BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006J23

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU38112.1|  hypothetical protein MIMGU_mgv1a0013162mg               209   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_004158630.1|  PREDICTED: serine/threonine-protein phosphat...    211   7e-63   
gb|KGN47886.1|  hypothetical protein Csa_6G409920                       212   2e-62   Cucumis sativus [cucumbers]
gb|EPS64063.1|  serine/threonine-protein phosphatase                    206   2e-62   Genlisea aurea
gb|KJB22565.1|  hypothetical protein B456_004G054500                    211   1e-60   Gossypium raimondii
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-60   Eucalyptus grandis [rose gum]
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    213   7e-60   
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-59   Nicotiana sylvestris
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-59   Nicotiana tomentosiformis
emb|CDP03570.1|  unnamed protein product                                213   1e-59   Coffea canephora [robusta coffee]
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-59   Cucumis melo [Oriental melon]
gb|KJB22563.1|  hypothetical protein B456_004G054500                    211   2e-59   Gossypium raimondii
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    212   2e-59   
ref|XP_008777710.1|  PREDICTED: serine/threonine-protein phosphat...    208   2e-59   
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-59   Nelumbo nucifera [Indian lotus]
emb|CAC11128.1|  protein phosphatase                                    200   3e-59   Fagus sylvatica
ref|NP_001169882.1|  uncharacterized protein LOC100383776               197   4e-59   
ref|XP_010522673.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-59   Tarenaya hassleriana [spider flower]
gb|KJB22561.1|  hypothetical protein B456_004G054500                    211   4e-59   Gossypium raimondii
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-59   Tarenaya hassleriana [spider flower]
gb|KJB22562.1|  hypothetical protein B456_004G054500                    211   4e-59   Gossypium raimondii
ref|XP_006366382.1|  PREDICTED: serine/threonine-protein phosphat...    201   5e-59   
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               211   5e-59   Gossypium arboreum [tree cotton]
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               211   5e-59   Gossypium arboreum [tree cotton]
gb|KJB22560.1|  hypothetical protein B456_004G054500                    211   5e-59   Gossypium raimondii
gb|AEK86563.1|  serine/threonine-protein phosphatase                    211   5e-59   Camellia sinensis [black tea]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    210   7e-59   Sesamum indicum [beniseed]
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    206   2e-57   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK04150.1|  predicted protein                                      199   2e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    206   3e-57   Populus euphratica
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    206   3e-57   Populus euphratica
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    204   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             204   2e-56   Prunus persica
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             203   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    203   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    203   3e-56   Prunus mume [ume]
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    203   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO87444.1|  hypothetical protein CISIN_1g002713mg                   198   3e-56   Citrus sinensis [apfelsine]
gb|AFN44702.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    198   4e-56   Nicotiana benthamiana
emb|CDX97296.1|  BnaA02g20870D                                          202   4e-56   
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    202   4e-56   Brassica rapa
emb|CDX90906.1|  BnaA03g25860D                                          202   5e-56   
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    202   5e-56   
emb|CDY17964.1|  BnaC03g30360D                                          202   5e-56   Brassica napus [oilseed rape]
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             202   5e-56   Capsella rubella
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             202   5e-56   Eutrema salsugineum [saltwater cress]
emb|CDY62088.1|  BnaC02g46770D                                          202   5e-56   Brassica napus [oilseed rape]
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    202   5e-56   Brassica rapa
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    202   5e-56   
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    202   5e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    202   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...    202   7e-56   Brachypodium distachyon [annual false brome]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...    202   7e-56   Brachypodium distachyon [annual false brome]
