BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006K19

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          399   5e-137   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     398   7e-137   Solanum tuberosum [potatoes]
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     395   2e-135   Nicotiana tomentosiformis
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     394   2e-135   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     394   2e-135   Nicotiana sylvestris
ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     394   6e-135   Nicotiana sylvestris
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    393   8e-135   Solanum tuberosum [potatoes]
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     393   1e-134   Sesamum indicum [beniseed]
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                390   1e-133   Erythranthe guttata [common monkey flower]
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          384   4e-131   Prunus mume [ume]
gb|ACP43315.1|  20S proteasome beta subunit 5                           383   8e-131   Citrus maxima [buntan]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     383   9e-131   Cucumis sativus [cucumbers]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     382   1e-130   Pyrus x bretschneideri [bai li]
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             382   1e-130   Citrus clementina [clementine]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    382   1e-130   Citrus sinensis [apfelsine]
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             382   1e-130   Prunus persica
gb|EPS61043.1|  hypothetical protein M569_13757                         382   1e-130   Genlisea aurea
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             382   2e-130   Phaseolus vulgaris [French bean]
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          381   3e-130   Cucumis melo [Oriental melon]
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     381   4e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          380   9e-130   Vitis vinifera
gb|KHN31904.1|  Proteasome subunit beta type-5                          380   1e-129   Glycine soja [wild soybean]
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    380   1e-129   Glycine max [soybeans]
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        377   1e-129   Prunus persica
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     379   2e-129   Glycine max [soybeans]
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     379   2e-129   
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             379   2e-129   Capsella rubella
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     379   5e-129   Fragaria vesca subsp. vesca
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             378   5e-129   Eutrema salsugineum [saltwater cress]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    378   5e-129   
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         378   7e-129   Jatropha curcas
gb|ACU23791.1|  unknown                                                 377   9e-129   Glycine max [soybeans]
gb|KHG05622.1|  Proteasome subunit beta type-5                          377   1e-128   Gossypium arboreum [tree cotton]
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     377   1e-128   Nelumbo nucifera [Indian lotus]
gb|KJB15718.1|  hypothetical protein B456_002G192400                    377   2e-128   Gossypium raimondii
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          377   2e-128   Nelumbo nucifera [Indian lotus]
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          377   2e-128   Pyrus x bretschneideri [bai li]
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          377   2e-128   
emb|CDY34594.1|  BnaC03g56940D                                          376   4e-128   Brassica napus [oilseed rape]
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        376   4e-128   Eucalyptus grandis [rose gum]
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     376   5e-128   Phoenix dactylifera
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     376   5e-128   Phoenix dactylifera
gb|KHG25400.1|  Proteasome subunit beta type-5                          375   8e-128   Gossypium arboreum [tree cotton]
emb|CDX98014.1|  BnaA06g07650D                                          375   9e-128   
emb|CDY19402.1|  BnaC05g09110D                                          375   9e-128   Brassica napus [oilseed rape]
emb|CDP13326.1|  unnamed protein product                                377   1e-127   Coffea canephora [robusta coffee]
gb|KJB78067.1|  hypothetical protein B456_012G175200                    375   1e-127   Gossypium raimondii
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        375   1e-127   Brassica rapa
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     375   1e-127   Elaeis guineensis
emb|CDY21081.1|  BnaA08g24440D                                          375   1e-127   Brassica napus [oilseed rape]
gb|AFK46055.1|  unknown                                                 374   1e-127   Lotus japonicus
ref|XP_010105786.1|  Proteasome subunit beta type-5                     374   2e-127   Morus notabilis
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             374   3e-127   Eutrema salsugineum [saltwater cress]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    374   4e-127   Brassica rapa
emb|CDY16054.1|  BnaC08g40690D                                          373   5e-127   Brassica napus [oilseed rape]
ref|XP_003602092.1|  Proteasome subunit beta type                       373   5e-127   Medicago truncatula
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    373   5e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        373   5e-127   Camelina sativa [gold-of-pleasure]
ref|NP_189265.1|  proteasome subunit beta type-5-B                      372   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    372   2e-126   Brassica rapa
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    371   4e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     371   5e-126   Elaeis guineensis
gb|ACP43316.1|  20S proteasome beta subunit 5                           368   5e-126   Citrus maxima [buntan]
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          370   6e-126   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK34329.1|  unknown                                                 370   8e-126   Medicago truncatula
emb|CDY26610.1|  BnaA09g46670D                                          370   1e-125   Brassica napus [oilseed rape]
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    370   1e-125   Tarenaya hassleriana [spider flower]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          369   2e-125   
gb|AAK92808.1|  putative proteasome epsilon chain precursor             369   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172765.1|  20S proteasome beta subunit E1                        369   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             369   2e-125   Capsella rubella
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             369   3e-125   
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    368   6e-125   Brachypodium distachyon [annual false brome]
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             368   6e-125   
gb|ABK25888.1|  unknown                                                 368   6e-125   Picea sitchensis
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          368   7e-125   Sorghum bicolor [broomcorn]
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    367   9e-125   Spinacia oleracea
ref|NP_001132821.1|  uncharacterized protein LOC100194311               367   1e-124   Zea mays [maize]
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     367   2e-124   Cucumis sativus [cucumbers]
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        367   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        367   2e-124   Tarenaya hassleriana [spider flower]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    367   2e-124   Camelina sativa [gold-of-pleasure]
gb|ABK25785.1|  unknown                                                 367   2e-124   Picea sitchensis
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    367   2e-124   Camelina sativa [gold-of-pleasure]
gb|AFK38197.1|  unknown                                                 366   3e-124   Medicago truncatula
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       367   3e-124   
gb|AAU82107.1|  20S proteasome beta 5 subunit                           366   3e-124   Triticum aestivum [Canadian hard winter wheat]
gb|EMS57921.1|  Proteasome subunit beta type-5                          364   3e-124   Triticum urartu
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    366   5e-124   Setaria italica
dbj|BAJ97061.1|  predicted protein                                      366   5e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAG92607.1|  unnamed protein product                                360   2e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    361   3e-122   Populus euphratica
gb|EEE65108.1|  hypothetical protein OsJ_20167                          361   4e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002312631.2|  20S proteasome beta subunit family protein         360   5e-122   
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       360   6e-122   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       360   7e-122   
gb|EEC80034.1|  hypothetical protein OsI_21721                          360   9e-122   Oryza sativa Indica Group [Indian rice]
gb|ABE68720.1|  20S proteasome beta subunit                             358   1e-121   Arachis hypogaea [goober]
gb|ACJ85344.1|  unknown                                                 358   2e-121   Medicago truncatula
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    359   2e-121   Oryza brachyantha
ref|XP_002315619.1|  20S proteasome beta subunit family protein         357   9e-121   Populus trichocarpa [western balsam poplar]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    356   3e-120   Populus euphratica
ref|NP_001184978.1|  20S proteasome beta subunit E1                     357   3e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CAC43326.1|  putative beta5 proteasome subunit                      346   8e-118   Nicotiana tabacum [American tobacco]
ref|XP_001759925.1|  predicted protein                                  343   4e-115   
gb|ACU51028.1|  20S proteasome beta5 subunit                            343   5e-115   Conocephalum conicum
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        367   2e-113   
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             338   6e-113   Selaginella moellendorffii
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             335   4e-112   Selaginella moellendorffii
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     329   1e-109   Phoenix dactylifera
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    327   7e-109   
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     327   9e-109   Elaeis guineensis
ref|XP_001751936.1|  predicted protein                                  311   2e-103   
ref|XP_003061052.1|  predicted protein                                  311   1e-102   Micromonas pusilla CCMP1545
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    312   1e-102   Ostreococcus tauri
ref|NP_001265983.1|  proteasome subunit beta type-5-like                309   2e-102   Cicer arietinum [garbanzo]
ref|XP_002506817.1|  predicted protein                                  310   8e-102   Micromonas commoda
ref|XP_007514496.1|  predicted protein                                  308   4e-101   Bathycoccus prasinos
ref|XP_001421201.1|  predicted protein                                  306   4e-100   Ostreococcus lucimarinus CCE9901
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         303   5e-100   
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         298   2e-97    Coccomyxa subellipsoidea C-169
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              296   6e-97    Chlorella variabilis
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              291   1e-94    Volvox carteri f. nagariensis
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   286   1e-94    Brassica napus [oilseed rape]
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         290   2e-94    Chlamydomonas reinhardtii
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   285   4e-92    Auxenochlorella protothecoides
gb|KDD75121.1|  proteasome subunit protein                              277   7e-90    Helicosporidium sp. ATCC 50920
gb|EIE77859.1|  proteasome component PRE2                               278   2e-89    Rhizopus delemar RA 99-880
emb|CEG76257.1|  Putative Proteasome subunit beta type                  276   8e-89    Rhizopus microsporus
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              273   5e-88    Helobdella robusta
gb|EIE87710.1|  proteasome component PRE2                               270   7e-88    Rhizopus delemar RA 99-880
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             273   9e-88    Lottia gigantea
ref|XP_002678668.1|  predicted protein                                  274   1e-87    Naegleria gruberi strain NEG-M
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like     271   6e-87    Latimeria chalumnae
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 271   1e-86    Guillardia theta CCMP2712
gb|AAI55951.1|  LOC100127332 protein                                    269   2e-86    Xenopus laevis [clawed frog]
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              270   2e-86    Batrachochytrium dendrobatidis JAM81
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          269   3e-86    Xenopus tropicalis [western clawed frog]
gb|KFH71396.1|  20S proteasome subunit beta 5                           268   8e-86    Mortierella verticillata NRRL 6337
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like     268   1e-85    Aplysia californica
gb|AAY98499.1|  LMP X                                                   268   1e-85    Swiftia exserta
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  268   2e-85    
gb|AAL74417.1|  proteosome PSMB5/8 protein                              265   2e-85    Branchiostoma lanceolatum [common lancelet]
ref|XP_004994692.1|  LMP X protein                                      268   2e-85    Salpingoeca rosetta
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    265   2e-85    Mus musculus [mouse]
emb|CDH56820.1|  20s proteasome subunit                                 268   2e-85    Lichtheimia corymbifera JMRC:FSU:9682
gb|AAM18885.1|AF391293_2  unknown                                       266   5e-85    Branchiostoma floridae
emb|CAA66313.1|  LMP7-like protein                                      265   6e-85    Botryllus schlosseri
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    266   6e-85    
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          266   6e-85    Cynoglossus semilaevis [half-smooth tongue sole]
emb|CEP17612.1|  hypothetical protein                                   266   7e-85    Parasitella parasitica
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  263   7e-85    Homo sapiens [man]
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    263   1e-84    Bos taurus [bovine]
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          265   1e-84    Dasypus novemcinctus
ref|XP_792356.3|  PREDICTED: proteasome subunit beta type-5-like        262   1e-84    
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5          265   1e-84    Python bivittatus
gb|EPY87607.1|  proteasome subunit beta type-5-like isoform 1           262   1e-84    Camelus ferus
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    263   2e-84    
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          265   2e-84    Stegastes partitus
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    263   2e-84    synthetic construct
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like     265   2e-84    Crassostrea gigas
dbj|BAA08204.1|  proteasome subunit RCX                                 262   2e-84    Rattus rattus [house rat]
dbj|BAA06097.1|  proteasome subunit X                                   262   2e-84    Homo sapiens [man]
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     265   2e-84    Saccoglossus kowalevskii
dbj|BAE93066.1|  low molecular mass polypeptide                         262   3e-84    Lethenteron camtschaticum [Japanese lamprey]
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          264   3e-84    Chrysochloris asiatica
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     264   4e-84    Hydra vulgaris
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              264   4e-84    Trichoplax adhaerens
dbj|GAN10935.1|  20S proteasome subunit                                 263   7e-84    Mucor ambiguus
emb|CAA66312.1|  LMP7-like protein                                      263   7e-84    Geodia cydonium
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  263   7e-84    Capitella teleta
gb|EPB87271.1|  proteasome component PRE2                               263   8e-84    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          263   8e-84    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          263   8e-84    Loxodonta africana [African bush elephant]
ref|XP_001730616.1|  hypothetical protein MGL_2412                      264   9e-84    Malassezia globosa CBS 7966
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          263   9e-84    Trichechus manatus latirostris
ref|XP_001745267.1|  hypothetical protein                               262   9e-84    Monosiga brevicollis MX1
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          263   1e-83    Sarcophilus harrisii
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          263   1e-83    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001626004.1|  predicted protein                                  263   1e-83    Nematostella vectensis
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    262   1e-83    Orycteropus afer afer
ref|NP_001032701.1|  proteasome subunit beta type-5                     262   1e-83    Bos taurus [bovine]
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          262   1e-83    Ovis aries [domestic sheep]
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          260   1e-83    
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    260   1e-83    
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     263   1e-83    Haplochromis burtoni
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     263   1e-83    
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          262   1e-83    Bubalus bubalis [domestic water buffalo]
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          262   1e-83    Peromyscus maniculatus bairdii
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    262   1e-83    
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     263   1e-83    Pundamilia nyererei
gb|ELR56586.1|  Proteasome subunit beta type-5                          262   1e-83    Bos mutus
ref|XP_002179855.1|  predicted protein                                  263   2e-83    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          262   2e-83    Callithrix jacchus [common marmoset]
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     262   2e-83    Myotis brandtii
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     263   2e-83    Oreochromis niloticus
emb|CBY21147.1|  unnamed protein product                                263   2e-83    Oikopleura dioica
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          262   2e-83    Saimiri boliviensis boliviensis
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          262   2e-83    Ailuropoda melanoleuca
ref|NP_035316.1|  proteasome subunit beta type-5                        262   2e-83    Mus musculus [mouse]
gb|ADO27969.1|  proteasome subunit beta type-5                          262   2e-83    Ictalurus furcatus
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    262   2e-83    Mus musculus [mouse]
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          261   2e-83    Monodelphis domestica
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          261   2e-83    Ursus maritimus [white bear]
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          261   3e-83    Felis catus [cat]
gb|ADL27419.1|  proteasome subunit beta type                            262   3e-83    Pheronema raphanus
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    261   3e-83    Condylura cristata
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          261   3e-83    Odobenus rosmarus divergens
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5          262   3e-83    Anolis carolinensis [Carolina anole]
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5          261   4e-83    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    261   4e-83    Physeter catodon
ref|NP_001099197.2|  proteasome subunit beta type-5                     261   4e-83    Rattus norvegicus [brown rat]
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          261   4e-83    Vicugna pacos
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          261   4e-83    Myotis lucifugus
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          261   4e-83    
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    261   4e-83    Lipotes vexillifer [baiji]
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    261   4e-83    
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5          261   4e-83    Camelus ferus
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             251   5e-83    
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          261   5e-83    Myotis davidii
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    261   5e-83    Orcinus orca [Orca]
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          261   5e-83    Balaenoptera acutorostrata scammoni
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    261   5e-83    Eptesicus fuscus
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          261   5e-83    Tupaia chinensis
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          261   5e-83    Cavia porcellus [guinea pig]
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     261   5e-83    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    262   5e-83    Capsaspora owczarzaki ATCC 30864
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              261   5e-83    Homo sapiens [man]
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          261   5e-83    
ref|XP_005707411.1|  20S proteasome subunit beta 5                      261   5e-83    Galdieria sulphuraria
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    261   6e-83    Gorilla gorilla gorilla [lowland gorilla]
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    261   6e-83    Rattus norvegicus [brown rat]
emb|CAD97956.1|  hypothetical protein                                   261   6e-83    Homo sapiens [man]
