GVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQ  259

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L  
Sbjct  260  RTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQ  318

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L +QI+
Sbjct  319  THNIFTQAGVRQLYIQID  336



>ref|NP_075703.1| zinc transporter 7 [Mus musculus]
 sp|Q9JKN1.1|ZNT7_MOUSE RecName: Full=Zinc transporter 7; Short=ZnT-7; AltName: Full=Solute 
carrier family 30 member 7; AltName: Full=Znt-like transporter 
2 [Mus musculus]
 gb|AAF43423.1|AF233322_1 zinc transporter like 2 [Mus musculus]
 dbj|BAB26639.1| unnamed protein product [Mus musculus]
 gb|AAH17136.1| Solute carrier family 30 (zinc transporter), member 7 [Mus musculus]
 dbj|BAC35970.1| unnamed protein product [Mus musculus]
 gb|AAO17323.1| zinc transporter ZnT7 [Mus musculus]
 gb|EDL12392.1| solute carrier family 30 (zinc transporter), member 7 [Mus musculus]
Length=378

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  237  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  297  QRTPPSL-ENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  356  QTHNIFTQAGVRQLYVQID  374



>gb|KFW79594.1| Zinc transporter 7, partial [Manacus vitellinus]
Length=325

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q 
Sbjct  186  VFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQR  245

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L   
Sbjct  246  TPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQT  304

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L +QI+
Sbjct  305  HNIFTQAGVRQLYIQID  321



>gb|KFW02735.1| Zinc transporter 7, partial [Eurypyga helias]
Length=324

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  183  QGVFLHIVADTLGSIGVIVSAVLMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  242

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  243  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  301

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  302  QTHNIFTQAGVRQLYVQID  320



>ref|XP_010407798.1| PREDICTED: zinc transporter 7, partial [Corvus cornix cornix]
Length=323

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  182  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  241

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  242  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  300

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  301  QTHNIFTQAGVRQLYIQID  319



>ref|XP_006762999.1| PREDICTED: zinc transporter 7 isoform X2 [Myotis davidii]
Length=378

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 76/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + GVL+
Sbjct  237  QGVFLHILADTLGSIGVIVSALLMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGVLM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +    L +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  297  QRTPPQL-EGALPQCYQRVQHLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADTRWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  356  QTHNIFTQAGVRQLYVQID  374



>ref|XP_008263034.1| PREDICTED: zinc transporter 7 [Oryctolagus cuniculus]
Length=376

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL K + GVL+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIALLIVVSVIPLLKESVGVLMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++  +GV+ L VQI+
Sbjct  356  HNIFTQVGVRQLYVQID  372



>gb|KFO56526.1| Zinc transporter 7, partial [Corvus brachyrhynchos]
Length=322

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  181  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  240

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  241  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  299

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  300  QTHNIFTQAGVRQLYIQID  318



>ref|XP_005808439.1| PREDICTED: zinc transporter 7-like [Xiphophorus maculatus]
Length=393

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH+IAD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL K + G+L+
Sbjct  252  QGVLLHIIADTLGSIGVIISALLMQKYDLMIADPICSMLIALLIGVSVVPLLKESIGILM  311

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  312  QRTPPSL-DNALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADTRWILS  370

Query  315  YVRDLYHDLGVQDLTVQIEA  256
               +++  +GV+ L VQI+ 
Sbjct  371  QTHNIFTQVGVRQLYVQIDT  390



>ref|XP_006165035.1| PREDICTED: zinc transporter 7 [Tupaia chinensis]
Length=376

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  235  QGVFLHILADTLGSVGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILM  294

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  295  QRTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  353

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  354  QTHNIFTQAGVRQLYVQID  372



>ref|XP_006762998.1| PREDICTED: zinc transporter 7 isoform X1 [Myotis davidii]
 gb|ELK30726.1| Zinc transporter 7 [Myotis davidii]
Length=380

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 76/138 (55%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + GVL+Q
Sbjct  240  GVFLHILADTLGSIGVIVSALLMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGVLMQ  299

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +    L +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  300  RTPPQL-EGALPQCYQRVQHLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADTRWILSQ  358

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  359  THNIFTQAGVRQLYVQID  376



>ref|XP_008695869.1| PREDICTED: zinc transporter 7 [Ursus maritimus]
Length=376

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  STL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-VLESTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>gb|KFQ05347.1| Zinc transporter 7, partial [Leptosomus discolor]
Length=321

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  180  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  239

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  240  QRTPPSL-ENVLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  298

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  299  QTHNIFTQAGVRQLYIQID  317



>ref|XP_009965043.1| PREDICTED: zinc transporter 7 [Tyto alba]
Length=325

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  184  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  243

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  244  QRTPPSL-ENILPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  302

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  303  QTHNIFTQAGVRQLYIQID  321



>ref|XP_010298478.1| PREDICTED: zinc transporter 7 [Balearica regulorum gibbericeps]
Length=331

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  190  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  249

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  250  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  308

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  309  QTHNIFTQAGVRQLYIQID  327



>ref|XP_004176257.1| PREDICTED: zinc transporter 7 [Taeniopygia guttata]
Length=308

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q
Sbjct  168  GVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQ  227

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L  
Sbjct  228  RTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQ  286

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L +QI+
Sbjct  287  THNIFTQAGVRQLYIQID  304



>ref|XP_007169579.1| PREDICTED: zinc transporter 7 isoform X1 [Balaenoptera acutorostrata 
scammoni]
Length=376

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIVSAIMMQNFGLMIADPICSILIAMLIVLSVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADTRWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_002928201.1| PREDICTED: zinc transporter 7 isoform X2 [Ailuropoda melanoleuca]
Length=376