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    202   8e-56   Solanum tuberosum [potatoes]
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...    202   1e-55   Brachypodium distachyon [annual false brome]
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...    201   2e-55   
gb|AAM83219.1|  AT4g03080/T4I9_4                                        201   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|EEE62303.1|  hypothetical protein OsJ_17091                          201   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054625.1|  Os05g0144400                                       200   2e-55   
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...    199   3e-55   Triticum urartu
emb|CAC09573.1|  protein phosphatase 1 (PP1)                            186   3e-55   Fagus sylvatica
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    200   4e-55   
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    200   4e-55   
gb|KDO87443.1|  hypothetical protein CISIN_1g002713mg                   198   4e-55   Citrus sinensis [apfelsine]
ref|XP_003591594.1|  Serine/threonine protein phosphatase               194   5e-55   
gb|EMT11348.1|  Serine/threonine phosphatase BSL1-like protein          199   6e-55   
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         199   6e-55   Jatropha curcas
gb|KDO87442.1|  hypothetical protein CISIN_1g002713mg                   198   8e-55   Citrus sinensis [apfelsine]
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  199   8e-55   Ricinus communis
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    199   9e-55   Vitis vinifera
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    199   1e-54   Fragaria vesca subsp. vesca
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    198   1e-54   Populus euphratica
gb|KDO87440.1|  hypothetical protein CISIN_1g002713mg                   198   1e-54   Citrus sinensis [apfelsine]
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             198   1e-54   Citrus clementina [clementine]
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    198   2e-54   Populus euphratica
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             198   2e-54   Citrus clementina [clementine]
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    198   2e-54   
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    197   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_002301559.1|  phosphatase family protein                         197   3e-54   
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440          197   4e-54   Sorghum bicolor [broomcorn]
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...    197   9e-54   Zea mays [maize]
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...    197   1e-53   Zea mays [maize]
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    196   1e-53   Glycine max [soybeans]
gb|KHN46606.1|  Serine/threonine-protein phosphatase BSL1               195   1e-53   Glycine soja [wild soybean]
ref|XP_007201685.1|  hypothetical protein PRUPE_ppa022807mg             194   2e-53   
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    195   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    195   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_003591586.1|  Serine/threonine protein phosphatase               194   2e-53   
gb|AES61845.2|  serine/threonine-protein phosphatase                    195   2e-53   Medicago truncatula
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-53   Cicer arietinum [garbanzo]
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             194   4e-53   Phaseolus vulgaris [French bean]
ref|XP_002321044.2|  phosphatase family protein                         194   5e-53   
ref|XP_006826451.1|  hypothetical protein AMTR_s00004p00179740          193   5e-53   
ref|XP_010914371.1|  PREDICTED: serine/threonine-protein phosphat...    192   6e-53   
ref|XP_010914370.1|  PREDICTED: serine/threonine-protein phosphat...    191   1e-52   
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    193   1e-52   Glycine max [soybeans]
gb|KGN66603.1|  hypothetical protein Csa_1G638500                       184   1e-52   Cucumis sativus [cucumbers]
ref|XP_010914369.1|  PREDICTED: serine/threonine-protein phosphat...    191   2e-52   
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    192   3e-52   Morella rubra [Chinese arbutus]
ref|NP_001266004.1|  Hop-interacting protein THI129                     191   6e-52   Solanum lycopersicum
gb|KJB42021.1|  hypothetical protein B456_007G132700                    190   1e-51   Gossypium raimondii
gb|EYU41290.1|  hypothetical protein MIMGU_mgv1a0202662mg               187   1e-51   Erythranthe guttata [common monkey flower]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    189   1e-51   Gossypium arboreum [tree cotton]
gb|ACR38393.1|  unknown                                                 179   1e-51   Zea mays [maize]
ref|XP_001769730.1|  predicted protein                                  189   4e-51   
ref|XP_001760494.1|  predicted protein                                  189   5e-51   
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    188   6e-51   Arabis alpina [alpine rockcress]