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    261   6e-83    Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001247774.1|  proteasome subunit beta type-5                     261   6e-83    Macaca mulatta [rhesus macaque]
emb|CAF97719.1|  unnamed protein product                                261   6e-83    Tetraodon nigroviridis
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          261   6e-83    Equus przewalskii [Przewalski horse]
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    261   6e-83    
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          260   7e-83    Myotis brandtii
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          260   7e-83    Pteropus alecto
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          260   7e-83    Galeopterus variegatus [Malayan flying lemur]
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    260   7e-83    Chlorocebus sabaeus
dbj|BAA10932.1|  LMPX of lamprey                                        261   7e-83    Petromyzon marinus [marine lamprey]
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    260   7e-83    Oryctolagus cuniculus [domestic rabbit]
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          261   8e-83    Sus scrofa [pigs]
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          260   9e-83    Carlito syrichta
gb|AAB33092.1|  proteasome subunit MB1                                  258   9e-83    Homo sapiens [man]
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          260   9e-83    Canis lupus familiaris [dogs]
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          260   9e-83    Microtus ochrogaster [prairie voles]
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          260   9e-83    
dbj|BAA10935.1|  nurse shark LMPX                                       260   1e-82    Ginglymostoma cirratum
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          260   1e-82    Cricetulus griseus [Chinese hamsters]
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 261   1e-82    Cyanidioschyzon merolae strain 10D
dbj|BAB26942.1|  unnamed protein product                                260   1e-82    Mus musculus [mouse]
ref|XP_004054985.1|  PREDICTED: proteasome subunit beta type-5 is...    260   1e-82    
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like     260   1e-82    
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    259   1e-82    
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          259   2e-82    Octodon degus
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          259   2e-82    Ochotona princeps [southern American pika]
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                258   2e-82    Osmerus mordax
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          259   2e-82    Nannospalax galili
gb|KFH65162.1|  20S proteasome subunit beta 5                           259   2e-82    Mortierella verticillata NRRL 6337
dbj|GAM19629.1|  hypothetical protein SAMD00019534_028040               259   2e-82    Acytostelium subglobosum LB1
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          259   3e-82    Fukomys damarensis [Damara mole rat]
gb|EWM22648.1|  proteasome subunit beta type 5                          259   3e-82    Nannochloropsis gaditana
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          259   3e-82    Erinaceus europaeus [common hedgehog]
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    259   3e-82    Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          259   3e-82    Jaculus jaculus
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          259   3e-82    Notothenia coriiceps [yellowbelly rockcod]
gb|ERE89366.1|  proteasome subunit beta type-5-like protein             260   3e-82    Cricetulus griseus [Chinese hamsters]
gb|EFA82937.1|  proteasome subunit beta type 5                          259   4e-82    Heterostelium album PN500
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         259   5e-82    Acanthamoeba castellanii str. Neff
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5          258   5e-82    
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    258   6e-82    Mustela putorius furo [black ferret]
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          258   8e-82    Otolemur garnettii
gb|ETE64662.1|  Proteasome subunit beta type-5                          258   9e-82    Ophiophagus hannah
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          258   1e-81    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          257   1e-81    Sorex araneus [Eurasian shrew]
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     258   1e-81    Xiphophorus maculatus
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          258   1e-81    
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5          257   1e-81    
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          258   1e-81    
ref|XP_006261242.1|  PREDICTED: proteasome subunit beta type-5          257   2e-81    
gb|EFX81688.1|  hypothetical protein DAPPUDRAFT_303318                  257   2e-81    
gb|AAW24786.1|  SJCHGC05978 protein                                     257   2e-81    
gb|EPY26658.1|  20S proteasome subunit beta 5                           255   2e-81    
gb|KGB40340.1|  Proteasome subunit beta type-5                          255   2e-81    
ref|XP_001568804.1|  putative proteasome beta 5 subunit                 258   2e-81    
ref|XP_010571771.1|  PREDICTED: proteasome subunit beta type-5          254   3e-81    
gb|EJK48257.1|  hypothetical protein THAOC_32963                        256   3e-81    
ref|XP_010703107.1|  proteasome beta 5 subunit, putative                258   3e-81    
gb|EPQ17641.1|  Proteasome subunit beta type-5                          259   3e-81    
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    256   4e-81    
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like     256   4e-81    
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     256   4e-81    
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 256   4e-81    
gb|EPY20654.1|  20S proteasome subunit beta 5                           257   5e-81    
gb|AGG11403.1|  hypothetical protein                                    257   5e-81    
ref|XP_009311762.1|  proteasome beta 5 subunit                          257   5e-81    
gb|AAI53590.1|  Psmb5 protein                                           256   5e-81    
ref|NP_001270574.1|  uncharacterized protein LOC101865806               255   7e-81    
ref|XP_001686739.1|  putative proteasome beta 5 subunit                 256   8e-81    
gb|EFX80663.1|  hypothetical protein DAPPUDRAFT_303852                  255   9e-81    
ref|XP_002050049.1|  GJ21921                                            256   9e-81    
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               256   9e-81    
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           255   1e-80    
emb|CAX70714.1|  proteasome (prosome, macropain) subunit, beta ty...    255   1e-80    
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    255   1e-80    
gb|EPY31554.1|  20S proteasome subunit beta 5                           255   1e-80    
ref|NP_571226.1|  proteasome subunit beta type-5                        255   1e-80    
ref|XP_001469755.1|  putative proteasome beta 5 subunit                 256   2e-80    
ref|XP_011391773.1|  putative proteasome core particle subunit be...    255   2e-80    
ref|XP_004358358.1|  proteasome subunit beta type 5                     255   2e-80    
emb|CCC93748.1|  proteasome beta 5 subunit                              255   3e-80    
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          254   3e-80    
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     251   3e-80    
gb|EPY36607.1|  20S proteasome subunit beta 5                           255   3e-80    
gb|AGG11598.1|  hypothetical protein                                    255   3e-80    
dbj|BAO50694.1|  proteasome subunit beta type 8,F-type                  251   3e-80    
gb|AAF37285.1|AF226674_1  20S proteasome beta 5 subunit                 253   4e-80    
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     253   4e-80    
ref|XP_003874511.1|  putative proteasome beta 5 subunit                 254   5e-80    
ref|XP_002033298.1|  GM21240                                            254   5e-80    
ref|XP_002080955.1|  GD10758                                            254   5e-80    
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      255   6e-80    
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   251   7e-80    
gb|AAC97957.2|  proteasome beta 5 subunit                               253   7e-80    
emb|CCC51553.1|  putative proteasome beta 5 subunit, fragment           253   9e-80    
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    254   9e-80    
emb|CBN74512.1|  conserved unknown protein                              253   1e-79    
dbj|BAM21000.1|  proteasome subunit beta type-8                         251   1e-79    
ref|XP_628966.1|  proteasome subunit beta type 5                        252   2e-79    
emb|CAA40494.1|  proteasome C1 subunit                                  249   2e-79    
dbj|BAA10934.1|  LMP7                                                   252   2e-79    
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  249   2e-79    
ref|XP_003287743.1|  proteasome subunit beta type 5                     251   3e-79    
ref|XP_822850.1|  proteasome subunit beta 5                             253   3e-79    
ref|XP_810086.1|  proteasome beta 5 subunit                             253   4e-79    
dbj|BAA10931.1|  LMPX of hagfish                                        251   4e-79    
ref|NP_652014.1|  proteasome beta5 subunit, isoform A                   251   4e-79    
gb|AAF26416.1|AF217726_1  20S proteasome beta5 subunit                  251   4e-79    
dbj|BAA10933.1|  LMP7 of nurse shark                                    251   6e-79    
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             251   6e-79    
ref|XP_810804.1|  proteasome beta 5 subunit                             252   6e-79    
dbj|BAO50697.1|  proteasome subunit beta type 8,F-type                  248   6e-79    
gb|ESS68038.1|  proteasome beta 5 subunit                               252   8e-79    
ref|NP_001264655.1|  proteasome subunit beta type-5                     250   8e-79    
dbj|BAO50692.1|  proteasome subunit beta type 8,A-type                  248   8e-79    
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    248   9e-79    
ref|XP_008036606.1|  proteasome component pts1                          251   9e-79    
ref|XP_002063746.1|  GK15836                                            251   9e-79    
gb|EKG04000.1|  proteasome beta 5 subunit, putative                     251   9e-79    
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    253   9e-79    
gb|ESL07999.1|  proteasome beta 5 subunit                               251   1e-78    
sp|P34065.2|PSB5_CHICK  RecName: Full=Proteasome subunit beta typ...    249   1e-78    
emb|CEG76258.1|  Putative Proteasome subunit beta type                  249   1e-78    
ref|XP_008543771.1|  PREDICTED: proteasome subunit beta type-5          250   1e-78    
dbj|BAO50685.1|  proteasome subunit beta type 8,F-type                  248   1e-78    
emb|CDQ73245.1|  unnamed protein product                                250   1e-78    
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      251   1e-78    
gb|EKF32460.1|  proteasome beta 5 subunit, putative                     251   1e-78    
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                249   1e-78    
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     249   1e-78    
ref|XP_007418509.1|  20S proteasome subunit                             250   2e-78    
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                249   2e-78    
ref|XP_007863011.1|  20S proteasome subunit                             251   2e-78    
gb|ADQ00176.1|  20S proteasome beta subunit E type beta 5               246   2e-78    
gb|KFM59336.1|  Proteasome subunit beta type-5                          249   2e-78    
ref|XP_001361733.1|  GA11556                                            249   3e-78    
ref|XP_001961263.1|  GF13778                                            249   3e-78    
ref|XP_001976166.1|  GG20151                                            249   3e-78    
ref|XP_001986559.1|  GH20460                                            249   4e-78    
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                248   5e-78    
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     248   5e-78    
gb|KDE05583.1|  proteasome component PRE2                               249   5e-78    
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    250   5e-78    
ref|XP_002090364.1|  Prosbeta5                                          248   6e-78    
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              249   6e-78    
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    249   6e-78    
ref|XP_002005785.1|  GI18886                                            248   6e-78    
gb|AAL59862.1|AF363583_1  proteasome beta-subunit LMP7                  248   7e-78    
gb|ACI66984.1|  Proteasome subunit beta type-8 precursor                248   7e-78    
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              249   7e-78    
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  249   7e-78    
ref|XP_003332961.2|  20S proteasome subunit beta 5                      248   8e-78    
ref|XP_011184652.1|  PREDICTED: proteasome subunit beta type-5-like     248   8e-78    
dbj|BAO50684.1|  proteasome subunit beta type 8,A-type                  245   1e-77    
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               249   1e-77    
gb|EJU05281.1|  proteasome-domain-containing protein                    249   1e-77    
gb|AGM32352.1|  proteasome subunit beta type-5-like protein             248   1e-77    
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537             246   1e-77    
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   248   1e-77    
gb|ACN10160.1|  Proteasome subunit beta type-8 precursor                248   2e-77    
gb|AJK90586.1|  20S proteasome beta5 subunit                            247   2e-77    
ref|XP_007850837.1|  proteasome component pre2 precursor                248   2e-77    
dbj|BAO50689.1|  proteasome subunit beta type 8,A-type                  244   2e-77    
dbj|BAO50693.1|  proteasome subunit beta type 8,F-type                  244   2e-77    
ref|XP_011182734.1|  PREDICTED: proteasome subunit beta type-5-like     246   2e-77    
dbj|BAO50687.1|  proteasome subunit beta type 8,F-type                  244   2e-77    
emb|CCM00020.1|  predicted protein                                      248   2e-77    
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  248   2e-77    
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              248   2e-77    
ref|NP_001158688.1|  Proteasome subunit beta type 8                     246   3e-77    
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   248   3e-77    
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  248   4e-77    
dbj|BAO50691.1|  proteasome subunit beta type 8,A-type                  243   5e-77    
gb|ETS60462.1|  hypothetical protein PaG_05302                          253   5e-77    
ref|NP_001017791.1|  proteasome subunit beta type 8                     246   6e-77    
dbj|BAO50690.1|  proteasome subunit beta type 8,A-type                  243   6e-77    
ref|XP_011214452.1|  PREDICTED: proteasome subunit beta type-5-like     246   6e-77    
gb|AFW85805.1|  hypothetical protein ZEAMMB73_646691                    243   6e-77    
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   246   7e-77    
gb|ACM09015.1|  Proteasome subunit beta type-5 precursor                245   7e-77    
ref|XP_005188727.1|  PREDICTED: proteasome subunit beta type-5          246   8e-77    
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  246   9e-77    
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  246   9e-77    
ref|XP_009038619.1|  hypothetical protein AURANDRAFT_28593              246   1e-76    
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  246   1e-76    
ref|XP_394680.3|  PREDICTED: proteasome subunit beta type-5-like        245   1e-76    
ref|XP_003694700.1|  PREDICTED: proteasome subunit beta type-5-like     245   1e-76    
emb|CCO27714.1|  20S proteasome subunit beta 5                          246   1e-76    
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   246   1e-76    
gb|EMS25821.1|  20S proteasome subunit beta 5                           245   1e-76    
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             246   2e-76    
ref|XP_011206211.1|  PREDICTED: proteasome subunit beta type-5-like     244   2e-76    
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 246   2e-76    
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  246   2e-76    
ref|XP_002911819.1|  proteasome component pts1                          246   2e-76    
emb|CCW60032.1|  unnamed protein product                                245   2e-76    
dbj|BAO50686.1|  proteasome subunit beta type 8,A-type                  241   2e-76    
ref|XP_003394930.1|  PREDICTED: proteasome subunit beta type-5-like     244   3e-76    
ref|XP_004534832.1|  PREDICTED: proteasome subunit beta type-5-like     244   3e-76    
ref|XP_003488646.1|  PREDICTED: proteasome subunit beta type-5-like     244   3e-76    
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 244   3e-76    
ref|XP_970194.1|  PREDICTED: proteasome subunit beta type-5             244   3e-76    
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   244   3e-76    
dbj|BAO50688.1|  proteasome subunit beta type 8,F-type                  241   4e-76    
ref|XP_007882652.1|  PREDICTED: proteasome subunit beta type-8-like     243   4e-76    
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              244   4e-76    
gb|AAL59861.1|AF363582_1  proteasome beta-subunit LMP7-like protein     244   4e-76    
gb|ACO15462.1|  Proteasome subunit beta type-5 precursor                243   4e-76    
ref|XP_011351485.1|  PREDICTED: proteasome subunit beta type-5          244   4e-76    
emb|CAN13318.1|  proteasome (prosome, macropain) subunit, beta ty...    241   5e-76    
dbj|BAM20999.1|  proteasome subunit beta type-8                         241   5e-76    
ref|XP_006001021.1|  PREDICTED: proteasome subunit beta type-8-like     243   6e-76    
gb|KDR22252.1|  Proteasome subunit beta type-5                          243   6e-76    
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  244   6e-76    
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              244   8e-76    
ref|XP_011502385.1|  PREDICTED: proteasome subunit beta type-5          242   8e-76    
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  243   9e-76    
ref|XP_001867951.1|  proteasome subunit beta type 8                     242   9e-76    
ref|XP_011309100.1|  PREDICTED: proteasome subunit beta type-5          243   9e-76    
ref|XP_007764597.1|  20S proteasome subunit                             244   9e-76    
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  243   1e-75    
dbj|BAM20998.1|  proteasome subunit beta type-8                         241   1e-75    
ref|XP_011150435.1|  PREDICTED: proteasome subunit beta type-5          243   1e-75    
gb|EFN77251.1|  Proteasome subunit beta type-5                          243   1e-75    
ref|XP_010866810.1|  PREDICTED: proteasome subunit beta type-8-like     242   1e-75    
ref|XP_006619720.1|  PREDICTED: proteasome subunit beta type-5-like     242   1e-75    
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   243   2e-75    
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   243   2e-75    
gb|AEE61820.1|  unknown                                                 242   2e-75    
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  243   2e-75    
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            243   2e-75    
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   243   2e-75    
gb|KJE01830.1|  proteasome subunit beta type-5                          243   2e-75    
gb|EHJ72628.1|  proteasome subunit beta 5                               242   2e-75    
ref|XP_006457891.1|  20S proteasome subunit                             243   2e-75    
gb|ENN71488.1|  hypothetical protein YQE_11784                          241   3e-75    
ref|XP_001663403.1|  AAEL013236-PA                                      241   3e-75    
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   243   3e-75    
ref|XP_571562.1|  proteasome component pts1                             242   3e-75    
ref|XP_001875479.1|  20S proteasome subunit                             242   3e-75    
gb|ABI31729.1|  low molecular mass protein 7                            240   3e-75    
ref|XP_011060822.1|  PREDICTED: proteasome subunit beta type-5          241   4e-75    
dbj|GAK66792.1|  proteasome-domain-containing protein                   252   4e-75    
ref|XP_003194765.1|  proteasome component                               241   5e-75    
gb|KIR99960.1|  proteasome subunit beta type-5                          241   5e-75    
dbj|BAO50695.1|  proteasome subunit beta type 8,A-type                  238   5e-75    
ref|XP_011163166.1|  PREDICTED: proteasome subunit beta type-5          241   5e-75    
gb|ACO07495.1|  Proteasome subunit beta type 8 precursor                241   6e-75    
gb|KIY65291.1|  proteasome-domain-containing protein                    241   6e-75    
gb|ACO11122.1|  Proteasome subunit beta type-5 precursor                241   6e-75    
gb|AFR96090.1|  proteasome component PRE2                               242   7e-75    
dbj|BAO00931.1|  proteasome subunit beta type 8,F-type                  240   7e-75    
dbj|BAM18296.1|  proteasome beta5 subunit                               240   8e-75    
ref|XP_011254239.1|  PREDICTED: proteasome subunit beta type-5          241   8e-75    
dbj|BAA19767.1|  LMP7                                                   238   8e-75    
ref|XP_001924154.2|  PREDICTED: proteasome subunit beta type-8          240   9e-75    
ref|XP_002435468.1|  20S proteasome, regulatory subunit beta, put...    240   1e-74    
ref|NP_999100.1|  proteasome subunit beta type-8                        239   1e-74    
dbj|GAA98585.1|  hypothetical protein E5Q_05272                         241   1e-74    
ref|XP_559226.2|  AGAP010718-PA                                         240   1e-74    
gb|ETN63828.1|  proteasome subunit beta type 5,8                        240   1e-74    
emb|CCW66993.1|  unnamed protein product                                241   1e-74    
gb|KFB51802.1|  AGAP010718-PA-like protein                              240   1e-74    
ref|XP_004590508.1|  PREDICTED: proteasome subunit beta type-8          239   2e-74    
dbj|BAO00926.1|  proteasome subunit beta type 8,A-type                  237   2e-74    
gb|EMD38457.1|  20S proteasome subunit                                  240   2e-74    
gb|KGB75936.1|  proteasome component pts1                               241   2e-74    