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  STL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-VLESTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_010147218.1| PREDICTED: zinc transporter 7 [Eurypyga helias]
Length=341

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  200  QGVFLHIVADTLGSIGVIVSAVLMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  259

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  260  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  318

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  319  QTHNIFTQAGVRQLYVQID  337



>ref|XP_005482089.1| PREDICTED: zinc transporter 7 isoform X3 [Zonotrichia albicollis]
Length=372

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  231  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  290

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  291  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  349

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  350  QTHNIFTQAGVRQLYIQID  368



>ref|XP_010141892.1| PREDICTED: zinc transporter 7, partial [Buceros rhinoceros silvestris]
Length=325

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q
Sbjct  185  GVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQ  244

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L  
Sbjct  245  RTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQ  303

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L +QI+
Sbjct  304  THNIFTQAGVRQLYIQID  321



>gb|KFV50673.1| Zinc transporter 7, partial [Tyto alba]
Length=321

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  180  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  239

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  240  QRTPPSL-ENILPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  298

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  299  QTHNIFTQAGVRQLYIQID  317



>ref|XP_008920519.1| PREDICTED: zinc transporter 7 [Manacus vitellinus]
Length=339

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q 
Sbjct  200  VFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQR  259

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L   
Sbjct  260  TPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQT  318

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L +QI+
Sbjct  319  HNIFTQAGVRQLYIQID  335



>ref|XP_006119869.1| PREDICTED: zinc transporter 7 isoform X1 [Pelodiscus sinensis]
Length=380

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  239  EGVFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGVSVVPLLRESIGILM  298

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  S L +C+++V   + V  L     W +     IG++ L V    D R +L 
Sbjct  299  QRTPPSL-ESVLPQCYQRVGLLEGVYSLHDPHFWTLCTDVYIGTLKLFVAPDADARWILS  357

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +Q++
Sbjct  358  QTHNIFTQAGVRQLYIQLD  376



>ref|XP_007569501.1| PREDICTED: zinc transporter 7 [Poecilia formosa]
Length=402

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH+IAD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL K + G+L+
Sbjct  261  QGVLLHIIADTLGSIGVIISALLMQKYDLMIADPICSMLIALLIGVSVVPLLKESIGILM  320

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  321  QRTPPSL-DNALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADTRWILS  379

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++  +GV+ L VQI+
Sbjct  380  QTHNIFTQVGVRQLYVQID  398



>ref|XP_010074039.1| PREDICTED: zinc transporter 7 [Pterocles gutturalis]
Length=367

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  226  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  285

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  286  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  344

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  345  QTHNIFTQAGVRQLYIQID  363



>ref|XP_003784157.1| PREDICTED: zinc transporter 7 [Otolemur garnettii]
Length=380

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  239  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILM  298

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  299  QRTPPML-ENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  357

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  358  QTHNIFTQAGVRQLYVQID  376



>ref|NP_001061826.1| Os08g0422200 [Oryza sativa Japonica Group]
 gb|AAP74355.1| putative cation transport protein OCT [Oryza sativa Japonica 
Group]
 dbj|BAF23740.1| Os08g0422200, partial [Oryza sativa Japonica Group]
Length=225

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 74/147 (50%), Gaps = 2/147 (1%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILASWLLTL-GVKNAEVLCMGLVSGTVFMLVMPLF  520
            R   D N   + LHV+AD++ S G+++++ L+   G   A+ +C   +S  +   V+PL 
Sbjct  76   RHHIDHNMEGIFLHVLADTMGSVGVVISTLLIKYKGWLIADPICSVFISIMIVSSVLPLL  135

Query  519  KATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG  340
            + +A +LLQ  P ++    + +    V     V  +    +W +     +G+  L +   
Sbjct  136  RNSAEILLQRVPRSLEKD-IKEALDDVMKIKGVIGVHNFHVWNLTNTDIVGTFHLHITTE  194

Query  339  VDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             D   + +   D++H+ G+QDLT+QIE
Sbjct  195  ADKSSIREKASDIFHEAGIQDLTIQIE  221



>ref|XP_009807088.1| PREDICTED: zinc transporter 7 [Gavia stellata]
Length=386

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  245  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  304

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  305  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  363

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  364  QTHNIFTQAGVRQLYIQID  382



>ref|XP_002187573.1| PREDICTED: zinc transporter 7 isoform 2 [Taeniopygia guttata]
Length=378

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q
Sbjct  238  GVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQ  297

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L  
Sbjct  298  RTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQ  356

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L +QI+
Sbjct  357  THNIFTQAGVRQLYIQID  374



>ref|XP_010561930.1| PREDICTED: zinc transporter 7 isoform X2 [Haliaeetus leucocephalus]
Length=370

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  229  QGVFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  288

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  289  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  347

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  348  QTHNIFTQAGVRQLYIQID  366



>ref|XP_005482087.1| PREDICTED: zinc transporter 7 isoform X1 [Zonotrichia albicollis]
Length=378

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q 
Sbjct  239  VFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQR  298

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L   
Sbjct  299  TPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQT  357

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L +QI+
Sbjct  358  HNIFTQAGVRQLYIQID  374



>gb|KFP86270.1| Zinc transporter 7 [Apaloderma vittatum]
Length=343

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  202  QGVFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  261

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     +G++ L V    D R +L 
Sbjct  262  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYVGTLKLLVAPDADGRWILS  320

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  321  QTHNIFTQAGVRQLYIQID  339



>gb|AAH50193.1| Solute carrier family 30 (zinc transporter), member 7 [Mus musculus]
Length=378