gb|EYU25965.1|  hypothetical protein MIMGU_mgv1a0006241mg               187   8e-51   Erythranthe guttata [common monkey flower]
ref|NP_001131445.1|  uncharacterized LOC100192777                       179   9e-51   
ref|NP_001167772.1|  uncharacterized protein LOC100381465               174   9e-51   
gb|KJB55562.1|  hypothetical protein B456_009G082300                    184   2e-50   Gossypium raimondii
ref|XP_010647448.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-50   Vitis vinifera
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3          188   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...    188   2e-50   Glycine max [soybeans]
emb|CDY57791.1|  BnaCnng32470D                                          187   2e-50   Brassica napus [oilseed rape]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3             187   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...    187   2e-50   Glycine max [soybeans]
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg             187   4e-50   Eutrema salsugineum [saltwater cress]
gb|KHN36505.1|  Serine/threonine-protein phosphatase BSL2               186   4e-50   Glycine soja [wild soybean]
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...    186   4e-50   Medicago truncatula
ref|XP_004170230.1|  PREDICTED: serine/threonine-protein phosphat...    184   6e-50   
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...    186   6e-50   Fragaria vesca subsp. vesca
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg             186   7e-50   Prunus persica
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Eucalyptus grandis [rose gum]
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Sesamum indicum [beniseed]
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Sesamum indicum [beniseed]
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Glycine max [soybeans]
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Prunus mume [ume]
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...    186   7e-50   
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Prunus mume [ume]
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Glycine max [soybeans]
ref|XP_003596905.1|  Serine/threonine protein phosphatase               186   8e-50   Medicago truncatula
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-50   Vitis vinifera
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-50   
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-50   Cicer arietinum [garbanzo]
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g             186   8e-50   Phaseolus vulgaris [French bean]
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-50   Pyrus x bretschneideri [bai li]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-50   
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   Pyrus x bretschneideri [bai li]
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg             186   9e-50   
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   Pyrus x bretschneideri [bai li]
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   Camelina sativa [gold-of-pleasure]
gb|KDP42962.1|  hypothetical protein JCGZ_23904                         186   9e-50   Jatropha curcas
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   Cicer arietinum [garbanzo]
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB55561.1|  hypothetical protein B456_009G082300                    184   9e-50   Gossypium raimondii
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...    186   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-49   
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...    186   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007015660.1|  BRI1 suppressor 1 (BSU1)-like 3 isoform 4          184   1e-49   
emb|CBI24435.3|  unnamed protein product                                186   1e-49   Vitis vinifera
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...    186   1e-49   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK06303.1|  predicted protein                                      179   1e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-49   
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-49   Brassica rapa
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...    186   1e-49   
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    184   1e-49   Elaeis guineensis
emb|CDY57485.1|  BnaAnng14650D                                          185   1e-49   Brassica napus [oilseed rape]
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...    185   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_009775149.1|  PREDICTED: serine/threonine-protein phosphat...    176   2e-49   Nicotiana sylvestris
gb|KHN03759.1|  Serine/threonine-protein phosphatase BSL1               184   2e-49   Glycine soja [wild soybean]
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...    185   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...    185   2e-49   Tarenaya hassleriana [spider flower]
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...    185   2e-49   Gossypium arboreum [tree cotton]
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g             185   2e-49   