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   399 bits (1024),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/200 (96%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+DLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPVE AAVE EM EVP+A
Sbjct  254  HYYPVEVAAVEQEMAEVPVA  273



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   398 bits (1023),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 191/200 (96%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+DLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPVE AAVE EM EVP+A
Sbjct  254  HYYPVEVAAVEQEMAEVPVA  273



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   395 bits (1014),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+DLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            +YYPVE AAVE EM EVP+A
Sbjct  254  NYYPVEVAAVEQEMAEVPVA  273



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   394 bits (1013),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFDLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            +YYPVE  +VE EM EVP+A
Sbjct  254  NYYPVELESVEQEMAEVPVA  273



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   394 bits (1013),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFDLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            +YYPVE  +VE EM EVP+A
Sbjct  254  NYYPVELESVEQEMAEVPVA  273



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   394 bits (1011),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+DLSV+EAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRYDLSVKEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            +YYPVE AAVE EM EVP+A
Sbjct  254  NYYPVEVAAVEQEMAEVPVA  273



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   393 bits (1009),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR DLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRNDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYP+E AAVE EM EV +A
Sbjct  254  HYYPIEVAAVEQEMAEVSVA  273



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   393 bits (1009),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYRFDLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVE  AVE EMTEV IA
Sbjct  254  KYYPVEPTAVEQEMTEVSIA  273



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   390 bits (1001),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+A
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIA  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASK+LANILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKMLANILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFDLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGW+KLSGDDVGELHY
Sbjct  194  VLDSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWEKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVE A VE EMTEV IA
Sbjct  254  KYYPVETAVVEQEMTEVAIA  273



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   384 bits (985),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
            HYYPV   AVE EM EV
Sbjct  253  HYYPVVQGAVEQEMVEV  269



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   383 bits (983),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+S+EEAAELARR+IYHATFRDAASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
            HYYPV  + VE EM EV
Sbjct  253  HYYPVTPSTVEQEMAEV  269



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   383 bits (983),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLH+LANKRRISVA
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHKLANKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+DLSVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            +YYPV    V+ EMTEV  A
Sbjct  253  NYYPVTPTTVDQEMTEVTAA  272



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   382 bits (982),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEV  155
            HYYPV A +VE EM EV
Sbjct  254  HYYPVVAGSVEQEMVEV  270



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   382 bits (982),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+S+EEAAELARR+IYHATFRDAASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
            HYYPV  + VE EM EV
Sbjct  253  HYYPVTPSTVEQEMAEV  269



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   382 bits (982),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+S+EEAAELARR+IYHATFRDAASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
            HYYPV  + VE EM EV
Sbjct  253  HYYPVTPSTVEQEMAEV  269



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   382 bits (982),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  193  VLDDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPV   AVE EM EV  A
Sbjct  253  HYYPVVEGAVEQEMVEVAAA  272



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   382 bits (982),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLL NILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG +FSVGSGSPYAYG
Sbjct  135  GASKLLGNILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTKFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD+G+RFDLSVEEAAELARR+IYHATFRD ASGGVASVYH+GPNGWKKLSGDDVGELHY
Sbjct  195  ILDSGHRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHIGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVE A VE EM+EV I+
Sbjct  255  LYYPVEPATVEREMSEVAIS  274



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   382 bits (980),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLSVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEVP  152
            HYYPV  + VE EM E P
Sbjct  253  HYYPVTPSTVEQEMVEAP  270



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   381 bits (979),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR HELANKRRISVA
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRRHELANKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+DLSVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            +YYPV    V+ EMTEV  A
Sbjct  253  NYYPVTPTTVDQEMTEVTAA  272



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   381 bits (979),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFD+ VEEAAELARR+IYHATFRD ASGGVASVYHVGP+GWKKLSGDDVGELHY
Sbjct  194  VLDSGYRFDMPVEEAAELARRAIYHATFRDGASGGVASVYHVGPDGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPV    VE EMT+ P A
Sbjct  254  KYYPVAPTPVEQEMTDAPAA  273



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   380 bits (976),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARRSIYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSVEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  + VE EM EV
Sbjct  253  KYYPVMPSTVEQEMVEV  269



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLSVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  + VE EM E
Sbjct  253  HYYPVTPSTVEQEMVE  268



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLSVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  + VE EM E
Sbjct  253  HYYPVTPSTVEQEMVE  268



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   377 bits (968),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSV+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  2    SRASMGGYISSQSVEKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  61

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  62   GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  121

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  122  VLDDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  181

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPV   AVE EM EV  A
Sbjct  182  HYYPVVEGAVEQEMVEVAAA  201



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   379 bits (974),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLSVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  + VE EM E
Sbjct  253  HYYPVTPSTVEQEMVE  268



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   379 bits (974),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVY VGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYXVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEV  155
            HYYPV A +VE EM EV
Sbjct  254  HYYPVVAGSVEQEMVEV  270



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GWKKLSGDDVGELHY
Sbjct  195  VLDSGYRFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV     EHEM E
Sbjct  255  HYYPVAPTTAEHEMAE  270



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   379 bits (972),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  78   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  138  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEA+ELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  198  VLDNGYRYDMSVEEASELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV    VE EM EV
Sbjct  258  EYYPVTPETVEQEMVEV  274



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   378 bits (971),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E EM E
Sbjct  255  HYYPVVPATAEQEMEE  270



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   378 bits (971),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  + VE EM EV
Sbjct  253  KYYPVMPSTVEQEMVEV  269



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   378 bits (970),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLS+EEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDLSIEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  + VE EM EV
Sbjct  253  KYYPVMPSTVEQEMVEV  269



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   377 bits (969),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGT+AGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLSVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  + VE EM E
Sbjct  253  HYYPVTPSTVEQEMVE  268



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   377 bits (969),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  + VE EM EV
Sbjct  253  KYYPVMPSTVEQEMVEV  269



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   377 bits (969),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLL NILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLTNILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELH+
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHF  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV    VE EM+EV
Sbjct  253  KYYPVTPGTVEQEMSEV  269



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   377 bits (968),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  + VE EM EV
Sbjct  253  KYYPVMPSTVEQEMVEV  269



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   377 bits (968),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+S+EEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELH+
Sbjct  193  VLDNGYRYDMSIEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHF  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV    VE EM EV
Sbjct  253  KYYPVSPGTVEQEMVEV  269



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVG NGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV   AVE EM EV
Sbjct  253  SYYPVVPGAVEQEMVEV  269



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVG NGWKKLSGDDVGELHY
Sbjct  193  VLDDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV A AVE EM EV
Sbjct  253  SYYPVVAGAVEQEMVEV  269



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   376 bits (966),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPATAEQVMEE  270



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   376 bits (965),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+SVEEAAELARR+IYHATFRD ASGGVASVYHVGP GWKKLSGDDVGELHY
Sbjct  193  VLDSGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPTGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
            HY+PV  + VE EM EV
Sbjct  253  HYHPVTPSTVEQEMAEV  269



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   376 bits (965),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  73   SRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRDAASGGVASVY+VGP+GWKKLSGDDVGELH+
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHF  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  +  E EM EV
Sbjct  253  RYYPVAPSPTEQEMAEV  269



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   376 bits (965),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  73   SRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+S+EEAAELARR+IYHATFRD ASGGVASVY+VG +GWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSIEEAAELARRAIYHATFRDGASGGVASVYYVGRDGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEVP  152
             YYPV  + VEHEM EVP
Sbjct  253  TYYPVAPSPVEHEMAEVP  270



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   375 bits (963),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  + +E EM EV
Sbjct  253  RYYPVMPSTIEQEMAEV  269



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   375 bits (963),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   375 bits (963),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 187/196 (95%), Gaps = 1/196 (1%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  141  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  200

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL GNRFSVGSGSPYAYG
Sbjct  201  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLNGNRFSVGSGSPYAYG  260

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFD+SVEEAAELARR+IYHATFRD ASGGV SVYHVGP+GWKKLSGDDVGELHY
Sbjct  261  VLDSGYRFDMSVEEAAELARRAIYHATFRDGASGGVVSVYHVGPDGWKKLSGDDVGELHY  320

Query  205  HYYPVEAAAVEHEMTE  158
             YYPVE   VEHEM E
Sbjct  321  AYYPVE-PTVEHEMAE  335



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  + VE EM EV
Sbjct  253  RYYPVMPSTVEQEMVEV  269



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  +  E  M E
Sbjct  255  HYYPVPPSTAEQVMEE  270



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  73   SRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+S+EEAAELARR+IYHATFRD ASGGV SVY+VG +GWKKLSGDDVGELHY
Sbjct  193  VLDNGYRYDMSIEEAAELARRAIYHATFRDGASGGVVSVYYVGRDGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPV  + VEHEM EVP A
Sbjct  253  TYYPVAPSPVEHEMAEVPPA  272



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  +  E  M E
Sbjct  255  HYYPVPPSTAEQVMEE  270



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   374 bits (961),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASK+LANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKMLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  193  VLDSGYKYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTE  158
            HY PV  + VE EM E
Sbjct  253  HYNPVVPSTVEQEMVE  268



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   374 bits (961),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+SV EAAELARR+IYHATFRD ASGGVASVY+VGP+GWKKLSGDDVGELHY
Sbjct  193  VLDDGYRYDMSVHEAAELARRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV A  VE EM EV
Sbjct  253  KYYPVTAGTVEQEMAEV  269



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVAPATAEQVMEE  270



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   374 bits (959),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGW KLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   373 bits (958),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGW KLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   373 bits (958),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  72   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  131

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  132  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  191

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARR+IYHATFRD ASGGVASVY+VGP GWKKLSGDDVGELHY
Sbjct  192  VLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHY  251

Query  205  HYYPVEAAAVEHEMTE  158
            HY PV  + VE EM E
Sbjct  252  HYNPVTPSTVEQEMVE  267



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   373 bits (958),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+S+EEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  EH M E
Sbjct  255  HYYPVAPATAEHVMEE  270



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   373 bits (958),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+S+EEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  EH M E
Sbjct  255  HYYPVAPATAEHVMEE  270



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   372 bits (955),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV     EH M E
Sbjct  255  HYYPVAPITAEHVMEE  270



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   372 bits (954),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+R SVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRLSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD++VEEA+ELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKFDMTVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   371 bits (952),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLG+MAGG+ADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGSMAGGSADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+S+EEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  EH M E
Sbjct  255  HYYPVAPATAEHVMEE  270



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   371 bits (952),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  73   SRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE G GLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGAGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+S+EEAAELARR+IYHATFRDAASGGVASVY+VGP+GWKKLSGDDVGELH+
Sbjct  193  VLDNGYRYDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHF  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV     E EM EV
Sbjct  253  RYYPVAPNPTEQEMAEV  269



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   368 bits (944),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -1

Query  727  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  548
            GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLL
Sbjct  1    GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLL  60

Query  547  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGY  368
            ANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY
Sbjct  61   ANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGY  120

Query  367  RFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  188
            +FD+S+EEAAELARR+IYHATFRDAASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV 
Sbjct  121  KFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVT  180

Query  187  AAAVEHEMTEV  155
             + VE EM EV
Sbjct  181  PSTVEQEMAEV  191



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   370 bits (951),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILY+YRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYNYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGY++D++VEEA+ELARR+IYHAT+RD ASGGV SVYHVGP+GWKKL+GDDVGELHY
Sbjct  193  VLDNGYQYDMTVEEASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKLTGDDVGELHY  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  A VE EM EV
Sbjct  253  QYYPVVPATVEQEMAEV  269



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   370 bits (950),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISS SVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  72   SRASMGGYISSHSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  131

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  132  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  191

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARR+IYHATFRD ASGGVASVY+VGP GWKKLSGDDVGELHY
Sbjct  192  VLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHY  251

Query  205  HYYPVEAAAVEHEMTE  158
            HY PV  + VE EM E
Sbjct  252  HYNPVTPSTVEQEMVE  267



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   370 bits (949),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVG NGW KLSGDDVGELHY
Sbjct  195  VLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGSNGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   370 bits (949),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGR+KG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRIKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D++VEEAAELARRSIYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKYDMTVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
             YYPV  ++ E  M+E
Sbjct  255  KYYPVTPSSAEQVMSE  270



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   369 bits (948),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPY++GT+AGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  78   SRASMGGYISSQSVKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRLHELANKRRISVT  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  138  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+S EEAAELARRSIYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  198  VLDSGYRYDMSCEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTE  158
             YYPV    VE EM E
Sbjct  258  KYYPVPKGNVEQEMVE  273



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   369 bits (948),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVAPATAEQVMEE  270



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   369 bits (947),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVAPATAEQVMEE  270



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   369 bits (947),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP+GW KLSGDDVGELHY
Sbjct  195  VLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPDGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVAPAIAEQVMEE  270



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   369 bits (946),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVAPAIAEQVMEE  270



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   368 bits (945),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHELANKRRIS+A
Sbjct  76   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELANKRRISIA  135

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            G+SK+LANILYSYRGMGLS+GTMIAG+DE GPGLYYVDSEG RLKGNRFSVGSGS YAYG
Sbjct  136  GSSKMLANILYSYRGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGNRFSVGSGSLYAYG  195

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GY+F++SVEEA ELARR+IYHATFRD ASGG  SVYHVGPNGWKKLSGDDVGELHY
Sbjct  196  ILDEGYKFNMSVEEAGELARRAIYHATFRDGASGGCVSVYHVGPNGWKKLSGDDVGELHY  255

Query  205  HYYPVEAAAVEHEMTEVPIA*T  140
            HYYPV+AA VE EM + P A T
Sbjct  256  HYYPVQAAPVEQEMADAPSAST  277



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   368 bits (944),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = -1

Query  745  SRASMGGYIS-SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  569
            SRASMGGYI  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV
Sbjct  75   SRASMGGYICMSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV  134

Query  568  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAY  389
            +GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAY
Sbjct  135  SGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAY  194

Query  388  GVLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELH  209
            GVLD+GY+FD+SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GWKKLSGDDVGELH
Sbjct  195  GVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELH  254