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I +  ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  237  QGVFLHILADTLGSIGVIASGIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  297  QRTPPSL-ENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  356  QTHNIFTQAGVRQLYVQID  374



>ref|NP_001008788.1| zinc transporter 7 [Gallus gallus]
 sp|Q5MNV6.1|ZNT7_CHICK RecName: Full=Zinc transporter 7; Short=ZnT-7; AltName: Full=Solute 
carrier family 30 member 7 [Gallus gallus]
 gb|AAV98202.1| zinc transporter 7 [Gallus gallus]
Length=378

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q
Sbjct  238  GVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQ  297

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L  
Sbjct  298  RTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQ  356

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L +QI+
Sbjct  357  THNIFTQAGVRQLYIQID  374



>ref|XP_004263136.1| PREDICTED: zinc transporter 7 [Orcinus orca]
 ref|XP_004313105.1| PREDICTED: zinc transporter 7 [Tursiops truncatus]
Length=376

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIVSAIMMQNFGLMIADPICSILIAMLIVLSVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_009865024.1| PREDICTED: zinc transporter 7 [Apaloderma vittatum]
Length=335

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  194  QGVFLHIVADTLGSVGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  253

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     +G++ L V    D R +L 
Sbjct  254  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYVGTLKLLVAPDADGRWILS  312

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  313  QTHNIFTQAGVRQLYIQID  331



>ref|XP_008941274.1| PREDICTED: zinc transporter 7, partial [Merops nubicus]
Length=378

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  237  QGVFLHIVADTLGSIGVIVSAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  297  QRTPPSL-ENLLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  356  QTHNIFTQAGVRQLYVQID  374



>gb|KGL76611.1| Zinc transporter 7, partial [Tinamus guttatus]
Length=322

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL K + G+L+
Sbjct  181  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSVVPLLKESIGILM  240

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  241  QRTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADARWILS  299

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQ++
Sbjct  300  QTHNIFTQAGVRQLYVQMD  318



>ref|XP_003479224.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 7 [Cavia porcellus]
Length=380

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 76/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL K + G+L+
Sbjct  239  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLKESVGILM  298

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  +TL  C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  299  QRTPPML-ENTLPHCYQRVQELQGVYSLQEQHFWTLCSDVYVGTVKLVVAPDADARWILS  357

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  358  QTHNIFTQAGVRQLYVQID  376



>ref|XP_009960056.1| PREDICTED: zinc transporter 7, partial [Leptosomus discolor]
Length=381

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  240  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  299

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  300  QRTPPSL-ENVLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  358

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  359  QTHNIFTQAGVRQLYIQID  377



>ref|XP_008628696.1| PREDICTED: zinc transporter 7 [Corvus brachyrhynchos]
Length=367

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  226  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  285

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  286  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  344

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  345  QTHNIFTQAGVRQLYIQID  363



>ref|XP_008283577.1| PREDICTED: zinc transporter 7 isoform X2 [Stegastes partitus]
Length=327

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 2/147 (1%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLF  520
            + A       V LH+IAD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL 
Sbjct  178  KGASKQILQGVLLHIIADTLGSIGVIISALLMQKYELMIADPICSMLIALLIGVSVVPLL  237

Query  519  KATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG  340
            K + G+L+Q  PP++    L +C+++V     V  L +   W +     IG++ L V   
Sbjct  238  KESIGILMQRTPPSL-DHALPECYQRVQRLQGVYNLHEPHFWTLCTDVYIGTLKLLVAPD  296

Query  339  VDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             D R +L    +++   GV+ L VQIE
Sbjct  297  ADTRWILSQSHNIFTQAGVRQLYVQIE  323



>ref|XP_005339748.1| PREDICTED: zinc transporter 7 [Ictidomys tridecemlineatus]
Length=376

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL K + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLKESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>dbj|BAP46877.1| solute carrier family 30 member 7-1 [Cyprinus carpio]
Length=388

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL + + G+L+
Sbjct  247  QGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRESIGILM  306

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++   TL +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  307  QRTPPSL-DHTLPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSRWILS  365

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++  +GV+ L VQI+
Sbjct  366  QTHNIFTQVGVRQLYVQID  384



>ref|XP_009883216.1| PREDICTED: zinc transporter 7 [Charadrius vociferus]
Length=400

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  259  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  318

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  319  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  377

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  378  QTHNIFTQAGVRQLYIQID  396



>ref|XP_008283576.1| PREDICTED: zinc transporter 7 isoform X1 [Stegastes partitus]
Length=397

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 2/147 (1%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLF  520
            + A       V LH+IAD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL 
Sbjct  248  KGASKQILQGVLLHIIADTLGSIGVIISALLMQKYELMIADPICSMLIALLIGVSVVPLL  307

Query  519  KATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG  340
            K + G+L+Q  PP++    L +C+++V     V  L +   W +     IG++ L V   
Sbjct  308  KESIGILMQRTPPSL-DHALPECYQRVQRLQGVYNLHEPHFWTLCTDVYIGTLKLLVAPD  366

Query  339  VDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             D R +L    +++   GV+ L VQIE
Sbjct  367  ADTRWILSQSHNIFTQAGVRQLYVQIE  393



>ref|XP_007934300.1| PREDICTED: zinc transporter 7 [Orycteropus afer afer]
Length=376

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_005878599.1| PREDICTED: zinc transporter 7 isoform X2 [Myotis brandtii]
Length=340

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 75/139 (54%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + GVL+
Sbjct  199  QGVFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGVLM  258

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +    L +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  259  QRTPPQL-EGALPQCYQRVQHLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADTRWILS  317

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  318  QTHNIFTQAGVRQLYVQID  336