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1          185   2e-49   
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...    185   2e-49   Populus euphratica
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...    185   2e-49   Cucumis melo [Oriental melon]
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...    185   3e-49   Populus euphratica
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...    185   3e-49   Populus euphratica
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...    184   3e-49   Cucumis sativus [cucumbers]
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g             184   3e-49   Phaseolus vulgaris [French bean]
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...    184   3e-49   Gossypium arboreum [tree cotton]
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg                184   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...    183   4e-49   Setaria italica
gb|KJB55556.1|  hypothetical protein B456_009G082300                    184   4e-49   Gossypium raimondii
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...    184   5e-49   Sesamum indicum [beniseed]
gb|KJB35468.1|  hypothetical protein B456_006G116600                    181   6e-49   Gossypium raimondii
dbj|BAF02235.1|  putative protein serine/threonine phosphatase alpha    181   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009606099.1|  PREDICTED: serine/threonine-protein phosphat...    181   7e-49   Nicotiana tomentosiformis
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2               183   7e-49   Glycine soja [wild soybean]
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...    183   7e-49   Nelumbo nucifera [Indian lotus]
ref|XP_001765008.1|  predicted protein                                  183   7e-49   
ref|XP_009606096.1|  PREDICTED: serine/threonine-protein phosphat...    181   8e-49   
ref|XP_008787777.1|  PREDICTED: serine/threonine-protein phosphat...    182   8e-49   Phoenix dactylifera
ref|XP_008787776.1|  PREDICTED: serine/threonine-protein phosphat...    182   8e-49   
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...    183   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...    183   9e-49   Glycine max [soybeans]
gb|KDO46579.1|  hypothetical protein CISIN_1g001895mg                   181   9e-49   Citrus sinensis [apfelsine]
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...    183   9e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like     183   1e-48   Solanum tuberosum [potatoes]
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...    183   1e-48   Nelumbo nucifera [Indian lotus]
gb|KJB35474.1|  hypothetical protein B456_006G116600                    182   1e-48   Gossypium raimondii
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...    183   1e-48   Solanum lycopersicum
gb|KJB35470.1|  hypothetical protein B456_006G116600                    183   1e-48   Gossypium raimondii
ref|XP_006367582.1|  PREDICTED: serine/threonine-protein phosphat...    181   1e-48   Solanum tuberosum [potatoes]
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...    182   2e-48   Nicotiana sylvestris
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...    182   2e-48   Nicotiana sylvestris
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...    182   2e-48   Elaeis guineensis
ref|XP_003605992.1|  Serine/threonine protein phosphatase               181   2e-48   
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...    182   2e-48   Elaeis guineensis
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...    182   2e-48   
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    182   2e-48   Nicotiana sylvestris
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   Phoenix dactylifera
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...    182   3e-48   Medicago truncatula
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   Phoenix dactylifera
ref|NP_001266022.1|  Hop-interacting protein THI140                     182   3e-48   Solanum lycopersicum
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg             182   3e-48   
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   Phoenix dactylifera
ref|XP_002513730.1|  bsu-protein phosphatase, putative                  181   3e-48   
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg             182   3e-48   Citrus clementina [clementine]
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg             182   3e-48   Capsella rubella
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...    181   3e-48   Solanum lycopersicum
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2             181   3e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19666.1|  AT1G08420                                              181   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2          181   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...    181   4e-48   Sesamum indicum [beniseed]
gb|EEE65895.1|  hypothetical protein OsJ_21718                          181   4e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002889692.1|  kelch repeat-containing protein                    181   4e-48   Arabidopsis lyrata subsp. lyrata