Query  208  YHYYPVEAAAVEHEMTE  158
            YHYYPV     EH M E
Sbjct  255  YHYYPVTPVTAEHVMEE  271



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   368 bits (944),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPY+LGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+ VEEAAELARRSIYHATFRD ASGGVASVY+VGP GWKKLSGDDV ELH+
Sbjct  193  VLDSGYRWDMPVEEAAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVAELHF  252

Query  205  HYYPVEAAAVEHEMTEV  155
            +YYPV    VE EM EV
Sbjct  253  NYYPVTENVVEQEMVEV  269



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   368 bits (945),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+A
Sbjct  79   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGNKCRLHELSNKRRISIA  138

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL GN+FSVGSGS YAYG
Sbjct  139  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNKFSVGSGSLYAYG  198

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRF++SVEEAAELARR+IY ATFRDAASGG  SVYHVGP+GW KLSGDDVGELHY
Sbjct  199  VLDDGYRFNMSVEEAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHY  258

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPV+   VE EMT+ P A
Sbjct  259  HYYPVQKTPVEQEMTDAPTA  278



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   367 bits (943),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILY+YRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYNYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGY++D++VEEA+ELARR+IYHAT+RD ASGGV SVYHVGP+GWKK++GDDVG+LH+
Sbjct  193  VLDNGYKYDMTVEEASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKVTGDDVGDLHF  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV  A VE EM EV
Sbjct  253  QYYPVVPATVEQEMVEV  269



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   367 bits (943),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+A
Sbjct  79   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELSNKRRISIA  138

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL GNRFSVGSGS YAYG
Sbjct  139  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNRFSVGSGSLYAYG  198

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD+GYRF +SVEEAAELARR+IY ATFRDAASGG  SVYHVGP+GW KLSGDDVGELHY
Sbjct  199  ILDDGYRFSMSVEEAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHY  258

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPV+   VE EM + P A
Sbjct  259  HYYPVQKTPVEQEMADAPTA  278



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   367 bits (942),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR HEL NKRRISV 
Sbjct  74   SRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCRRHELENKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAY 
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYC  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGY++DLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  194  VLDNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  253

Query  205  HYYPVEAAAVEHEMTEVPI  149
             YYPV    VE EM EV +
Sbjct  254  KYYPVVHDTVEQEMIEVTV  272



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   367 bits (942),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++++SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVP  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGR+KG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRIKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D++VEEAAELARRSIYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGYKYDMTVEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
             YYPV  +  E  M E
Sbjct  255  KYYPVAPSTAEQVMAE  270



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++++SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINP++LGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSIGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+D+ VEEAAELARRSIYHATFRD ASGGVASVY+VGP GWKKLSGDDVGELH+
Sbjct  193  VLDSGYRWDMPVEEAAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVGELHF  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYPV    VE EM EV
Sbjct  253  KYYPVTENVVEQEMVEV  269



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVS  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYG
Sbjct  135  GASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++++SVEEA+ELARRSIYHATFRD ASGGVASVYHVGP GW KLSGDDVGELHY
Sbjct  195  VLDSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
            HYYPV  A  E  M E
Sbjct  255  HYYPVPPAIAEQVMEE  270



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   366 bits (940),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  72   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  131

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMG SVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  132  GASKLLANILYSYRGMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  191

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARR+IYHATFRD ASGGVASVY+VGP G KKLSGDDVGELHY
Sbjct  192  VLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHY  251

Query  205  HYYPVEAAAVEHEMTE  158
            HY PV  + VE EM E
Sbjct  252  HYNPVTPSTVEQEMVE  267



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   367 bits (941),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR HEL NKRRISV 
Sbjct  90   SRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCRRHELENKRRISVT  149

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAY 
Sbjct  150  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYC  209

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGY++DLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVGELHY
Sbjct  210  VLDNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  269

Query  205  HYYPVEAAAVEHEMTEVPI  149
             YYPV    VE EM EV +
Sbjct  270  KYYPVVHDTVEQEMIEVTV  288



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   366 bits (940),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+A
Sbjct  78   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIA  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            G+SK LANILYSYRGMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG
Sbjct  138  GSSKTLANILYSYRGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GY+F++SVEEAAELARR+IYHATFRD ASGG  SVY+VGP+GWKKLSGDDVGELHY
Sbjct  198  ILDEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTEVPIA*T  140
            HYYPV+AA VE EM E P A T
Sbjct  258  HYYPVQAAPVEQEMAEAPSAST  279



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   364 bits (935),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+A
Sbjct  25   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIA  84

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            G+SK LANILYSYRGMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG
Sbjct  85   GSSKTLANILYSYRGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYG  144

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GY+F++SVEEAAELARR+IYHATFRD ASGG  SVY+VGP+GWKKLSGDDVGELHY
Sbjct  145  ILDEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHY  204

Query  205  HYYPVEAAAVEHEMTEVPIA*T  140
            HYYPV+AA VE EM E P A T
Sbjct  205  HYYPVQAAPVEQEMAEAPSAST  226



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   366 bits (939),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+A
Sbjct  79   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGNKCRLHELSNKRRISIA  138

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL GNRFSVGSGS YAYG
Sbjct  139  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNRFSVGSGSLYAYG  198

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GYRF++SVEEA ELARR+IY ATFRDAASGG  SVYHVGP+GWKKLSGDDVGELHY
Sbjct  199  ILDEGYRFNMSVEEAGELARRAIYGATFRDAASGGCVSVYHVGPDGWKKLSGDDVGELHY  258

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPV+   VE EMT+ P A
Sbjct  259  HYYPVQKTPVEQEMTDAPSA  278



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   366 bits (939),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+A
Sbjct  78   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIA  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            G+SK LANILYSYRGMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG
Sbjct  138  GSSKTLANILYSYRGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GY+F++SVEEAAELARR+IYHATFRD ASGG  SVY+VGP+GWKKLSGDDVGELHY
Sbjct  198  ILDEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTEVPIA*T  140
            HYYPV+AA VE EM E P A T
Sbjct  258  HYYPVQAAPVEQEMAEAPSAST  279



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   360 bits (924),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+A
Sbjct  25   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIA  84

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG
Sbjct  85   GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYG  144

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GYR+ + VEEAAELARR+IY ATFRD ASGG  SVYHVGPNGW KLSGDDVGELHY
Sbjct  145  ILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHY  204

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVEA  VE EM + P A
Sbjct  205  KYYPVEATPVEQEMADAPAA  224



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   361 bits (927),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFD+S+EEAAEL RR+IYHATFRD ASGGVASVY+VGP+GWKKLSGDDV ELHY
Sbjct  194  VLDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHY  253

Query  205  HYYPV  191
            +YYPV
Sbjct  254  NYYPV  258



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   361 bits (926),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+A
Sbjct  78   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIA  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG
Sbjct  138  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GYR+ + VEEAAELARR+IY ATFRD ASGG  SVYHVGPNGW KLSGDDVGELHY
Sbjct  198  ILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVEA  VE EM + P A
Sbjct  258  KYYPVEATPVEQEMADAPAA  277



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   360 bits (925),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  74   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  134  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD+GYRFD+S+EEAAEL RR+IYHATFRD ASGGVASVY+VGP+GWKKLSGDDV ELHY
Sbjct  194  ILDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHY  253

Query  205  HYYPV  191
            +YYPV
Sbjct  254  NYYPV  258



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   360 bits (925),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+A
Sbjct  78   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIA  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG
Sbjct  138  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GYR+ + VEEAAELARR+IY ATFRD ASGG  SVYHVGPNGW KLSGDDVGELHY
Sbjct  198  ILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVEA  VE EM + P A
Sbjct  258  KYYPVEATPVEQEMADAPAA  277



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   360 bits (925),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+A
Sbjct  78   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIA  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG
Sbjct  138  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GYR+ + VEEAAELARR+IY ATFRD ASGG  SVYHVGPNGW KLSGDDVGELHY
Sbjct  198  ILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVEA  VE EM + P A
Sbjct  258  KYYPVEATPVEQEMADAPAA  277



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   360 bits (924),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+A
Sbjct  78   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIA  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG
Sbjct  138  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GYR+ + VEEAAELARR+IY ATFRD ASGG  SVYHVGPNGW KLSGDDVGELHY
Sbjct  198  ILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPVEA  VE EM + P A
Sbjct  258  KYYPVEAIPVEQEMADAPAA  277



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   358 bits (918),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  739  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  560
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GA
Sbjct  26   ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGA  85

Query  559  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  380
            SKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+L
Sbjct  86   SKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGIL  145

Query  379  DNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHYHY  200
            D+GYR+DLSV+EA EL RR+IYHATFRD ASGGV SVYHVGP GWKK +GDDVG+LHY Y
Sbjct  146  DSGYRYDLSVDEAVELGRRAIYHATFRDGASGGVVSVYHVGPEGWKKWTGDDVGDLHYQY  205

Query  199  YPVEAAAVEHEMTE  158
            YPV  + VE EM E
Sbjct  206  YPVVPSTVEQEMAE  219



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   358 bits (920),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  72   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  131

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMG SVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYG
Sbjct  132  GASKLLANILYSYRGMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  191

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++D+SVEEA+ELARR+IYHATFRD ASGGVASVY+VGP G KKLSGDDVGELHY
Sbjct  192  VLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHY  251

Query  205  HYYPVEAAAVE  173
            HY PV  + VE
Sbjct  252  HYNPVTPSTVE  262



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   359 bits (921),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVA
Sbjct  77   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL G RFSVGSGS YAYG
Sbjct  137  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGTRFSVGSGSLYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD GYR+ +SVEEA ELARR+IYHATFRD ASGG  SVYHVG +GWKKLSGDDVGELHY
Sbjct  197  ILDEGYRYVMSVEEAGELARRAIYHATFRDGASGGCVSVYHVGADGWKKLSGDDVGELHY  256

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYPV+A  VE EM + P A
Sbjct  257  KYYPVQATPVEQEMADAPAA  276



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   357 bits (917),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 2/198 (1%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  76   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  135

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANIL+SYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  136  GASKLLANILFSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  195

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD+GYRFD+S+EEAAEL RR+IYHATFRD ASGGVASVY+VG NGW KLSGDDV ELHY
Sbjct  196  ILDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHY  255

Query  205  HYYPVEAAAVEH--EMTE  158
             YYPV +A      +M E
Sbjct  256  KYYPVVSAETSEPDQMVE  273



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   356 bits (914),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGG ADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  76   SRASMGGYISSQSVKKIIEINPYMLGTMAGGGADCQFWHRNLGIKCRLHELANKRRISVT  135

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANIL+SYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  136  GASKLLANILFSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  195

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYRFD+S+EEAAEL RR+IYHATFRD ASGGVASVY+VG NGW KLSGDDV ELHY
Sbjct  196  VLDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHY  255

Query  205  HYYPVEAA  182
             YYPV +A
Sbjct  256  KYYPVVSA  263



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   357 bits (916),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 185/220 (84%), Gaps = 24/220 (11%)
 Frame = -1

Query  745  SRASMGGYIS------------------------SQSVKKIIEINPYMLGTMAGGAADCQ  638
            SRASMGGYIS                        SQSVKKIIEINPYMLGTMAGGAADCQ
Sbjct  75   SRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINPYMLGTMAGGAADCQ  134

Query  637  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYY  458
            FWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYY
Sbjct  135  FWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYY  194

Query  457  VDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGV  278
            VD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEEA+ELARRSIYHATFRD ASGGV
Sbjct  195  VDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGASGGV  254

Query  277  ASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  158
            ASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  255  ASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQVMEE  294



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   346 bits (888),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/174 (97%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = -1

Query  739  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  560
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRR SVAGA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGA  60

Query  559  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  380
            SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL
Sbjct  61   SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  120

Query  379  DNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVG  218
            D+GYRFDLSVEEAAELARR+IYHATFRD ASGGVASVYHVGPNGWKKLSGDDVG
Sbjct  121  DSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  174



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISV 
Sbjct  71   SRASMGNYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVT  130

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN LYSYRGMGLS+GTMIAGWDE GPGLYYVDSEGGR+KG RFSVGSGS YAYG
Sbjct  131  GASKLLANTLYSYRGMGLSMGTMIAGWDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYG  190

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD G+ +D+S++EA ELARRSIYHATFRD ASGGV SVY+VGP GWKK+SGDDVGELHY
Sbjct  191  VLDTGFNWDMSIDEAVELARRSIYHATFRDGASGGVVSVYYVGPGGWKKMSGDDVGELHY  250

Query  205  HYYPVEAAAVEHEMTE  158
             YYPV+    E EM E
Sbjct  251  SYYPVQEVPAEAEMGE  266



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   343 bits (880),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YISSQ VKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHEL NKRRISV 
Sbjct  78   SRASMGNYISSQDVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELGNKRRISVT  137

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN LYSYRGMGLS+GTMIAGWDE GPGLYYVDSEGGR+KG RFSVGSGS YAYG
Sbjct  138  GASKLLANTLYSYRGMGLSMGTMIAGWDETGPGLYYVDSEGGRVKGRRFSVGSGSTYAYG  197

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD G+R+D++VEEA ELARRSIYHATFRD ASGGVASVY+VGP+GWKK+SGDDVGELHY
Sbjct  198  VLDTGFRWDMTVEEAVELARRSIYHATFRDGASGGVASVYYVGPDGWKKMSGDDVGELHY  257

Query  205  HYYPVEAAAVEHEMT  161
             YYPV  A  E E+ 
Sbjct  258  KYYPVSDAPAEQEVV  272



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   367 bits (941),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -1

Query  745   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
             SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+A
Sbjct  1319  SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIA  1378

Query  565   GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             G+SK LANILYSYRGMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG
Sbjct  1379  GSSKTLANILYSYRGMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYG  1438

Query  385   VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
             +LD GY+F++SVEEAAELARR+IYHATFRD ASGG  SVY+VGP+GWKKLSGDDVGELHY
Sbjct  1439  ILDEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHY  1498

Query  205   HYYPVEAAAVEHEMTEVPIA*T  140
             HYYPV+AA VE EM E P A T
Sbjct  1499  HYYPVQAAPVEQEMAEAPSAST  1520



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   338 bits (866),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISVA
Sbjct  75   SRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVA  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN LYSYRGMGLS+GTMIAGWDE GP L+YVDSEGGR KG  FSVGSGS YAYG
Sbjct  135  GASKLLANTLYSYRGMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFSVGSGSTYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD+GY+F++SVEEA EL RR+IYHATFRD ASGGVASVYH+GP GWKK+SGDDV ELHY
Sbjct  195  ILDSGYKFEMSVEEAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHY  254

Query  205  HYYPVEAAAVEHEMTE  158
             YYP E+ A   ++ E
Sbjct  255  QYYPPESQASAPDVVE  270



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   335 bits (860),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISVA
Sbjct  73   SRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN LYSYRGMGLS+GTMIAGWDE GP L+YVDSEGGR KG  FSVGSGS YAYG
Sbjct  133  GASKLLANTLYSYRGMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFSVGSGSTYAYG  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD+GY++++SVEEA EL RR+IYHATFRD ASGGVASVYH+GP GWKK+SGDDV ELHY
Sbjct  193  ILDSGYKYEMSVEEAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHY  252

Query  205  HYYPVEAAAVEHEMTE  158
             YYP E+ A   ++ E
Sbjct  253  QYYPPESQASAPDVVE  268



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   329 bits (843),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SR SMGGY++SQ+VKKI+EINPYM+ T+AGGAADC FWHRNLG+KCRL+EL NKRRISVA
Sbjct  73   SRTSMGGYVASQNVKKIVEINPYMIATVAGGAADCIFWHRNLGMKCRLYELENKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLL N+LYSYRGMGLS+GTM+AG DE GP LYYVDSEGGRLKG+RFSVGSGSPYAY 
Sbjct  133  GASKLLTNMLYSYRGMGLSIGTMVAGCDEMGPSLYYVDSEGGRLKGSRFSVGSGSPYAYA  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+   EAAELARR+IYHATFRD ASGGVA VYHVGP+GWKK+SGDDV ELH 
Sbjct  193  VLDNGYRYDMPTGEAAELARRAIYHATFRDGASGGVAVVYHVGPDGWKKISGDDVRELHD  252