>ref|XP_004883474.1| PREDICTED: zinc transporter 7 [Heterocephalus glaber]
 ref|XP_004869196.1| PREDICTED: zinc transporter 7 [Heterocephalus glaber]
Length=376

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 75/138 (54%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  +   V+PL K + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVASVIPLLKESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL  C+++V     V  L +   W +     IG++ L V    D R +L  
Sbjct  296  RTPPML-ENTLPHCYQRVQELQGVYSLQEQHFWTLCSDVYIGTVKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|NP_001093556.1| zinc transporter 7 [Danio rerio]
 sp|A5PMX1.1|ZNT7_DANRE RecName: Full=Zinc transporter 7; Short=ZnT-7; AltName: Full=Solute 
carrier family 30 member 7 [Danio rerio]
Length=387

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL + + G+L+
Sbjct  246  QGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRESIGILM  305

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++    L +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  306  QRTPPSL-DHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSRWILS  364

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++  +GV+ L VQIE
Sbjct  365  QTHNIFTQVGVRQLYVQIE  383



>ref|XP_009500259.1| PREDICTED: zinc transporter 7 [Phalacrocorax carbo]
Length=402

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  261  QGVFLHIVADTLGSIGVIVSAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  320

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  321  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  379

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  380  QTHNIFTQAGVRQLYIQID  398



>gb|AAI54235.1| Solute carrier family 30 (zinc transporter), member 7 [Danio 
rerio]
Length=387

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL + + G+L+
Sbjct  246  QGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRESIGILM  305

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++    L +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  306  QRTPPSL-DHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSRWILS  364

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++  +GV+ L VQIE
Sbjct  365  QTHNIFTQVGVRQLYVQIE  383



>gb|AAH44151.1| Solute carrier family 30 (zinc transporter), member 7 [Danio 
rerio]
 gb|AAI64782.1| Slc30a7 protein [Danio rerio]
Length=387

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL + + G+L+
Sbjct  246  QGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRESIGILM  305

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++    L +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  306  QRTPPSL-DHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSRWILS  364

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++  +GV+ L VQIE
Sbjct  365  QTHNIFTQVGVRQLYVQIE  383



>ref|XP_006191009.1| PREDICTED: zinc transporter 7 [Camelus ferus]
 ref|XP_006197432.1| PREDICTED: zinc transporter 7 [Vicugna pacos]
 ref|XP_010948757.1| PREDICTED: zinc transporter 7 [Camelus bactrianus]
 ref|XP_010973423.1| PREDICTED: zinc transporter 7 [Camelus dromedarius]
Length=376

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  235  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILM  294

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  295  QRTPPFL-ENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLLVAPDADARWILS  353

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  354  QTHNIFTQAGVRQLYVQID  372



>ref|XP_007449681.1| PREDICTED: zinc transporter 7 [Lipotes vexillifer]
Length=376

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIVSAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>gb|ENN78166.1| hypothetical protein YQE_05319, partial [Dendroctonus ponderosae]
 gb|ERL92450.1| hypothetical protein D910_09764 [Dendroctonus ponderosae]
Length=347

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLLTL-GVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+ + G   A+ +C   ++  + + V+ L K +  VL+Q 
Sbjct  208  VFLHILADTLGSVGVIISAVLMQMFGWMIADPICSMFIAVLIALSVLALIKDSVAVLMQR  267

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             P ++  S L +C+++V S   V  + +   W +     +G+I L+V K VD + V+Q+ 
Sbjct  268  QPYSL-DSVLPQCYQKVISLAGVYSVQEPHFWTLCSNVYVGAIKLEVSKNVDPKYVVQHT  326

Query  309  RDLYHDLGVQDLTVQIE  259
            + ++  +GV+ L VQ++
Sbjct  327  QMIFASVGVKQLYVQLD  343



>ref|XP_005878598.1| PREDICTED: zinc transporter 7 isoform X1 [Myotis brandtii]
Length=378

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 75/139 (54%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + GVL+
Sbjct  237  QGVFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGVLM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +    L +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  297  QRTPPQL-EGALPQCYQRVQHLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADTRWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  356  QTHNIFTQAGVRQLYVQID  374



>ref|XP_004775230.1| PREDICTED: zinc transporter 7 [Mustela putorius furo]
 ref|XP_004812222.1| PREDICTED: zinc transporter 7 [Mustela putorius furo]
Length=376

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-VLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_005482088.1| PREDICTED: zinc transporter 7 isoform X2 [Zonotrichia albicollis]
Length=368

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q 
Sbjct  229  VFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQR  288

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L   
Sbjct  289  TPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQT  347

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L +QI+
Sbjct  348  HNIFTQAGVRQLYIQID  364



>ref|XP_008049279.1| PREDICTED: zinc transporter 7 [Tarsius syrichta]
Length=376

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSVGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_005678094.1| PREDICTED: zinc transporter 7 [Capra hircus]
Length=376

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-VLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_006015046.1| PREDICTED: zinc transporter 7, partial [Alligator sinensis]
Length=320

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH+IAD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  181  VLLHIIADTLGSVGVIISALLMQNYGLMIADPICSMLIALLIGISVVPLLRESIGILMQR  240

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  + L +C+++V     V  L     W +     IG++ L V    D + +L   
Sbjct  241  TPPPL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLFVAPDADAKWILSQT  299

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  300  HNIFTQAGVRQLYVQID  316



>ref|XP_011454602.1| PREDICTED: zinc transporter 7-like [Crassostrea gigas]
Length=266