emb|CDP15567.1|  unnamed protein product                                181   4e-48   Coffea canephora [robusta coffee]
ref|NP_001067290.1|  Os12g0617900                                       181   5e-48   
gb|AFW68155.1|  putative kelch repeat-containing protein containi...    174   5e-48   
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...    181   6e-48   Setaria italica
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...    181   6e-48   Zea mays [maize]
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...    181   7e-48   Nicotiana tomentosiformis
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...    179   7e-48   Triticum urartu
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...    180   7e-48   
ref|XP_001781021.1|  predicted protein                                  181   8e-48   
gb|KJB21740.1|  hypothetical protein B456_004G011600                    181   8e-48   Gossypium raimondii
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850          181   8e-48   Sorghum bicolor [broomcorn]
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371             180   8e-48   
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...    180   1e-47   Oryza brachyantha
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932             180   1e-47   
gb|EEE59591.1|  hypothetical protein OsJ_11899                          180   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002313501.2|  kelch repeat-containing family protein             180   1e-47   
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...    180   1e-47   Solanum tuberosum [potatoes]
gb|EEC75832.1|  hypothetical protein OsI_12812                          180   1e-47   Oryza sativa Indica Group [Indian rice]
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...    180   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...    180   1e-47   Zea mays [maize]
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...    180   1e-47   
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...    179   1e-47   
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...    179   2e-47   Sesamum indicum [beniseed]
gb|EPS70499.1|  hypothetical protein M569_04238                         179   2e-47   Genlisea aurea
ref|XP_009606098.1|  PREDICTED: serine/threonine-protein phosphat...    177   2e-47   
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...    179   3e-47   
gb|AAD26883.1|  putative phosphoprotein phosphatase                     176   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg             178   6e-47   Eutrema salsugineum [saltwater cress]
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...    178   7e-47   Nicotiana tomentosiformis
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...    177   7e-47   Nicotiana sylvestris
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...    177   8e-47   Nicotiana tomentosiformis
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...    174   1e-46   
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...    177   1e-46   Brachypodium distachyon [annual false brome]
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...    177   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...    176   3e-46   Solanum lycopersicum
ref|XP_004982315.1|  PREDICTED: serine/threonine-protein phosphat...    175   3e-46   
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...    176   3e-46   Solanum tuberosum [potatoes]
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...    176   3e-46   
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...    176   3e-46   Camelina sativa [gold-of-pleasure]
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...    176   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...    175   3e-46   Phoenix dactylifera
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2          176   4e-46   
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...    175   5e-46   Solanum tuberosum [potatoes]
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...    175   6e-46   Solanum lycopersicum
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460          175   6e-46   Sorghum bicolor [broomcorn]
gb|AAF22889.1|AC006932_6  T27G7.10                                      175   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...    175   8e-46   Setaria italica
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    174   8e-46   
ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          174   9e-46   
ref|XP_003577251.1|  PREDICTED: serine/threonine-protein phosphat...    174   9e-46   Brachypodium distachyon [annual false brome]
gb|EMT08803.1|  Serine/threonine-phosphatase BSL2-like protein          174   1e-45   
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                   174   2e-45   Citrus sinensis [apfelsine]
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690          174   4e-45   
gb|EMT33719.1|  Serine/threonine-phosphatase BSL2-like protein          171   2e-44   
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...    170   4e-44   Brassica rapa
emb|CDY06313.1|  BnaA09g48900D                                          170   4e-44   
emb|CDY22684.1|  BnaC08g43180D                                          170   4e-44   