Query  205  HYYPVEAAAVEHEMTEVP  152
             YYP      E EM +VP
Sbjct  253  KYYPAVQVPPEQEMMQVP  270



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   327 bits (837),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 167/200 (84%), Gaps = 17/200 (9%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+A
Sbjct  79   SRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELSNKRRISIA  138

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL G              
Sbjct  139  GASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARLVG--------------  184

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
               N YRF +SVEEAAELARR+IY ATFRDAASGG  SVYHVGP+GW KLSGDDVGELHY
Sbjct  185  ---NSYRFSMSVEEAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHY  241

Query  205  HYYPVEAAAVEHEMTEVPIA  146
            HYYPV+   VE EM + P A
Sbjct  242  HYYPVQKTPVEQEMADAPTA  261



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   327 bits (837),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SR SMGGY++SQ+VKKI+EINP+M+ T+AGGAADC FWHRNLGVKCRL+EL NKRRISVA
Sbjct  73   SRTSMGGYVASQNVKKIVEINPHMIATVAGGAADCIFWHRNLGVKCRLYELENKRRISVA  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLL N+LYSYRGM LSVGTMIAGWDE GP LYYVDSEGGRLKG+RFSVGSGSPYAY 
Sbjct  133  GASKLLTNMLYSYRGMELSVGTMIAGWDEMGPSLYYVDSEGGRLKGSRFSVGSGSPYAYA  192

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGYR+D+ + EAAELARR+IYHATFRD ASGGVA V HVGP+GWKKLSGDDV ELH 
Sbjct  193  VLDNGYRYDMPLGEAAELARRAIYHATFRDGASGGVAIVCHVGPDGWKKLSGDDVKELHD  252

Query  205  HYYPVEAAAVEHEMTEV  155
             YYP      E EM ++
Sbjct  253  KYYPAVQVPAEQEMMQI  269



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 167/202 (83%), Gaps = 3/202 (1%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            S ASMG  ISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKR ISV 
Sbjct  35   SSASMGNSISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRHISVT  94

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN LYSYRGMGL +GTMIAGWDE GPGLYYVDSEGGR+KG RFSVGSGS YAYG
Sbjct  95   GASKLLANTLYSYRGMGLFMGTMIAGWDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYG  154

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASV---YHVGPNGWKKLSGDDVGE  215
            VLD  ++ D+S++EA ELARRSIYHAT RD ASGGV  +      GP+GWKK+SGDD GE
Sbjct  155  VLDTVFKQDMSIDEAVELARRSIYHATLRDGASGGVTLLKCSLLCGPSGWKKMSGDDGGE  214

Query  214  LHYHYYPVEAAAVEHEMTEVPI  149
            LH+ YYPV+    E EM+E  +
Sbjct  215  LHHSYYPVQETPAEAEMSEASV  236



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG++CRLHEL N +RISV+
Sbjct  77   SRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRISVS  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLL+N LY YRG GLS+GTM+AGWD  GPGLYYVDS+G RLKG RFSVGSGS +AYG
Sbjct  137  GASKLLSNTLYGYRGQGLSMGTMVAGWDLNGPGLYYVDSDGTRLKGKRFSVGSGSLFAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GYR+DLSVE+A EL RR+IYHATFRDA SGG  SVYHVGP+GW K+SG DVGELHY
Sbjct  197  VLDQGYRWDLSVEDACELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHY  256

Query  205  HYYPVE  188
             YYP +
Sbjct  257  EYYPAD  262



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG++CRLHEL N +RI+V 
Sbjct  81   SRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRITVR  140

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN LYSY+G GLS+GTMIAGWD  GPGLYYVDSEG RLKG RFSVGSGS +AYG
Sbjct  141  AASKLLANTLYSYKGRGLSMGTMIAGWDLNGPGLYYVDSEGTRLKGQRFSVGSGSLFAYG  200

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GYR+DLSV+EA EL RR+IYHATFRDA SGG  SVYHVG NGW K++GDDVGELH+
Sbjct  201  VLDQGYRWDLSVKEACELGRRAIYHATFRDAFSGGTVSVYHVGKNGWTKVTGDDVGELHF  260

Query  205  HYYPVE  188
            HYYP E
Sbjct  261  HYYPSE  266



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -1

Query  652  AADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKG  473
            AADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE G
Sbjct  70   AADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETG  129

Query  472  PGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDA  293
            PGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY++D+S+EEA+ELARR+IYHATFRD 
Sbjct  130  PGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKYDMSIEEASELARRAIYHATFRDG  189

Query  292  ASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  158
            ASGGVASVY+VGP GWKKLSGDDVGELHYHY PV  + VE EM E
Sbjct  190  ASGGVASVYYVGPTGWKKLSGDDVGELHYHYNPVTPSTVEQEMVE  234



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   310 bits (793),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG++CRLHEL N +RISVA
Sbjct  80   SRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRISVA  139

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN LY YRG GLS+GTM+AGWD KGPGLYYVDS+G RLKG RFSVGSGS +AYG
Sbjct  140  GASKLLANTLYGYRGQGLSMGTMVAGWDLKGPGLYYVDSDGTRLKGQRFSVGSGSLFAYG  199

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GYR+DLSVEEA EL RR+IYHATFRDA SGG  SVYHV  NGW K+SG DVGELH+
Sbjct  200  VLDQGYRWDLSVEEACELGRRAIYHATFRDAFSGGTISVYHVNENGWTKVSGTDVGELHF  259

Query  205  HYYPVE  188
             YYP +
Sbjct  260  EYYPAD  265



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG++CRLHEL   +RI+V 
Sbjct  83   SRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELETGKRITVT  142

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN LY YRG GLS+GTM+AGWD  GPGL+YVDS+G RLKG RFSVGSGS +AYG
Sbjct  143  GASKLLANTLYGYRGRGLSMGTMVAGWDTTGPGLFYVDSDGTRLKGKRFSVGSGSLFAYG  202

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD G+R DLS++EAAEL RR+IYHATFRDA SGG  SVYHVGP+GW K+SG DVGELHY
Sbjct  203  VLDQGFRHDLSIKEAAELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHY  262

Query  205  HYYPVEAA  182
             YYP +A 
Sbjct  263  EYYPADAV  270



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   306 bits (783),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG++CRLHEL N +RI+V 
Sbjct  82   SRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRITVR  141

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN LYSY+G GLS+GTM+AGWD  GPGLYYVDSEG RLKG RFSVGSGS +AYG
Sbjct  142  AASKLLANTLYSYKGKGLSMGTMVAGWDLNGPGLYYVDSEGTRLKGQRFSVGSGSLFAYG  201

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY++DL+VEEA EL RR+IYHATFRDA SGG  SVYHVG NGW K++GDDVGELH+
Sbjct  202  VLDQGYKWDLTVEEACELGRRAIYHATFRDAFSGGTVSVYHVGANGWTKVTGDDVGELHF  261

Query  205  HYYP  194
             YYP
Sbjct  262  SYYP  265



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 157/197 (80%), Gaps = 25/197 (13%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  75   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILY+YRGMGLSVGTM+AGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  135  GASKLLANILYNYRGMGLSVGTMVAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+G      V                          VY+VGPNGWKKLSGDDVGELHY
Sbjct  195  VLDSGGLTKFYVL-------------------------VYYVGPNGWKKLSGDDVGELHY  229

Query  205  HYYPVEAAAVEHEMTEV  155
            HYYPV  + VE EM EV
Sbjct  230  HYYPVMPSTVEQEMVEV  246



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG +CRL+EL N +RISV 
Sbjct  77   SRASMGSYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGQQCRLYELNNGKRISVR  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN+++SY+G GLS+GTM+AG+D  GPGLYYVDS+G R KG  FSVGSGS YAYG
Sbjct  137  AASKLLANVMFSYKGYGLSMGTMVAGYDPTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDNGY++D+ VE+A EL RRSIYHATFRDA SGG  SVYHV  +GWKK+ GDDVGELHY
Sbjct  197  VLDNGYKWDMDVEDAIELGRRSIYHATFRDAVSGGTVSVYHVTADGWKKVRGDDVGELHY  256

Query  205  HYYPVEAAAVEHEMTEVPIA  146
             YYP   A   H    +  A
Sbjct  257  EYYPTPEAHPCHRADPLETA  276



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   296 bits (759),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 166/205 (81%), Gaps = 8/205 (4%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG +CRL+ELAN +RI+V 
Sbjct  77   SRASQGSYISSQTVKKVIEINPHLLGTMAGGAADCQFWERNLGRQCRLYELANGKRITVR  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLAN ++SYRGMGLS+GTM+AGWDE GPGLYYVDS+G R KG  FSVGSGS YAYG
Sbjct  137  GASKLLANTMFSYRGMGLSMGTMVAGWDEAGPGLYYVDSDGQRTKGKLFSVGSGSLYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GYR+DLSVEEA EL +RSIYHATFRDAASGG  S YHV   GW K+ G+DVG+LH+
Sbjct  197  VLDEGYRWDLSVEEAVELGQRSIYHATFRDAASGGTVSAYHVTQEGWTKVRGEDVGQLHF  256

Query  205  HYYPVEAAAVEHEMTEVPIA*TDPF  131
            +YYP   A  EH     P    DP 
Sbjct  257  NYYP---APEEH-----PCNSKDPL  273



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 162/199 (81%), Gaps = 3/199 (2%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG +ISSQ+VKK+IEIN +++GTMAGGAADCQFW RNLG++CRL+EL N +RI+V 
Sbjct  76   SRATMGSFISSQTVKKVIEINKHLIGTMAGGAADCQFWQRNLGMRCRLYELNNGKRITVC  135

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN ++SYRGMGLS+GTM+AGWD  GPGLYYVDS+G R KG  FSVGSGS YAYG
Sbjct  136  AASKLLANTMFSYRGMGLSMGTMVAGWDSTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYG  195

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLSVEEA EL RRSIYHA FRD ASGG  SVYHV  +GW K+ GDDV ELHY
Sbjct  196  VLDSGYRWDLSVEEAIELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDVTELHY  255

Query  205  HYYPVEAAAVEHEMTEVPI  149
             YYP  A   +H  T   +
Sbjct  256  QYYPDPA---QHPATATSV  271



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   286 bits (732),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -1

Query  739  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  560
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAAD QFWHRNLG+KCRLHELANKRRISV+GA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGA  60

Query  559  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  380
            SKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVL
Sbjct  61   SKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVL  120

Query  379  DNGYRFDLSVEEAAELARRSIYHATFRDAA  290
            D+GY+FD+SVEEA+ELARRSIYHATFRD A
Sbjct  121  DSGYKFDMSVEEASELARRSIYHATFRDGA  150



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YISSQ+VKK+IEIN ++LGTMAGGAADCQFW RNLG++CRL+EL N +RI+V 
Sbjct  77   SRATMGAYISSQTVKKVIEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVR  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLL+N+++SYRGMGLS+GTM+AGWD  GPGLYYVDS+G R KG  FSVGSGS YAYG
Sbjct  137  AASKLLSNVMFSYRGMGLSMGTMVAGWDPTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GYR+D+ VEEA EL RRSIYHA FRD ASGG  SVYHV  +GW K+ GDD+ ELHY
Sbjct  197  VLDAGYRWDMPVEEAVELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDISELHY  256

Query  205  HYYP  194
             YYP
Sbjct  257  QYYP  260



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 157/187 (84%), Gaps = 3/187 (2%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG---VKCRLHELANKRRI  575
            SRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG   V CRL+EL N +RI
Sbjct  76   SRASQGSYISSQTVKKVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRI  135

Query  574  SVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPY  395
            +V GASKLLAN ++SYRGMGLS+GTM+AGWD  GPGLYYVDS+G R KG RFSVGSGS Y
Sbjct  136  TVRGASKLLANTMFSYRGMGLSMGTMVAGWDVAGPGLYYVDSDGQRTKGQRFSVGSGSLY  195

Query  394  AYGVLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGE  215
            AYGVLD GY +D+SVE+A EL +R+IYHAT RDAASGG ASVYHV   GW K+ G+ VGE
Sbjct  196  AYGVLDAGYSWDMSVEDAVELGQRAIYHATARDAASGGTASVYHVTEAGWTKVRGESVGE  255

Query  214  LHYHYYP  194
            LHY YYP
Sbjct  256  LHYKYYP  262



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G Y+SSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG +CRL+EL   RRI+V 
Sbjct  43   SRASQGSYLSSQTVKKVIEINPYLLGTMAGGAADCQFWERNLGRQCRLYELKEGRRITVK  102

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN ++SYRGMGLS+GTMIAGWD  GPGLYYVDS+G R  G RFSVGSGS YAYG
Sbjct  103  AASKLLANTMFSYRGMGLSMGTMIAGWDIGGPGLYYVDSDGQRTGGQRFSVGSGSLYAYG  162

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY +D+SVE+A EL +R+I+HAT RDAASGG ASVYHV  +GW K+ GD VG+L+Y
Sbjct  163  VLDTGYSWDMSVEDAVELGQRAIFHATSRDAASGGTASVYHVTESGWTKVRGDAVGDLYY  222

Query  205  HYYP  194
             Y P
Sbjct  223  KYNP  226



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YISSQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA
Sbjct  87   SRATMGNYISSQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++YSY+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYG
Sbjct  147  AASKLLANMVYSYKGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY +DLSV++A EL RRSIYHAT RDA SGG  ++YHV  NGW      DVGELH+
Sbjct  207  VLDSGYNYDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHW  266

Query  205  HYYPVEAAAVE  173
             Y    A  ++
Sbjct  267  EYQDENAKGMQ  277



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YI+SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA
Sbjct  87   SRATMGNYIASQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++YSY+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYG
Sbjct  147  AASKLLANMVYSYKGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY FDLSV++A EL RRSIYHAT RDA SGG  ++YHV  NGW+     DVG+LH+
Sbjct  207  VLDSGYDFDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWEYHGNHDVGQLHW  266

Query  205  HYYPVEAAAVE  173
             Y    A +++
Sbjct  267  DYQDENAKSMQ  277



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score =   273 bits (698),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  KCRL+EL NK RISVA
Sbjct  59   SRATAGPWIASQNVKKVIEINPYLLGTMAGGAADCSFWQRFLAEKCRLYELRNKERISVA  118

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLANILY Y+GMGLSVGTMI GWD++GPGLYYVDS+G RL    FSVGSGS YAYG
Sbjct  119  AASKLLANILYGYKGMGLSVGTMIVGWDKRGPGLYYVDSDGTRLSSVMFSVGSGSTYAYG  178

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLS +EA +L RR+IYHAT+RDA SGG+ S+YH+  +GW K+S DDV +LHY
Sbjct  179  VLDSGYRYDLSDDEAYDLGRRAIYHATYRDAYSGGIVSLYHMKESGWVKISQDDVSDLHY  238

Query  205  HY  200
             Y
Sbjct  239  TY  240



>gb|EIE87710.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=187

 Score =   270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  733  MGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASK  554
            MG YISSQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA ASK
Sbjct  1    MGNYISSQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASK  60

Query  553  LLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDN  374
            LLAN++YSY+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+
Sbjct  61   LLANMVYSYKGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDS  120

Query  373  GYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  194
            GY +DLSV++A EL RRSIYHAT RDA SGG  ++YHV  NGW      DVGELH+ Y  
Sbjct  121  GYDYDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHWEYQD  180

Query  193  VEAAAVE  173
              A  ++
Sbjct  181  ENAKGMQ  187



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score =   273 bits (698),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R+L  +CRL+EL NK RISVA
Sbjct  74   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERHLAKECRLYELRNKERISVA  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN +Y+Y+GMGLS+GTMI GWD+KGPGLYYVDS+G RL  N FSVGSGS YAYG
Sbjct  134  AASKLLANTVYNYKGMGLSMGTMIVGWDKKGPGLYYVDSDGERLTNNMFSVGSGSTYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY +DLSVE+A EL +RSIYHAT RDA SGGV ++YH+   GW K+S  DV ELHY
Sbjct  194  VLDSGYSWDLSVEDAYELGKRSIYHATHRDAYSGGVVNLYHMKQTGWIKVSQTDVKELHY  253