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 75/140 (54%), Gaps = 2/140 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I++S L+   G   A+ LC   ++  V + V+PL + + G+L+
Sbjct  125  QGVFLHILADTLGSVGVIISSLLIYYFGWMIADPLCSMFIAVLVTISVLPLLRDSVGILM  184

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  P  +    L  C+++V+  + V  + +   W +     IG+I L+V    D R +L 
Sbjct  185  QRTPREL-DHVLPGCYQRVSQLEGVYSVQEPHFWTLCSEVYIGTIKLEVAMNADTRYILS  243

Query  315  YVRDLYHDLGVQDLTVQIEA  256
               +++   GV+ L VQI+ 
Sbjct  244  QTHNIFTQAGVRQLYVQIDT  263



>ref|XP_006103697.1| PREDICTED: zinc transporter 7 isoform X2 [Myotis lucifugus]
Length=340

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 75/139 (54%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + GVL+
Sbjct  199  QGVFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAILIVVSVIPLLRESVGVLM  258

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +    L +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  259  QRTPPKL-EGALPQCYQRVQHLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADTRWILS  317

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  318  QTHNIFTQAGVRQLYVQID  336



>ref|XP_004699282.1| PREDICTED: zinc transporter 7 [Echinops telfairi]
Length=378

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  237  QGVFLHILADTLGSLGVIASAILMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP + +S L +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  297  QRTPPLLENS-LPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  356  QTHNIFTQAGVRQLYVQID  374



>ref|XP_006273785.1| PREDICTED: zinc transporter 7 [Alligator mississippiensis]
Length=378

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH+IAD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  239  VLLHIIADTLGSVGVIISALLMQNYGLMIADPICSMLIALLIGISVVPLLRESIGILMQR  298

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  + L +C+++V     V  L     W +     IG++ L V    D + +L   
Sbjct  299  TPPPL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLFVAPDADAKWILSQT  357

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  358  HNIFTQAGVRQLYVQID  374



>ref|XP_001375558.1| PREDICTED: zinc transporter 10 [Monodelphis domestica]
Length=475

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 87/157 (55%), Gaps = 15/157 (10%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILAS---WLLTLGVKNAEV--LCMGLVSGTVFMLV  532
            +K+E +N   V LHV+ D++ S  +++A+   ++L L V NA     C    S T+ M++
Sbjct  225  KKSEALNIRGVLLHVMGDALGSVVVVIAAIIFYVLPLDV-NAPCNWQCYIDPSLTIIMVI  283

Query  531  M------PLFKATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAI  370
            +      PL K TA +LLQ  P  I    L +   ++++   V  + +V +WE+V G  I
Sbjct  284  IILSSAFPLIKETASILLQMVPKGI---NLEELVSKLSNVAGVNSIHEVHVWELVSGKNI  340

Query  369  GSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             ++ ++ +KG D R     +R+++H +G+ ++T+Q E
Sbjct  341  ATLHIKCQKGKDYRDANFKMREIFHSVGIHNVTIQPE  377



>ref|XP_010212032.1| PREDICTED: zinc transporter 7 [Tinamus guttatus]
Length=357

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL K + G+L+
Sbjct  216  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSVVPLLKESIGILM  275

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  276  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADARWILS  334

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQ++
Sbjct  335  QTHNIFTQAGVRQLYVQMD  353



>ref|XP_005978831.1| PREDICTED: zinc transporter 7 [Pantholops hodgsonii]
Length=376

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_009645830.1| PREDICTED: zinc transporter 7 [Egretta garzetta]
Length=477

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  336  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  395

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  396  QRTPPSL-ENVLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  454

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  455  QTHNIFTQAGVRQLYIQID  473



>ref|XP_010829271.1| PREDICTED: zinc transporter 7 [Bison bison bison]
Length=376

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|NP_001077229.1| zinc transporter 7 [Bos taurus]
 ref|XP_005906344.1| PREDICTED: zinc transporter 7 [Bos mutus]
 ref|XP_006049879.1| PREDICTED: zinc transporter 7 isoform X1 [Bubalus bubalis]
 sp|A4IFD7.1|ZNT7_BOVIN RecName: Full=Zinc transporter 7; Short=ZnT-7; AltName: Full=Solute 
carrier family 30 member 7 [Bos taurus]
 gb|AAI34532.1| SLC30A7 protein [Bos taurus]
 tpg|DAA31492.1| TPA: zinc transporter 7 [Bos taurus]
 gb|ELR48679.1| Zinc transporter 7 [Bos mutus]
Length=376

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_006103696.1| PREDICTED: zinc transporter 7 isoform X1 [Myotis lucifugus]
Length=378

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 75/139 (54%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + GVL+
Sbjct  237  QGVFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAILIVVSVIPLLRESVGVLM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +    L +C+++V     V  L +   W +     +G++ L V    D R +L 
Sbjct  297  QRTPPKL-EGALPQCYQRVQHLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADTRWILS  355

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  356  QTHNIFTQAGVRQLYVQID  374



>ref|XP_004401522.1| PREDICTED: zinc transporter 7 [Odobenus rosmarus divergens]
Length=376

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-VLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_009057902.1| hypothetical protein LOTGIDRAFT_209561 [Lottia gigantea]
 gb|ESO91197.1| hypothetical protein LOTGIDRAFT_209561 [Lottia gigantea]
Length=342

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 78/145 (54%), Gaps = 2/145 (1%)
 Frame = -2

Query  690  AEDMNYHSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKA  514
            A+      V LH++AD++ S G+I++S L+   G   A+ +C   ++  + + V+PL + 
Sbjct  195  AQSQIMEGVFLHILADTLGSVGVIVSSVLIHYFGWMIADPICSMFIAVLIGISVLPLIRD  254