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                    169   1e-43   
emb|CBI24997.3|  unnamed protein product                                167   2e-43   
ref|XP_010031570.1|  PREDICTED: serine/threonine-protein phosphat...    167   3e-43   
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...    167   3e-43   
gb|AFW68156.1|  putative kelch repeat-containing protein containi...    161   1e-42   
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...    163   8e-42   
emb|CDX97481.1|  BnaC08g13460D                                          163   9e-42   
emb|CDY31148.1|  BnaA08g26980D                                          162   2e-41   
ref|XP_007508044.1|  predicted protein                                  157   2e-41   
ref|XP_002974662.1|  hypothetical protein SELMODRAFT_442608             158   3e-40   
emb|CAN67845.1|  hypothetical protein VITISV_016668                     156   3e-40   
ref|XP_002963377.1|  hypothetical protein SELMODRAFT_438528             158   3e-40   
ref|XP_007510268.1|  predicted protein                                  158   5e-40   
emb|CDY17966.1|  BnaC03g30380D                                          148   1e-39   
ref|XP_001420111.1|  predicted protein                                  155   4e-39   
emb|CEF99328.1|  Serine/threonine-specific protein phosphatase/bi...    154   1e-38   
gb|KDD72092.1|  calcineurin-like phosphoesterase                        147   2e-38   
ref|XP_003081555.1|  Serine/threonine specific protein phosphatas...    154   3e-38   
gb|KJB35473.1|  hypothetical protein B456_006G116600                    152   5e-38   
ref|XP_001689767.1|  protein phosphatase 1 beta                         147   2e-36   
ref|XP_003058098.1|  predicted protein                                  147   3e-36   
ref|XP_005846245.1|  hypothetical protein CHLNCDRAFT_135536             145   9e-36   
ref|XP_005645525.1|  protein phosphatase 1 beta                         145   1e-35   
ref|XP_002499734.1|  predicted protein                                  145   1e-35   
ref|XP_002958148.1|  hypothetical protein VOLCADRAFT_84366              145   2e-35   
ref|XP_011402161.1|  Serine/threonine-protein phosphatase BSL3          143   2e-35   
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...    139   1e-33   
ref|XP_007508023.1|  predicted protein                                  135   2e-33   
gb|EPS58158.1|  serine/threonine-protein phosphatase                    131   1e-32   
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...    136   2e-32   
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...    129   3e-30
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1             129   4e-30   
emb|CAN62681.1|  hypothetical protein VITISV_026755                     123   6e-30   
gb|AAF86539.1|AC002560_32  F21B7.7                                      129   6e-30   
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg             127   2e-29   
emb|CDY07313.1|  BnaC05g26750D                                          121   4e-29   
ref|XP_006418234.1|  hypothetical protein EUTSA_v10009980mg             123   5e-28   
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1          121   2e-27   
ref|XP_009144944.1|  PREDICTED: serine/threonine-protein phosphat...    118   2e-26   
emb|CDY29598.1|  BnaA05g15720D                                          118   2e-26   
gb|AFK45415.1|  unknown                                                 108   5e-25   
gb|KFK42698.1|  hypothetical protein AALP_AA1G028300                    114   2e-24   
gb|KFK42699.1|  hypothetical protein AALP_AA1G028300                    114   2e-24   
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...    113   2e-24   
gb|AAC69437.1|  protein serine/threonine phosphatase alpha              107   3e-22   
gb|ETW46597.1|  hypothetical protein PFMALIP_05500                      106   4e-22   
ref|XP_001348804.1|  protein serine/threonine phosphatase               106   4e-22   
ref|XP_727284.1|  protein serine/threonine phosphatase alpha            106   4e-22   
gb|ETB63046.1|  hypothetical protein YYC_00643                          106   4e-22   
ref|XP_678280.1|  protein serine/threonine phosphatase                  106   4e-22   
gb|EUD70469.1|  protein phosphatase                                     106   5e-22   
emb|CDS50472.1|  protein phosphatase containing kelch-like domains      106   5e-22   
gb|EWC73527.1|  hypothetical protein C923_05783                         106   5e-22   
emb|CDO67125.1|  protein phosphatase containing kelch-like domain...    105   5e-22   
ref|XP_008622216.1|  protein phosphatase                                105   6e-22   
emb|CDR15635.1|  protein phosphatase containing kelch-like domain...    105   6e-22   
ref|XP_002260205.1|  protein serine/threonine phosphatase               105   8e-22   
ref|XP_008813960.1|  protein phosphatase                                105   1e-21   
ref|XP_666328.1|  protein serine/threonine phosphatase alpha            104   1e-21   
ref|XP_001388090.1|  protein serine/threonine phosphatase alpha         104   1e-21   
ref|XP_004223870.1|  protein serine/threonine phosphatase               104   1e-21   