Query  205  HYYPVEA  185
             Y   +A
Sbjct  254  KYQEEKA  260



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YISSQ+VKK+IEINPY+LGTMAGGAADCQFW R LG++CRL+EL NKRRISVA
Sbjct  102  SRASMGNYISSQNVKKVIEINPYLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVA  161

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLL+NI+Y Y+  GLS+GTMIAGWD  GP L+ VD++G RLKG RFSVGSGS YAYG
Sbjct  162  AASKLLSNIVYQYKDHGLSMGTMIAGWDHTGPNLFMVDNDGTRLKGTRFSVGSGSLYAYG  221

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GYR DL+ EEA EL RR+IYHAT RDA SGG+ +VY +  +GW K+S  D+ ELHY
Sbjct  222  VLDQGYRADLTEEEACELGRRAIYHATHRDAYSGGIINVYLIRSDGWTKISSTDMNELHY  281

Query  205  HYYPVEAAAVEH  170
              Y  E   +++
Sbjct  282  GKYAPEKGILDN  293



>ref|XP_005994469.1| PREDICTED: proteasome subunit beta type-5-like [Latimeria chalumnae]
Length=260

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  75   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLY+VDSEG R+ G+ FSVGSGS YAYG
Sbjct  135  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYFVDSEGNRITGDNFSVGSGSVYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY FDLSVEEA +LARR+IYHAT+RDA SGGV ++YHV  +GW ++  DDV ELH 
Sbjct  195  VLDRGYHFDLSVEEAYDLARRAIYHATYRDAYSGGVVNIYHVREDGWFRVFQDDVLELHE  254

Query  205  HY  200
             +
Sbjct  255  EF  256



>ref|XP_005825075.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
 gb|EKX38095.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
Length=290

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YI SQ+VKK IEI PY+LGTMAGGAADC FW R+LG  CRL+EL NK RI+ A
Sbjct  94   SRASMGSYIGSQTVKKCIEITPYLLGTMAGGAADCMFWERHLGRLCRLYELRNKERITTA  153

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEK-GPGLYYVDSEGGRLKGNRFSVGSGSPYAY  389
             ASKLL NI+YSY+G GLS+GTMIAGWD+  GP LYY DSEG R+KG +FSVGSGSPYAY
Sbjct  154  AASKLLHNIMYSYKGYGLSMGTMIAGWDKDIGPNLYYCDSEGTRVKGQKFSVGSGSPYAY  213

Query  388  GVLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELH  209
            GVLD GY+FD+S+++A EL RR+IYHATFRDA SGG  SVYHV  NGW K+S DDV  LH
Sbjct  214  GVLDEGYKFDMSIDDACELGRRAIYHATFRDAMSGGRVSVYHVHENGWTKISMDDVQLLH  273

Query  208  YHY  200
              Y
Sbjct  274  EKY  276



>gb|AAI55951.1| LOC100127332 protein [Xenopus laevis]
Length=253

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  67   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  126

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G+ FSVGSGS YAYG
Sbjct  127  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYG  186

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY ++L VEEA ELARRSIY AT+RDA SGGV ++YHV  +GW ++S DDV ELH 
Sbjct  187  VLDSGYNYELEVEEAQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVLELHQ  246

Query  205  HY  200
             Y
Sbjct  247  KY  248



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC FW R LG + RL+EL NK RISVA
Sbjct  24   SRATMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSFWERELGRRARLYELRNKERISVA  83

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLL+N++Y Y+GMGLS+GTMI GWD++GPGL+YVDS+G RLK + FSVGSGS YAYG
Sbjct  84   AASKLLSNMVYGYKGMGLSMGTMITGWDKQGPGLFYVDSDGQRLKNHMFSVGSGSTYAYG  143

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY +DLSV +A +LARRSIYHATFRDA SGG  +VYHV  +GWK +S  DV +LHY
Sbjct  144  VLDAGYDYDLSVNDAIDLARRSIYHATFRDAYSGGSVNVYHVQQDGWKFISNTDVMDLHY  203

Query  205  H  203
             
Sbjct  204  E  204



>ref|XP_002941560.1| PREDICTED: proteasome subunit beta type-5 [Xenopus (Silurana) 
tropicalis]
Length=257

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  71   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  130

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G+ FSVGSGS YAYG
Sbjct  131  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYG  190

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY +++ VEEA ELARRSIY AT+RDA SGGV ++YHV  +GW ++S DDV +LH 
Sbjct  191  VLDRGYNYEMEVEEAQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVADLHQ  250

Query  205  HY  200
             Y
Sbjct  251  KY  252



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   268 bits (686),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YI+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA
Sbjct  88   SRASGGSYIASQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVA  147

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+L+N++Y Y+GMGLS+GTMI GWD+ GP L+YVDS+G R++G RFSVGSGS +AYG
Sbjct  148  AASKILSNMVYDYKGMGLSMGTMITGWDKTGPALFYVDSDGTRMRGERFSVGSGSTFAYG  207

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY F+LSV +A EL RR+IYHAT RDA SGG  +V+HV   GW+ +   DVGELH+
Sbjct  208  VLDTGYDFNLSVPDAIELGRRAIYHATHRDAYSGGSVNVFHVKETGWEFIGNYDVGELHW  267

Query  205  HYYPVEAAAV  176
            HY+     A+
Sbjct  268  HYHAQPKGAI  277



>ref|XP_005110562.1| PREDICTED: proteasome subunit beta type-5-like [Aplysia californica]
Length=281

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G  I SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  91   SRATAGPSIESQTVKKVIEINPYLLGTMAGGAADCMFWERALARQCRIYELRNKERISVA  150

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLANI+Y Y+GMGLS+GTMI GWD+KGPGLYYVD++G RL+G  FSVGSGS YAYG
Sbjct  151  AASKLLANIVYDYKGMGLSMGTMIIGWDKKGPGLYYVDNDGERLEGKLFSVGSGSVYAYG  210

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++DLSVEEA +L RR+IYHAT RDA SGGV ++YH+   GW+K+S  D  ELHY
Sbjct  211  VLDSGYKWDLSVEEAQDLGRRAIYHATHRDAYSGGVVNLYHMKQTGWEKISQTDTMELHY  270

Query  205  HY  200
             Y
Sbjct  271  QY  272



>gb|AAY98499.1| LMP X [Swiftia exserta]
Length=268

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK RISVA
Sbjct  82   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSYWERVLAKQCRIYELRNKERISVA  141

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y YRGMGLS+GTMI GWD++GPGLYYVDS+G RL  N FSVGSGS +AYG
Sbjct  142  AASKLLANMVYYYRGMGLSMGTMICGWDKRGPGLYYVDSDGSRLSNNIFSVGSGSTFAYG  201

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR DLSV+EA +L  R+IYHAT RDA SGGV ++YH+   GW K+S +DVG+LHY
Sbjct  202  VLDSGYRPDLSVQEAYDLGERAIYHATHRDAYSGGVVNMYHMQETGWVKVSQNDVGQLHY  261

Query  205  HY  200
             Y
Sbjct  262  KY  263



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G +I++Q+VKK+IEINPY+LGTMAGGAADC FW R LG +CRL+EL NK RISVA
Sbjct  87   SRASAGSFIATQTVKKVIEINPYLLGTMAGGAADCIFWQRELGRRCRLYELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y+Y+GMGLS+GTM+AGWD+ GP ++Y+DS+G RLKG+ FSVGSGSP+AYG
Sbjct  147  AASKLLANMVYAYKGMGLSMGTMVAGWDKTGPSIFYIDSDGTRLKGDLFSVGSGSPFAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G+ +DLSV+EA EL RRSIYHA  RD+ASGG  +VYHV  +GW+ +   DVG+LH+
Sbjct  207  VVDSGFDYDLSVQEAIELGRRSIYHAAHRDSASGGSINVYHVKQDGWEFIGNYDVGDLHW  266

Query  205  HY  200
             Y
Sbjct  267  EY  268



>gb|AAL74417.1| proteosome PSMB5/8 protein [Branchiostoma lanceolatum]
Length=194

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  17   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISVA  76

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLANI+Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+G RL  N FSVGSGS YAYG
Sbjct  77   AASKLLANIVYNYKGMGLSMGTMIVGWDKRGPGLYYVDSDGTRLSNNMFSVGSGSTYAYG  136

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGEL  212
            VLD+GY++D+SVEEA EL +RSIYHAT RDA SGGV ++YH+   GW K+S  DV +L
Sbjct  137  VLDSGYKWDMSVEEAYELGKRSIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVMDL  194



>ref|XP_004994692.1| LMP X protein [Salpingoeca rosetta]
 gb|EGD72869.1| LMP X protein [Salpingoeca rosetta]
Length=292

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YI+SQ+VKK+IEINPY+LGTMAGGAADC +W R L  +CRL EL N  RISVA
Sbjct  97   SRASAGSYIASQTVKKVIEINPYLLGTMAGGAADCSYWERVLAKECRLFELRNGERISVA  156

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+LANI+Y YRGMGLS+GTMI GWD+KGPGL+YVDS+G RL  N FSVGSGS YAYG
Sbjct  157  AASKILANIVYHYRGMGLSMGTMICGWDKKGPGLFYVDSDGTRLTNNLFSVGSGSTYAYG  216

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKK-LSGDDVGELH  209
            VLD GYR+DLSVEEA ELARR+IYHATFRDA SGG  ++YH+   GW++ L+  DVG LH
Sbjct  217  VLDAGYRWDLSVEEAHELARRAIYHATFRDAYSGGHINLYHMKETGWERILNMQDVGPLH  276

Query  208  YHY  200
            Y Y
Sbjct  277  YEY  279



>pdb|3UNB|K Chain K, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|Y Chain Y, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|MM Chain m, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|1 Chain 1, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|K Chain K, Mouse Constitutive 20s Proteasome
 pdb|3UNE|Y Chain Y, Mouse Constitutive 20s Proteasome
 pdb|3UNE|MM Chain m, Mouse Constitutive 20s Proteasome
 pdb|3UNE|1 Chain 1, Mouse Constitutive 20s Proteasome
Length=205

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  18   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  77

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  78   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYG  137

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  138  VMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  197

Query  205  HYYPV  191
             Y  V
Sbjct  198  KYSSV  202



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA
Sbjct  87   SRATMGNYIGSQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLL N++YSY+GMGLS+GTMI GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYG
Sbjct  147  AASKLLGNMVYSYKGMGLSMGTMITGWDKTGPNLFYVDSDGQRLKGDLFSVGSGSTFAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY FDLSV +A EL +RSIYHAT RDA SGG  ++YHV  +GW+     DVG LHY
Sbjct  207  VLDSGYDFDLSVSDALELGKRSIYHATHRDAMSGGSVNLYHVTESGWEYHGNHDVGPLHY  266

Query  205  HY  200
             Y
Sbjct  267  EY  268



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  89   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISVA  148

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLANI+Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+G RL  N FSVGSGS YAYG
Sbjct  149  AASKLLANIVYNYKGMGLSMGTMIVGWDKRGPGLYYVDSDGTRLSNNMFSVGSGSTYAYG  208

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY +D+ VEEA EL +R+IYHAT RDA SGGV ++YH+   GW K+S  DV +LHY
Sbjct  209  VLDSGYSWDMGVEEAYELGKRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVMDLHY  268

Query  205  HY  200
             Y
Sbjct  269  KY  270



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  74   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMFWERVLAKQCRIYELRNKERISVA  133

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+LAN++Y+Y+GMGLS+GTMI GWD+ GPGL+YVDS+G RLKGN FSVGSGS YAYG
Sbjct  134  AASKILANMVYNYKGMGLSMGTMICGWDKHGPGLFYVDSDGQRLKGNMFSVGSGSTYAYG  193

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+GYR+DLSV EA +L +RSIYHAT RDA SGGV ++YH+   GW+ +S  DV ++HY
Sbjct  194  VMDSGYRYDLSVAEALDLGKRSIYHATHRDAYSGGVVNLYHMKETGWEFISQTDVLDIHY  253



>ref|XP_007258118.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Astyanax 
mexicanus]
 ref|XP_007258119.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Astyanax 
mexicanus]
Length=269

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  83   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  142

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G++F+VGSGS YAYG
Sbjct  143  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRVCGDQFAVGSGSMYAYG  202

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+G R DL+VEEA +L RR+IY AT+RDA SGG  ++YHV   GWK++S +DV +LH+
Sbjct  203  VLDSGLRQDLTVEEACDLGRRAIYQATYRDAYSGGQVNLYHVHSEGWKRVSQEDVLQLHH  262

Query  205  HYYPVEA  185
             Y   +A
Sbjct  263  QYQSQKA  269



>ref|XP_008332973.1| PREDICTED: proteasome subunit beta type-5 [Cynoglossus semilaevis]
Length=278

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  86   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  145

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  146  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVSGDLFAVGSGSMYAYG  205

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R+DLSV+EA EL RR+IY AT+RDA SGG  ++YHV   GW ++S DDV +LH 
Sbjct  206  VMDSGLRYDLSVDEACELGRRAIYQATYRDAYSGGQVNLYHVQSEGWTRVSQDDVLKLHQ  265

Query  205  HYYPVEAAAVEHE  167
             Y   E      E
Sbjct  266  KYNDQEKLETAQE  278



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA
Sbjct  87   SRATMGNYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYG
Sbjct  147  AASKLLANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY +DLS++EA EL RRSIYHAT RDA SGG  ++YHV   GW      DVG LH+
Sbjct  207  VLDSGYDYDLSIKEALELGRRSIYHATHRDAMSGGSVNLYHVTEKGWTYHGNHDVGSLHW  266

Query  205  HY  200
             Y
Sbjct  267  EY  268



>pdb|4R3O|L Chain L, Human Constitutive 20s Proteasome
 pdb|4R3O|Z Chain Z, Human Constitutive 20s Proteasome
 pdb|4R67|L Chain L, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|Z Chain Z, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|NN Chain n, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|3 Chain 3, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=201

 Score =   263 bits (673),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  18   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  77

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  78   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  137

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  138  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  197

Query  205  HY  200
             Y
Sbjct  198  KY  199



>pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|Z Chain Z, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
Length=204

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  18   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  77

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  78   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  137

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  138  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  197

Query  205  HY  200
             Y
Sbjct  198  KY  199



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYTYDLEVEEAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_792356.3| PREDICTED: proteasome subunit beta type-5-like [Strongylocentrotus 
purpuratus]
Length=187

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -1

Query  724  YISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLA  545
            Y +SQSVKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLA
Sbjct  8    YAASQSVKKVIEINPYLLGTMAGGAADCAFWERVLAEQCRIYELRNKERISVAAASKLLA  67

Query  544  NILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR  365
            N+LY+Y+GMGLSVGTMI GWD++GPGLYYVDS+G RL  N FSVGSGSPYAYGVLD GY+
Sbjct  68   NMLYNYKGMGLSVGTMICGWDKRGPGLYYVDSDGNRLTNNIFSVGSGSPYAYGVLDEGYK  127

Query  364  FDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHYHY  200
            ++LSVE+A +L +R+IYHAT RDA SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  128  WELSVEDALDLGQRAIYHATHRDAYSGGVVNLYHMQETGWVKISSTDVKDLHYRY  182



>ref|XP_007439509.1| PREDICTED: proteasome subunit beta type-5 [Python bivittatus]
Length=265

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SR++ G Y++SQ+VKKIIEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  75   SRSTAGVYVASQTVKKIIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  134

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  135  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYG  194

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY  DLSVEEA +LARR+IY AT+RDA SGG  +VYHVGP+GW ++S DDV  L  
Sbjct  195  VMDRGYSHDLSVEEAYDLARRAIYQATYRDAYSGGSVNVYHVGPDGWIRVSSDDVSNLRE  254

Query  205  HYYPVEAAAV  176
             +    + AV
Sbjct  255  LFRDTASEAV  264



>gb|EPY87607.1| proteasome subunit beta type-5-like isoform 1 [Camelus ferus]
Length=198

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  12   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  71

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  72   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYG  131

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  132  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  191

Query  205  HY  200
             Y
Sbjct  192  KY  193



>ref|XP_004694702.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Condylura 
cristata]
Length=208

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  22   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  81

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  82   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  141

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  142  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  201