Query  513  TAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVD  334
            + G+L+Q  P  I  S L+ C+ +V   + V  + +   W +     +G+I L+V    D
Sbjct  255  SVGILMQRTPKQIEHS-LSGCYSRVNQLEGVYSVQEPHFWTLCSDVYVGTIKLEVSSKAD  313

Query  333  DRPVLQYVRDLYHDLGVQDLTVQIE  259
             + +L    +++  +GV+ L VQI+
Sbjct  314  AKYILSSTHNIFTQIGVRQLYVQID  338



>ref|XP_007093685.1| PREDICTED: zinc transporter 7 [Panthera tigris altaica]
Length=376

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-VLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|NP_001157070.1| zinc transporter 7 [Ovis aries]
 gb|ACT34185.1| SLC30A7 [Ovis aries]
Length=376

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_005498830.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 7 [Columba livia]
Length=377

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 76/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL + + G+L+
Sbjct  236  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIAILIGVSIVPLLRESIGILM  295

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++    L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  296  QRTPPSL-EKVLPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  354

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  355  QTHNIFTQAGVRQLYIQID  373



>ref|XP_003990418.1| PREDICTED: zinc transporter 7 [Felis catus]
Length=376

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  236  GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQ  295

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  296  RTPP-VLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  354

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  355  THNIFTQAGVRQLYVQID  372



>ref|XP_001647887.1| AAEL000077-PA [Aedes aegypti]
 gb|EAT48944.1| AAEL000077-PA [Aedes aegypti]
Length=371

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLLTL-GVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+ L G   A+ +C   ++ T+ +  + L K +  VL+Q 
Sbjct  232  VFLHILADTLGSVGVIISAVLMQLFGWMRADPICSMFIALTIGLSTLSLIKESVMVLMQR  291

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             P  +    L +C+++V     V  + +   W +     +G+I L+V K VD R V+Q+ 
Sbjct  292  QPVGL-DRVLPQCYQKVTGLAGVYSVQEPHFWTLCSEVYVGAIKLEVSKNVDPRYVVQHT  350

Query  309  RDLYHDLGVQDLTVQIE  259
            R ++  +GV+ + +Q++
Sbjct  351  RMIFEAIGVRQIYIQLD  367



>ref|XP_006919630.1| PREDICTED: zinc transporter 7 [Pteropus alecto]
 ref|XP_011366579.1| PREDICTED: zinc transporter 7 [Pteropus vampyrus]
Length=378

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  237  QGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILM  296

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP +  +TL +C+++V     V  L     W +     +G++ L V    D R +L 
Sbjct  297  QRTPP-LLENTLPQCYQRVQQLQGVYSLQDQHFWTLCSDVYVGTLKLVVAPDADARWILS  355

Query  315  YVRDLYHDLGVQDLTVQIEA  256
               +++   GV+ L VQI++
Sbjct  356  QTHNIFTQAGVRQLYVQIDS  375



>ref|XP_009281503.1| PREDICTED: zinc transporter 7 [Aptenodytes forsteri]
Length=332

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL + + G+L+Q
Sbjct  192  GVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLRESIGILMQ  251

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++ ++ L +C+++V     V  L     W +     IG++ L V    D R +L  
Sbjct  252  RTPPSLENA-LPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQ  310

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L +QI+
Sbjct  311  THNIFTQAGVRQLYIQID  328



>ref|XP_004354504.1| putative zinc transporter [Dictyostelium fasciculatum]
 gb|EGG15757.1| putative zinc transporter [Dictyostelium fasciculatum]
Length=506

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 102/196 (52%), Gaps = 31/196 (16%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYARINLVYRKAEDM-------------------NYHSVCLHVI  649
            A+ +L++N++G+ FFR ++  +   +K++D+                   N+ ++  H+I
Sbjct  252  ALFSLVINVVGILFFRQHSLKHSNNKKSDDIGNNSNNYRNMIYNDRIRQDNFVTIFTHII  311

Query  648  ADSVRSAGLILASWLLTL-GVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAP----  484
             DS  S G+IL++ L  L G   ++ L   +++  +   V+P+ K TA VLLQT P    
Sbjct  312  VDSCTSLGVILSTLLSQLFGFDLSDSLISIIIAFIIIYQVIPICKRTAFVLLQTTPDAIA  371

Query  483  PNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG-VDDRPVLQYVR  307
            P I S+ L     +V++   V ++     W    G+ +GS+ + VK   V+ + +L+ +R
Sbjct  372  PQIKSANL-----KVSTMHGVVKIGDSHFWTQSQGNTVGSMVVYVKDDKVNQQALLKEIR  426

Query  306  DLYHDLGVQDLTVQIE  259
             LY    V D+T+QI+
Sbjct  427  TLYTSF-VNDITIQIQ  441



>ref|XP_537050.3| PREDICTED: zinc transporter 7 [Canis lupus familiaris]
Length=376

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_004385784.1| PREDICTED: zinc transporter 7 [Trichechus manatus latirostris]
Length=376

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
              ++   GV+ L VQI+
Sbjct  356  HSIFTQAGVRQLYVQID  372



>ref|XP_006643139.1| PREDICTED: zinc transporter 7-like isoform X2 [Lepisosteus oculatus]
Length=384

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL K + G+L+
Sbjct  243  QGVFLHIVADTLGSIGVIISAILMQKYDLMIADPICSMLIAILIGVSVVPLLKESIGILM  302

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++   TL +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  303  QRTPPSL-DHTLPECYQRVQHLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADARWILS  361

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  362  QTHNIFTQAGVRQLYVQID  380



>ref|XP_004582061.1| PREDICTED: zinc transporter 7 [Ochotona princeps]
Length=376

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL K + G+L+Q 
Sbjct  237  VFLHILADTLGSVGVIASAIMMQNFGLMIADPICSILIAFLIVISVIPLLKESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  + L +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENALPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_007240170.1| PREDICTED: zinc transporter 7 [Astyanax mexicanus]
Length=392

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 79/147 (54%), Gaps = 2/147 (1%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILASWLLT-LGVKNAEVLCMGLVSGTVFMLVMPLF  520
            + A       V LH++AD++ S G+I++++L+    +  A+ +C  L++  + + V+PL 
Sbjct  243  KGASKQILQGVFLHIVADTLGSIGVIISAFLMQRYDLMIADPICSMLIALLIGVSVVPLL  302

Query  519  KATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG  340
            + + G+L+Q  PP++    L +C+++V     V  L +   W +     IG++ L V   
Sbjct  303  RESIGILMQRTPPSL-DHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPD  361

Query  339  VDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             D R +L    +++   GV+ L VQI+
Sbjct  362  ADSRWILSQTHNIFTQAGVRQLYVQID  388



>gb|AAH91417.1| Slc30a7 protein, partial [Rattus norvegicus]
 gb|AAI07442.1| Slc30a7 protein, partial [Rattus norvegicus]
Length=214

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  74   GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESIGILMQ  133

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP++  + L +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  134  RTPPSL-ENVLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQ  192

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  193  THNIFTQAGVRQLYVQID  210



>ref|XP_006643138.1| PREDICTED: zinc transporter 7-like isoform X1 [Lepisosteus oculatus]
Length=406

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+    +  A+ +C  L++  + + V+PL K + G+L+
Sbjct  265  QGVFLHIVADTLGSIGVIISAILMQKYDLMIADPICSMLIAILIGVSVVPLLKESIGILM  324

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++   TL +C+++V     V  L +   W +     IG++ L V    D R +L 
Sbjct  325  QRTPPSL-DHTLPECYQRVQHLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADARWILS  383

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  384  QTHNIFTQAGVRQLYVQID  402



>ref|XP_003220036.1| PREDICTED: zinc transporter 7 [Anolis carolinensis]
Length=380

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 76/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + V+PL + + G+L+
Sbjct  239  EGVFLHIVADTLGSVGVIISALLMQNYGLMIADPICSMLIAMLIGVSVVPLLRESIGILM  298

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++    L +C+++V     V  L     W +     IG++ L V    D + +L 
Sbjct  299  QRTPPSL-EGALPQCYQRVQQLQGVYSLNDPHFWTLCTDVYIGTLKLFVAPDADAKWILS  357

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L VQI+
Sbjct  358  QTHNIFTQAGVRQLYVQID  376



>ref|XP_009087094.1| PREDICTED: zinc transporter 7 [Serinus canaria]
Length=468

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -2

Query  672  HSVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLL  496
              V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+
Sbjct  327  QGVFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILM  386

Query  495  QTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQ  316
            Q  PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L 
Sbjct  387  QRTPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILS  445

Query  315  YVRDLYHDLGVQDLTVQIE  259
               +++   GV+ L +QI+
Sbjct  446  QTHNIFTQAGVRQLYIQID  464



>ref|XP_009424677.1| PREDICTED: zinc transporter 7 isoform X2 [Pan troglodytes]
Length=306

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  669  SVCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQ  493
             V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q
Sbjct  166  GVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAVLIVVSVIPLLRESVGILMQ  225

Query  492  TAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQY  313
              PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L  
Sbjct  226  RTPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQ  284

Query  312  VRDLYHDLGVQDLTVQIE  259
              +++   GV+ L VQI+
Sbjct  285  THNIFTQAGVRQLYVQID  302



>ref|XP_004258151.1| metal tolerance protein C2, putative [Entamoeba invadens IP1]
 gb|ELP91380.1| metal tolerance protein C2, putative [Entamoeba invadens IP1]
Length=541

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 90/183 (49%), Gaps = 16/183 (9%)
 Frame = -2

Query  771  AVTNLLVNLIGVWFFRNYAR------------INLVYRKAEDMNYHSVCLHVIADSVRSA  628
            +V  LLVN+IGV+ FR+               +    +K +D N   + LHV++D++ S 
Sbjct  360  SVLGLLVNIIGVFAFRDNGEEDEQECDCPAQLVKPKRKKGKDNNMEGIFLHVLSDTLGSV  419

Query  627  GLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQTAPPNIPSSTLNKC  451
            G+I++S+L+   G   A+ +C   +SG +F  VMPL K +A +LLQ  P       + + 
Sbjct  420  GVIVSSFLVEKFGWVIADPICSLCLSGMIFFSVMPLLKNSANLLLQNTPKCF---DVEEI  476

Query  450  WRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYVRDLYHDLGVQDLT  271
              ++   + V+E+ ++  WE      + +  +++K   D   +   V  +  +     +T
Sbjct  477  QNKILKVEGVSEVVKLNAWEFAEESMVATAVVKMKVECDAEKIRSDVYAILKEEEFNSIT  536

Query  270  VQI  262
            V++
Sbjct  537  VEL  539



>ref|XP_001136030.1| PREDICTED: zinc transporter 7 isoform X1 [Pan troglodytes]
 ref|XP_009424673.1| PREDICTED: zinc transporter 7 isoform X1 [Pan troglodytes]
Length=376

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAVLIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_003808530.1| PREDICTED: zinc transporter 7 [Pan paniscus]
 ref|XP_008958817.1| PREDICTED: zinc transporter 7 [Pan paniscus]
Length=376