Query  205  HY  200
             Y
Sbjct  202  KY  203



>ref|XP_008292170.1| PREDICTED: proteasome subunit beta type-5 [Stegastes partitus]
Length=271

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  86   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  145

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  146  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  205

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G RFDL+VEEA ELARR+IY AT+RDA SGG  ++YHV   GW ++S DDV  LH 
Sbjct  206  VMDSGLRFDLTVEEACELARRAIYQATYRDAYSGGQVNLYHVHGKGWTRVSQDDVLMLHQ  265

Query  205  HY  200
             Y
Sbjct  266  QY  267



>gb|AAP36588.1| Homo sapiens proteasome (prosome, macropain) subunit, beta type, 
5 [synthetic construct]
Length=209

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  22   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  81

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  82   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  141

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  142  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  201

Query  205  HY  200
             Y
Sbjct  202  KY  203



>ref|XP_011441202.1| PREDICTED: proteasome subunit beta type-5-like [Crassostrea gigas]
Length=275

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G  I SQ+VKK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK RISVA
Sbjct  87   SRATAGPSIESQTVKKVIEINPYLLGTMAGGAADCAYWERVLARQCRIYELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLANI+Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+G R+  N +SVGSGS YAYG
Sbjct  147  AASKLLANIVYNYKGMGLSMGTMICGWDKRGPGLYYVDSDGERMSNNIYSVGSGSVYAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR+DLSVEEA +L RRSIYHAT RDA SGGV ++YH+  +GW+ +S  DV +LHY
Sbjct  207  VLDSGYRYDLSVEEAIDLGRRSIYHATHRDAYSGGVVNLYHMKESGWEFISQTDVFDLHY  266

Query  205  HY  200
             Y
Sbjct  267  QY  268



>dbj|BAA08204.1| proteasome subunit RCX [Rattus rattus]
Length=208

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  22   SRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  81

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+G
Sbjct  82   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFG  141

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  142  VMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  201

Query  205  HY  200
             Y
Sbjct  202  KY  203



>dbj|BAA06097.1| proteasome subunit X [Homo sapiens]
 gb|AAP35423.1| proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|AIC59195.1| hypothetical protein, partial [synthetic construct]
Length=208

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  22   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  81

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  82   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  141

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  142  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  201

Query  205  HY  200
             Y
Sbjct  202  KY  203



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  89   SRATAGPFIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLSQQCRIYELRNKERISVA  148

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+G R+    FSVGSGS YAYG
Sbjct  149  AASKLLANMVYNYKGMGLSMGTMICGWDKRGPGLYYVDSDGTRITNYMFSVGSGSTYAYG  208

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR++LSV+EA +L +R+IYHAT RDA SGGV ++YH+   GW K+S +DV ELHY
Sbjct  209  VLDSGYRYELSVQEAYDLGQRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQNDVKELHY  268

Query  205  HY  200
             Y
Sbjct  269  KY  270



>dbj|BAE93066.1| low molecular mass polypeptide [Lethenteron camtschaticum]
Length=204

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK RISVA
Sbjct  19   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMYWERVLAKQCRIYELRNKERISVA  78

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD+KGPGLYYVD EG RL G+ F+VGSGSPYA+G
Sbjct  79   AASKLLANMVYQYKGMGLSMGTMICGWDKKGPGLYYVDDEGMRLPGSMFAVGSGSPYAFG  138

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR DLS EEA +L RR+I  AT RDA SGGV ++YH+   GW K+S DDV EL Y
Sbjct  139  VLDSGYREDLSKEEAYDLGRRAIASATHRDAYSGGVVNLYHMCQTGWIKVSQDDVSELQY  198

Query  205  HY  200
             +
Sbjct  199  KF  200



>ref|XP_006835507.1| PREDICTED: proteasome subunit beta type-5 [Chrysochloris asiatica]
Length=263

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V ELH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVAELHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CRL++L NK RISVA
Sbjct  90   SRASAGSYIASQTVKKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVA  149

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDS+G RLKG+ FSVGSGS YAYG
Sbjct  150  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSDGSRLKGDLFSVGSGSTYAYG  209

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD  +++DL++EEA +L  R+IYHAT RDA SGGV ++YH+   GW K+S  DV +LHY
Sbjct  210  VLDADHKWDLTLEEAYDLGNRAIYHATHRDAGSGGVCNLYHMQETGWIKVSQTDVTDLHY  269

Query  205  HY  200
             Y
Sbjct  270  KY  271



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YI SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  91   SRASMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVA  150

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDS+G R+    FSVGSGS YAYG
Sbjct  151  AASKLLANMVYYYKGMGLSMGTMICGWDKRGPGLYYVDSDGTRMTNYMFSVGSGSTYAYG  210

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            +LD+G++ DL  EEA +LARR+I+HAT RDA SGG  ++YHV   GW K+S DDVG L+Y
Sbjct  211  ILDSGFKHDLEDEEAYDLARRAIFHATHRDAYSGGSVNLYHVKETGWVKISRDDVGPLYY  270

Query  205  HY  200
             Y
Sbjct  271  QY  272



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   263 bits (673),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA
Sbjct  87   SRATMGNYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYG
Sbjct  147  AASKLLANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY  DLSV++A EL RRSIYHAT RDA SGG  ++YHV   GW      DVG LH+
Sbjct  207  VLDSGYDHDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGNLHW  266

Query  205  HY  200
             Y
Sbjct  267  DY  268



>emb|CAA66312.1| LMP7-like protein [Geodia cydonium]
Length=280

 Score =   263 bits (673),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC +W R L   CR++EL NK RISVA
Sbjct  92   SRATAGSWIASQTVKKVIEINPYLLGTMAGGAADCAYWERQLAFSCRVYELRNKERISVA  151

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+L+N++Y Y+GMGLS+GTMI GWD+KGPGLYYVDS+G RL  + FSVGSGS YAYG
Sbjct  152  AASKILSNMVYRYKGMGLSMGTMICGWDKKGPGLYYVDSDGSRLTHHMFSVGSGSTYAYG  211

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY +DLSVEEA +L +R+IYHAT RDA SGGV ++YH+   GW K+S  DV ELHY
Sbjct  212  VLDSGYSYDLSVEEARDLGKRAIYHATHRDAYSGGVVNLYHMMETGWVKVSQTDVKELHY  271

Query  205  HY  200
             Y
Sbjct  272  QY  273



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   263 bits (673),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +  +CR++EL NK RISVA
Sbjct  89   SRATAGDWIASQTVKKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVA  148

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLANI+Y+Y+GMGLS+GTMI GWD+KGPGLYYVDS+G R+    FSVGSGS YAYG
Sbjct  149  AASKLLANIVYNYKGMGLSMGTMICGWDKKGPGLYYVDSDGTRMTNAMFSVGSGSTYAYG  208

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+ YR+DLSVEEA  L  R+IYHA  RDA +GGV ++YH+  +GW K+S +D+GELHY
Sbjct  209  VLDSSYRWDLSVEEAYALGERAIYHAAHRDAFTGGVVNMYHMKESGWVKVSQNDIGELHY  268

Query  205  HY  200
             +
Sbjct  269  KF  270



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   263 bits (673),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA
Sbjct  87   SRATMGNYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVA  146

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYG
Sbjct  147  AASKLLANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYG  206

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY  DLSV++A EL RRSIYHAT RDA SGG  ++YHV   GW      DVG LH+
Sbjct  207  VLDSGYDHDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGSLHW  266

Query  205  HY  200
             Y
Sbjct  267  DY  268



>ref|XP_004698955.1| PREDICTED: proteasome subunit beta type-5 [Echinops telfairi]
Length=263

 Score =   263 bits (671),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_003421032.1| PREDICTED: proteasome subunit beta type-5 [Loxodonta africana]
Length=263

 Score =   263 bits (671),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   264 bits (674),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRAS G YI+S SVKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA
Sbjct  79   SRASAGSYIASGSVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVA  138

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+L+N++YSY+GMGLS+GTMI GWD+ GP +YYVDSEG R+KG+ FSVGSGS +AYG
Sbjct  139  AASKILSNLVYSYKGMGLSMGTMICGWDKSGPAIYYVDSEGSRMKGDLFSVGSGSTFAYG  198

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY +DLS EEA +L RRSIY AT RDA SG   ++YH+GPNGW+ ++  DV +LHY
Sbjct  199  VLDQGYHWDLSEEEALDLGRRSIYAATHRDAYSGNTINLYHMGPNGWRFIANYDVMQLHY  258



>ref|XP_004389982.1| PREDICTED: proteasome subunit beta type-5 [Trichechus manatus 
latirostris]
Length=263

 Score =   263 bits (671),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_001745267.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89845.1| predicted protein [Monosiga brevicollis MX1]
Length=247

 Score =   262 bits (669),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC +W R L ++CRL+EL N  RISVA
Sbjct  57   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSYWERYLAMQCRLYELRNGERISVA  116

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+LANI+++YR MGLS+GTM+ GWD+KGPGL+YVDS+G RL  N FSVGSGS YAYG
Sbjct  117  AASKVLANIVWNYRNMGLSMGTMVCGWDKKGPGLFYVDSDGTRLTNNMFSVGSGSTYAYG  176

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY++DLS EEA +L RR+IYHATFRDA SGG  ++YH+   GW K+S D V +LHY
Sbjct  177  VLDAGYKWDLSDEEAQDLGRRAIYHATFRDAYSGGTVNLYHMRQTGWVKISADSVHDLHY  236

Query  205  HY  200
             Y
Sbjct  237  RY  238



>ref|XP_003755883.1| PREDICTED: proteasome subunit beta type-5 [Sarcophilus harrisii]
Length=263

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY FDL+VEEA +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +L+ 
Sbjct  197  VMDRGYSFDLTVEEAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLND  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_004421295.1| PREDICTED: proteasome subunit beta type-5 [Ceratotherium simum 
simum]
Length=263

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_001626004.1| predicted protein [Nematostella vectensis]
 gb|EDO33904.1| predicted protein [Nematostella vectensis]
Length=279

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  92   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAKQCRIYELRNKERISVA  151

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+LAN++Y Y+GMGLS+GTMI GWD+KGPGLYYVDS+G RL    FSVGSGS YAYG
Sbjct  152  AASKILANMVYYYKGMGLSMGTMICGWDKKGPGLYYVDSDGTRLSNQMFSVGSGSTYAYG  211

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+GY++D+S EEA +L  RSIYHAT RDA SGGV ++YH+   GW K+S  DV +LHY
Sbjct  212  VMDSGYKYDMSPEEAYDLGVRSIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVAKLHY  271

Query  205  HY  200
             Y
Sbjct  272  QY  273



>ref|XP_007949373.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Orycteropus 
afer afer]
Length=263

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|NP_001032701.1| proteasome subunit beta type-5 [Bos taurus]
 ref|XP_005895501.1| PREDICTED: proteasome subunit beta type-5 [Bos mutus]
 ref|XP_010829574.1| PREDICTED: proteasome subunit beta type-5 [Bison bison bison]
 sp|Q32KL2.1|PSB5_BOVIN RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Bos taurus]
 gb|AAI10040.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Bos taurus]
 tpg|DAA25764.1| TPA: proteasome subunit beta type-5 precursor [Bos taurus]
Length=263

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  S+YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_004010385.1| PREDICTED: proteasome subunit beta type-5 [Ovis aries]
 ref|XP_005685312.1| PREDICTED: proteasome subunit beta type-5 [Capra hircus]
Length=263

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  S+YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_005338834.1| PREDICTED: proteasome subunit beta type-5 [Ictidomys tridecemlineatus]
Length=208

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  22   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  81

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  82   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  141

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW  +S D+V +LH 
Sbjct  142  VMDRGYSYDLDVEQAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIHVSSDNVADLHD  201

Query  205  HY  200
             Y
Sbjct  202  KY  203



>ref|XP_004313402.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Tursiops 
truncatus]
Length=208

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  22   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  81

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  82   AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  141

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S ++V +LH 
Sbjct  142  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSNNVADLHD  201

Query  205  HY  200
             Y
Sbjct  202  KY  203



>ref|XP_005933706.1| PREDICTED: proteasome subunit beta type-5-like [Haplochromis 
burtoni]
Length=281

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  96   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  155

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  156  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  215

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R DL+VEEA EL RR+IY AT+RDA SGG  ++YHV   GW ++S DDV  LH+
Sbjct  216  VMDSGVRHDLTVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLMLHH  275

Query  205  HY  200
             Y
Sbjct  276  QY  277



>ref|XP_004565403.1| PREDICTED: proteasome subunit beta type-5-like [Maylandia zebra]
Length=271

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  86   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  145

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  146  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  205

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R DL+VEEA EL RR+IY AT+RDA SGG  ++YHV   GW ++S DDV  LH+
Sbjct  206  VMDSGVRHDLTVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHH  265

Query  205  HY  200
             Y
Sbjct  266  QY  267



>ref|XP_006066544.1| PREDICTED: proteasome subunit beta type-5 [Bubalus bubalis]
Length=263

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  S+YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWVRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_006988553.1| PREDICTED: proteasome subunit beta type-5 [Peromyscus maniculatus 
bairdii]
Length=263

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  NGW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEDAYDLARRAIYQATYRDAYSGGAVNLYHVRENGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_005978061.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Pantholops 
hodgsonii]
Length=263

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  S+YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_005740284.1| PREDICTED: proteasome subunit beta type-5-like [Pundamilia nyererei]
Length=281

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  96   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  155

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  156  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  215

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R DL+VEEA EL RR+IY AT+RDA SGG  ++YHV   GW ++S DDV  LH+
Sbjct  216  VMDSGVRHDLTVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHH  275

Query  205  HY  200
             Y
Sbjct  276  QY  277



>gb|ELR56586.1| Proteasome subunit beta type-5, partial [Bos mutus]
Length=266

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  80   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  139

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  140  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  199

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  S+YHV  +GW ++S D+V +LH 
Sbjct  200  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHD  259

Query  205  HY  200
             Y
Sbjct  260  KY  261



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SR++MG YI+S +VKK+IEINP++LGTMAGGAADC FW RNLG++CRL+EL N RRI+VA
Sbjct  92   SRSTMGYYIASGTVKKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVA  151

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++ +YRG GLS+GTMI GWDE GP LYYVD++G RLKG  FSVGSGS YAYG
Sbjct  152  AASKLLANVMSAYRGYGLSMGTMITGWDETGPQLYYVDNDGTRLKGKYFSVGSGSMYAYG  211

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLDN +R DLSVEEA +L +R+IYHAT RDAASGG+ ++YHV  +GWK + G DV ++HY
Sbjct  212  VLDNHWREDLSVEEAIDLGKRAIYHATHRDAASGGINNLYHVTADGWKYIHGIDVNDMHY  271

Query  205  HY  200
             +
Sbjct  272  EF  273



>ref|XP_002753673.3| PREDICTED: proteasome subunit beta type-5 [Callithrix jacchus]
Length=268

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  82   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  141

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  142  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  201

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  202  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  261

Query  205  HY  200
             Y
Sbjct  262  KY  263



>ref|XP_005875924.1| PREDICTED: proteasome subunit beta type-5-like [Myotis brandtii]
 gb|EPQ13719.1| Proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLL N+LY Y+GMGLSVGTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLVNMLYQYKGMGLSVGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_003457456.2| PREDICTED: proteasome subunit beta type-5-like [Oreochromis niloticus]
Length=281

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  96   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  155

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  156  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  215

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R DL+VEEA EL RR+IY AT+RDA SGG  ++YHV   GW ++S DDV  LH+
Sbjct  216  VMDSGVRHDLTVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHH  275

Query  205  HY  200
             Y
Sbjct  276  QY  277



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ GGYI+SQ VKK+IEINPY+LGTMAGGAADCQFW R L ++CRL+EL NK RISVA
Sbjct  96   SRATAGGYIASQEVKKVIEINPYLLGTMAGGAADCQFWERVLAMECRLYELRNKERISVA  155

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD+KGPGLYYVD  G RL+G+ FSVGSGS +AYG
Sbjct  156  AASKLLANMVYQYKGMGLSMGTMVCGWDKKGPGLYYVDDGGQRLEGSLFSVGSGSLFAYG  215