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAVLIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>gb|EAZ42775.1| hypothetical protein OsJ_27355 [Oryza sativa Japonica Group]
Length=800

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 74/147 (50%), Gaps = 2/147 (1%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILASWLLTL-GVKNAEVLCMGLVSGTVFMLVMPLF  520
            R   D N   + LHV+AD++ S G+++++ L+   G   A+ +C   +S  +   V+PL 
Sbjct  651  RHHIDHNMEGIFLHVLADTMGSVGVVISTLLIKYKGWLIADPICSVFISIMIVSSVLPLL  710

Query  519  KATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG  340
            + +A +LLQ  P ++    + +    V     V  +    +W +     +G+  L +   
Sbjct  711  RNSAEILLQRVPRSL-EKDIKEALDDVMKIKGVIGVHNFHVWNLTNTDIVGTFHLHITTE  769

Query  339  VDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             D   + +   D++H+ G+QDLT+QIE
Sbjct  770  ADKSSIREKASDIFHEAGIQDLTIQIE  796



>ref|XP_006830971.1| PREDICTED: zinc transporter 7 [Chrysochloris asiatica]
Length=374

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ L+   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  235  VFLHILADTLGSIGVIASAILMQNFGLMIADPICSILIAMLIVVSVIPLLRESVGILMQR  294

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  + L +C+++V     V  L +   W +     +G++ + V    D R +L   
Sbjct  295  TPP-LLENALPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKVVVAPDADARWILSQT  353

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQIE
Sbjct  354  HNIFTQAGVRQLYVQIE  370



>ref|XP_005050600.1| PREDICTED: zinc transporter 7 [Ficedula albicollis]
Length=618

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I+++ L+   G+  A+ +C  L++  + + ++PL K + G+L+Q 
Sbjct  479  VFLHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQR  538

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP++  + L +C+++V     V  L     W +     IG++ L V    D R +L   
Sbjct  539  TPPSL-ENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQT  597

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L +QI+
Sbjct  598  HNIFTQAGVRQLYIQID  614



>ref|XP_009245480.1| PREDICTED: zinc transporter 7 isoform X1 [Pongo abelii]
Length=376

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_007975991.1| PREDICTED: zinc transporter 7 [Chlorocebus sabaeus]
 ref|XP_007975992.1| PREDICTED: zinc transporter 7 [Chlorocebus sabaeus]
 ref|XP_007975993.1| PREDICTED: zinc transporter 7 [Chlorocebus sabaeus]
Length=376

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query  666  VCLHVIADSVRSAGLILASWLL-TLGVKNAEVLCMGLVSGTVFMLVMPLFKATAGVLLQT  490
            V LH++AD++ S G+I ++ ++   G+  A+ +C  L++  + + V+PL + + G+L+Q 
Sbjct  237  VFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQR  296

Query  489  APPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVDDRPVLQYV  310
             PP +  +TL +C+++V     V  L +   W +     +G++ L V    D R +L   
Sbjct  297  TPP-LLENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQT  355

Query  309  RDLYHDLGVQDLTVQIE  259
             +++   GV+ L VQI+
Sbjct  356  HNIFTQAGVRQLYVQID  372



>ref|XP_002138677.2| GA24914 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY69235.2| GA24914 [Drosophila pseudoobscura pseudoobscura]
Length=490

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 75/147 (51%), Gaps = 7/147 (5%)
 Frame = -2

Query  687  EDMNYHSVCLHVIADSVRSAGLILASWLLTL--GVKNAEVLCMGLVSGTVFMLVMPLFKA  514
            E++N  +  +HVI D V+S G+ LA+ L+    G K A+ LC  L S  V +  +PLF+ 
Sbjct  343  ENLNLRAAMIHVIGDLVQSIGVFLAAVLIKFCPGAKYADPLCTLLFSVIVILTTVPLFRE  402

Query  513  TAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKGVD  334
            +  VLL   P N+   TL    RQ+AS + V  +  + +W+    H +  + L  + G +
Sbjct  403  SVAVLLDAVPQNLSLRTLQ---RQLASIEGVRSVHHLNVWQHTAEHRVLMVHLVTEAGSN  459

Query  333  DRPVLQYVRDLYH--DLGVQDLTVQIE  259
               +LQ    L    +  ++  T+QIE
Sbjct  460  SEDILQLATQLVSGPEYRMKHATIQIE  486



>dbj|BAC24961.1| putative zinc transporter [Oryza sativa Japonica Group]
Length=800

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 74/147 (50%), Gaps = 2/147 (1%)
 Frame = -2

Query  696  RKAEDMNYHSVCLHVIADSVRSAGLILASWLLTL-GVKNAEVLCMGLVSGTVFMLVMPLF  520
            R   D N   + LHV+AD++ S G+++++ L+   G   A+ +C   +S  +   V+PL 
Sbjct  651  RHHIDHNMEGIFLHVLADTMGSVGVVISTLLIKYKGWLIADPICSVFISIMIVSSVLPLL  710

Query  519  KATAGVLLQTAPPNIPSSTLNKCWRQVASHDSVTELFQVRLWEMVPGHAIGSISLQVKKG  340
            + +A +LLQ  P ++    + +    V     V  +    +W +     +G+  L +   
Sbjct  711  RNSAEILLQRVPRSL-EKDIKEALDDVMKIKGVIGVHNFHVWNLTNTDIVGTFHLHITTE  769

Query  339  VDDRPVLQYVRDLYHDLGVQDLTVQIE  259
             D   + +   D++H+ G+QDLT+QIE
Sbjct  770  ADKSSIREKASDIFHEAGIQDLTIQIE  796



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310