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD GY +D+ VE A +LA RSIYHAT+RDAASGG  ++YH+   GW+     DV ELH+
Sbjct  216  VLDEGYSYDIEVEAAKDLAIRSIYHATYRDAASGGFVNLYHMKETGWEHCGWMDVKELHW  275

Query  205  HYYPVEAAAVEH  170
             Y+  + A  + 
Sbjct  276  KYHDEKIARAQQ  287



>ref|XP_003924370.1| PREDICTED: proteasome subunit beta type-5 [Saimiri boliviensis 
boliviensis]
Length=263

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_002926051.1| PREDICTED: proteasome subunit beta type-5 [Ailuropoda melanoleuca]
 gb|EFB18962.1| hypothetical protein PANDA_015661 [Ailuropoda melanoleuca]
Length=263

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  EY  258



>ref|NP_035316.1| proteasome subunit beta type-5 [Mus musculus]
 sp|O55234.3|PSB5_MOUSE RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Mus musculus]
 gb|AAD50536.1|AF060091_1 proteasome subunit X [Mus musculus]
 dbj|BAA24916.1| PSMB5 [Mus musculus]
 dbj|BAA24917.1| PSMB5 [Mus musculus]
 dbj|BAE21876.1| unnamed protein product [Mus musculus]
 gb|AAI06145.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
 gb|EDL36339.1| mCG8712, isoform CRA_b [Mus musculus]
Length=264

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HYYPV  191
             Y  V
Sbjct  257  KYSSV  261



>gb|ADO27969.1| proteasome subunit beta type-5 [Ictalurus furcatus]
Length=266

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  80   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  139

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  140  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDMFAVGSGSMYAYG  199

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+G+R DL++EEA +L RR+IY ATFRDA SGG  ++Y V   GW+++S DDV  LH+
Sbjct  200  VLDSGHRTDLTIEEACDLGRRAIYQATFRDAYSGGQVNLYRVHSEGWERVSQDDVLALHH  259

Query  205  HYYPVEA  185
             +   +A
Sbjct  260  QFQSQKA  266



>gb|AAH12246.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
Length=264

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSNDNVADLHD  256

Query  205  HYYPV  191
             Y  V
Sbjct  257  KYSSV  261



>ref|XP_001379940.1| PREDICTED: proteasome subunit beta type-5 [Monodelphis domestica]
Length=263

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY FDLSVE+A +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +L+ 
Sbjct  197  VMDRGYSFDLSVEDAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLND  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_008708757.1| PREDICTED: proteasome subunit beta type-5 [Ursus maritimus]
Length=263

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +L  
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWTRVSSDNVADLQD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_003987515.1| PREDICTED: proteasome subunit beta type-5 [Felis catus]
 ref|XP_007098030.1| PREDICTED: proteasome subunit beta type-5 [Panthera tigris altaica]
Length=263

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>gb|ADL27419.1| proteasome subunit beta type [Pheronema raphanus]
Length=279

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G +I+SQ+ KK+IEINPY+LGTMAGGAADC +W R L  +CRL+EL NK RISVA
Sbjct  93   SRATAGSWIASQTCKKVIEINPYLLGTMAGGAADCSYWERRLAQECRLYELRNKERISVA  152

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+L+N LY Y+GMGLSVGTMI GWD+KGPGLYYVDS+G R+  + FSVGSGS YAYG
Sbjct  153  AASKVLSNFLYYYKGMGLSVGTMICGWDKKGPGLYYVDSDGTRMTHHMFSVGSGSVYAYG  212

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GY++DLS +EA EL RRSIYHAT RDA SGGV ++YH+   GW K+S DDV  LHY
Sbjct  213  VLDSGYKWDLSDDEARELGRRSIYHATHRDAYSGGVVNLYHMKETGWIKISQDDVMTLHY  272

Query  205  HY  200
             Y
Sbjct  273  KY  274



>ref|XP_004694701.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Condylura 
cristata]
Length=263

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_004402154.1| PREDICTED: proteasome subunit beta type-5 [Odobenus rosmarus 
divergens]
Length=263

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_008121563.1| PREDICTED: proteasome subunit beta type-5 [Anolis carolinensis]
Length=279

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  89   SRATAGVYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  148

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  149  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYG  208

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELH  209
            V+D GY  +LSVEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S DDV +LH
Sbjct  209  VMDRGYSHNLSVEEAYDLARRAIYQATYRDAYSGGTVNLYHVRQDGWIRVSSDDVSKLH  267



>ref|XP_006883201.1| PREDICTED: proteasome subunit beta type-5 [Elephantulus edwardii]
Length=263

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTM GGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMTGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGGV ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEKAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|NP_001099197.2| proteasome subunit beta type-5 [Rattus norvegicus]
 gb|EDM14180.1| proteasome (prosome, macropain) subunit, beta type 5, isoform 
CRA_a [Rattus norvegicus]
Length=263

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+G
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_006217298.1| PREDICTED: proteasome subunit beta type-5 [Vicugna pacos]
 ref|XP_010953019.1| PREDICTED: proteasome subunit beta type-5 [Camelus bactrianus]
 ref|XP_010987732.1| PREDICTED: proteasome subunit beta type-5 [Camelus dromedarius]
Length=263

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_006100131.1| PREDICTED: proteasome subunit beta type-5 [Myotis lucifugus]
Length=263

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_010376681.1| PREDICTED: proteasome subunit beta type-5 [Rhinopithecus roxellana]
Length=271

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  85   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  144

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  145  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  204

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  205  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  264

Query  205  HY  200
             Y
Sbjct  265  KY  266



>ref|XP_007449602.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Lipotes 
vexillifer]
Length=263

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_004054982.1| PREDICTED: proteasome subunit beta type-5 isoform 3 [Gorilla 
gorilla gorilla]
Length=268

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  82   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  141

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  142  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  201

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  202  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  261

Query  205  HY  200
             Y
Sbjct  262  KY  263



>ref|XP_006175925.1| PREDICTED: proteasome subunit beta type-5 [Camelus ferus]
Length=263

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   251 bits (642),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV 
Sbjct  73   SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVT  132

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
            GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG
Sbjct  133  GASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYG  192

Query  385  VLDNG  371
            VLD+G
Sbjct  193  VLDSG  197


 Score = 84.3 bits (207),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  384  FLIMGTGLICLLKKLQSWLGGLFIMQRSVMQLVEVLPVFTMLGQMDGRNCRVMMLESFTT  205
            + ++ +GL CLLKKL+SWL  LFIMQ S MQ V VL  F M  QMDGR+C VMMLESFTT
Sbjct  191  YGVLDSGLTCLLKKLRSWLEELFIMQHSEMQPVVVLQAFIMWDQMDGRSCLVMMLESFTT  250

Query  204  ITTQLKQQQWSMK  166
            I  Q +  +WS K
Sbjct  251  IIIQSRPVRWSKK  263



>ref|XP_006776843.1| PREDICTED: proteasome subunit beta type-5 [Myotis davidii]
Length=263

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLDVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_004283228.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Orcinus 
orca]
Length=263

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_007180616.1| PREDICTED: proteasome subunit beta type-5 [Balaenoptera acutorostrata 
scammoni]
Length=263

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_008156742.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Eptesicus 
fuscus]
Length=263

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_006144566.1| PREDICTED: proteasome subunit beta type-5 [Tupaia chinensis]
 gb|ELW69249.1| Proteasome subunit beta type-5 [Tupaia chinensis]
Length=263

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_003474544.1| PREDICTED: proteasome subunit beta type-5 [Cavia porcellus]
Length=263

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_006802789.1| PREDICTED: proteasome subunit beta type-5-like [Neolamprologus 
brichardi]
Length=281

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  96   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  155

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  156  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  215

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R DL+VEEA EL RR+IY AT+RDA SGG  ++YHV   GW ++S DDV  LH+
Sbjct  216  VMDSGVRHDLTVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHH  275

Query  205  HY  200
             Y
Sbjct  276  QY  277



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+S +VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  118  SRATGGSYIASGTVKKVIEINPYLLGTMAGGAADCSFWERELARRCRIYELRNKERISVA  177

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+ MGLS+GTMI GWD++GP LYYVDS+G RL G+ FSVGSGS YAYG
Sbjct  178  AASKLLANMVYGYKNMGLSMGTMITGWDKRGPELYYVDSDGTRLHGDMFSVGSGSTYAYG  237

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD G+R+D++ EEA EL RRSIYHAT RDA SGG  +VYHV   GW K+S  DV +LHY
Sbjct  238  VLDAGFRYDMTPEEACELGRRSIYHATHRDAYSGGFVNVYHVREEGWVKISSTDVNQLHY  297

Query  205  HY  200
             Y
Sbjct  298  GY  299



>ref|NP_002788.1| proteasome subunit beta type-5 isoform 1 [Homo sapiens]
 ref|NP_001126063.1| proteasome subunit beta type-5 precursor [Pongo abelii]
 ref|XP_003808166.1| PREDICTED: proteasome subunit beta type-5 [Pan paniscus]
 sp|P28074.3|PSB5_HUMAN RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit MB1; AltName: Full=Proteasome subunit X; Flags: 
Precursor [Homo sapiens]
 sp|Q5R8S2.3|PSB5_PONAB RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Pongo abelii]
 emb|CAA64838.1| proteasome [Homo sapiens]
 gb|AAH57840.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 emb|CAH91838.1| hypothetical protein [Pongo abelii]
 gb|AAI07721.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|EAW66193.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 gb|EAW66195.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 dbj|BAG34836.1| unnamed protein product [Homo sapiens]
 dbj|BAI47149.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
 gb|ADQ33015.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
Length=263

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_010744420.1| PREDICTED: proteasome subunit beta type-5 [Larimichthys crocea]
Length=273

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  86   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  145

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  146  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  205

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R DLSVEEA EL RR+IY AT+RDA SGG  ++YHV   GW ++S +DV  LH+
Sbjct  206  VMDSGLRHDLSVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRVSQEDVLMLHH  265

Query  205  HY  200
             Y
Sbjct  266  QY  267



>ref|XP_005707411.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
 gb|EME30891.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
Length=275

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRASMG YI S SVKK+IEIN Y+LGTMAGGAADC FW R LG++CR+ EL NK RISVA
Sbjct  76   SRASMGQYIGSGSVKKVIEINKYLLGTMAGGAADCTFWERYLGMRCRIFELKNKERISVA  135

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASK+L N +Y Y+GMGLS+GTMI GWD+KGP +YYVDSEG RLKG++FSVGSGS +A G
Sbjct  136  AASKILCNTVYQYKGMGLSMGTMIMGWDKKGPHIYYVDSEGTRLKGSKFSVGSGSTHALG  195

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVG-ELH  209
            VLD GY++++SVEEA EL RRSIYHAT RDA SGG  +VY++GP+GWK +S +D G + H
Sbjct  196  VLDQGYKWNMSVEEACELGRRSIYHATHRDAFSGGYINVYYIGPDGWKFISHEDSGFDKH  255

Query  208  YHYYPVEA--AAVEHEMT  161
            Y Y   +A  A  + +M+
Sbjct  256  YQYAADKATEAQTQQQMS  273



>ref|XP_004054980.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004054981.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004054983.1| PREDICTED: proteasome subunit beta type-5 isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004054984.1| PREDICTED: proteasome subunit beta type-5 isoform 5 [Gorilla 
gorilla gorilla]
Length=263

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>sp|P28075.3|PSB5_RAT RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Rattus norvegicus]
Length=263

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+G
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>emb|CAD97956.1| hypothetical protein [Homo sapiens]
Length=266

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  80   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  139

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  140  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  199

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  200  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  259

Query  205  HY  200
             Y
Sbjct  260  KY  261



>ref|XP_003260670.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Nomascus 
leucogenys]
 ref|XP_004091952.1| PREDICTED: proteasome subunit beta type-5 [Nomascus leucogenys]
Length=263

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|NP_001247774.1| proteasome subunit beta type-5 [Macaca mulatta]
 ref|XP_003901626.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Papio anubis]
 gb|EHH27742.1| hypothetical protein EGK_18013 [Macaca mulatta]
 gb|EHH63472.1| hypothetical protein EGM_16445 [Macaca fascicularis]
Length=263

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>emb|CAF97719.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=268

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  86   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  145

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYG
Sbjct  146  AASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYG  205

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D+G R DLSVEEA EL RR+IY AT+RDA SGG  ++YHV   GW ++S DDV  LH 
Sbjct  206  VMDSGLRHDLSVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRVSQDDVLMLHQ  265

Query  205  HY  200
             Y
Sbjct  266  RY  267



>ref|XP_008527207.1| PREDICTED: proteasome subunit beta type-5 [Equus przewalskii]
Length=263

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_001494538.2| PREDICTED: proteasome subunit beta type-5 isoform 1 [Equus caballus]
Length=263

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_005882305.1| PREDICTED: proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA++G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATVGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLL N++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLVNMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_006913661.1| PREDICTED: proteasome subunit beta type-5 [Pteropus alecto]
 ref|XP_011371095.1| PREDICTED: proteasome subunit beta type-5 [Pteropus vampyrus]
 gb|ELK11254.1| Proteasome subunit beta type-5 [Pteropus alecto]
Length=263

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_007989004.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Chlorocebus 
sabaeus]
Length=263

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>dbj|BAA10932.1| LMPX of lamprey [Petromyzon marinus]
Length=273

 Score =   261 bits (666),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK RISVA
Sbjct  88   SRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMYWERVLAKQCRIYELRNKERISVA  147

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD+KGPGLYYVD EG RL G+ F+VGSGSPYA+G
Sbjct  148  AASKLLANMVYQYKGMGLSMGTMICGWDKKGPGLYYVDDEGMRLPGSMFAVGSGSPYAFG  207

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            VLD+GYR DLS EEA +L RR+I  AT RDA SGGV ++YH+   GW K+S DDV EL Y
Sbjct  208  VLDSGYREDLSKEEAYDLGRRAIASATHRDAYSGGVVNLYHMCQTGWIKVSQDDVSELQY  267

Query  205  HY  200
             +
Sbjct  268  KF  269



>ref|XP_002718121.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Oryctolagus 
cuniculus]
Length=263

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_001924480.2| PREDICTED: proteasome subunit beta type-5 [Sus scrofa]
Length=275

 Score =   261 bits (666),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  89   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  148

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  149  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  208

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  209  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  268

Query  205  HY  200
             Y
Sbjct  269  KY  270



>ref|XP_008065987.1| PREDICTED: proteasome subunit beta type-5 [Tarsius syrichta]
Length=263

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>gb|AAB33092.1| proteasome subunit MB1, partial [Homo sapiens]
Length=215

 Score =   258 bits (660),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGA DC FW R L  +CR++EL NK RISVA
Sbjct  29   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAGDCSFWERLLARQCRIYELRNKERISVA  88

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+G+MI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  89   AASKLLANMVYQYKGMGLSMGSMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  148

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  149  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHE  208

Query  205  HY  200
             Y
Sbjct  209  KY  210



>ref|XP_003639276.1| PREDICTED: proteasome subunit beta type-5 [Canis lupus familiaris]
Length=263

 Score =   260 bits (664),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_005370537.1| PREDICTED: proteasome subunit beta type-5 [Microtus ochrogaster]
Length=263

 Score =   260 bits (664),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VE+A +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLQVEDAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



>ref|XP_004879937.1| PREDICTED: proteasome subunit beta type-5 [Heterocephalus glaber]
 ref|XP_004864242.1| PREDICTED: proteasome subunit beta type-5 [Heterocephalus glaber]
 gb|EHB00011.1| Proteasome subunit beta type-5 [Heterocephalus glaber]
Length=263

 Score =   260 bits (664),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  745  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  566
            SRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA
Sbjct  77   SRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA  136

Query  565  GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYG  386
             ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYG
Sbjct  137  AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVAFSVGSGSVYAYG  196

Query  385  VLDNGYRFDLSVEEAAELARRSIYHATFRDAASGGVASVYHVGPNGWKKLSGDDVGELHY  206
            V+D GY +DL VEEA +LARR+IY AT+RDA SGG  ++YHV  +GW ++S D+V +LH 
Sbjct  197  VMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHD  256

Query  205  HY  200
             Y
Sbjct  257  KY  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420