ref|XP_001615727.1|  protein serine/threonine phosphatase               104   1e-21   
ref|XP_001609688.1|  kelch repeat domain containing/Serine/threon...    104   1e-21   
gb|ABR25780.1|  serine/threonine-protein phosphatase bsl2               100   2e-21   
emb|CDX71467.1|  BnaC04g17020D                                          101   2e-21   
ref|XP_953085.1|  serine/threonine phosphatase                          103   2e-21   
gb|KFG42467.1|  kelch repeat domain containing/Serine/threonine p...  99.8    3e-21   
ref|XP_764058.1|  serine/threonine protein phosphatase                  103   3e-21   
ref|XP_001458952.1|  hypothetical protein                               103   4e-21   
emb|CDR94993.1|  kelch repeat domain containing/Serine/threonine ...    103   5e-21   
ref|XP_011129274.1|  serine/threonine-protein phosphatase               101   5e-21   
emb|CDI76910.1|  Serine/threonine-protein phosphatase , related         102   8e-21   
ref|XP_001438977.1|  hypothetical protein                               102   8e-21   
ref|XP_001443631.1|  hypothetical protein                               102   9e-21   
emb|CDJ38799.1|  Serine/threonine-protein phosphatase , related       97.8    1e-20   
emb|CCF73649.1|  unnamed protein product                                101   1e-20   
ref|XP_004831147.1|  Ser/Thr protein phosphatase family member pr...    101   2e-20   
ref|XP_001022531.2|  Ser/Thr protein phosphatase family protein         101   2e-20   
gb|KIY95206.1|  hypothetical protein MNEG_12757                       93.6    3e-20   
ref|XP_008889177.1|  kelch repeat domain containing/Serine/threon...    100   3e-20   
gb|ESS33859.1|  kelch repeat domain containing/Serine/threonine p...  99.8    7e-20   
ref|XP_002368432.1|  protein serine/threonine phosphatase, putati...  99.8    7e-20   
gb|EPR59771.1|  kelch repeat domain containing/Serine/threonine p...  99.8    7e-20   
emb|CDW91130.1|  ser thr protein phosphatase family protein           99.0    9e-20   
emb|CDJ50529.1|  protein serine/threonine phosphatase, putative /...  97.4    2e-19   
ref|XP_002139134.1|  serine/threonine protein phosphatase             98.2    2e-19   
ref|XP_002785335.1|  bsu-protein phosphatase, putative                96.3    2e-19   
emb|CDJ58913.1|  Serine/threonine-protein phosphatase , related       97.4    3e-19   
gb|EJY66618.1|  Serine/threonine-protein phosphatase                  97.4    3e-19   
ref|XP_004036424.1|  protein serine threonine phosphatase alpha, ...  95.9    1e-18   
ref|XP_004030178.1|  ser thr protein phosphatase family protein, ...  94.4    3e-18   
ref|XP_002788680.1|  protein serine/threonine phosphatase, putative   94.0    6e-18   
ref|XP_010023961.1|  PREDICTED: serine/threonine-protein phosphat...  89.4    1e-17   
ref|XP_010023960.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    2e-17   
ref|XP_005793306.1|  hypothetical protein EMIHUDRAFT_417293           91.3    2e-17   
gb|ETO30408.1|  hypothetical protein RFI_06712                        89.0    3e-17   
ref|XP_004995703.1|  hypothetical protein PTSG_03117                  91.7    5e-17   
gb|ETO22086.1|  protein serine/threonine phosphatase                  90.9    6e-17   
ref|XP_004987444.1|  hypothetical protein PTSG_11520                  86.3    1e-16   
ref|XP_001746829.1|  hypothetical protein                             89.4    1e-16   
ref|XP_001429774.1|  hypothetical protein                             89.0    2e-16   
gb|EWM21847.1|  serine threonine-protein phosphatase bsl2             87.8    7e-16   
ref|XP_002902202.1|  calcineurin-like phosphoesterase, putative       86.7    8e-16   
gb|ADE76458.1|  unknown                                               83.6    2e-15   
ref|XP_009397621.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    2e-15   
ref|XP_004510082.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    3e-15   
ref|XP_010924761.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    3e-15   
ref|XP_007222643.1|  hypothetical protein PRUPE_ppa008543mg           82.8    3e-15   
dbj|BAJ99103.1|  predicted protein                                    82.4    3e-15   
gb|ETI52475.1|  hypothetical protein F443_04391                       85.1    4e-15   
ref|XP_008224363.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    4e-15   
gb|ETO81245.1|  hypothetical protein F444_04413                       85.1    4e-15   
gb|ETM52081.1|  hypothetical protein L914_04213                       85.1    4e-15   
gb|ETL98921.1|  hypothetical protein L917_04107                       85.1    4e-15   
gb|ETK92354.1|  hypothetical protein L915_04269                       85.1    4e-15   
sp|P48480.1|PP11_ACEPE  RecName: Full=Serine/threonine-protein ph...  82.4    4e-15   
ref|XP_008901676.1|  hypothetical protein PPTG_08717                  85.1    5e-15   
gb|ETP50198.1|  hypothetical protein F442_04419                       84.7    5e-15   
ref|XP_006581185.1|  PREDICTED: serine/threonine-protein phosphat...  82.0    6e-15   
gb|KHN22207.1|  Serine/threonine-protein phosphatase PP1              82.0    6e-15   
gb|EJU02609.1|  catalytic subunit of type 1 serine/threonine prot...  82.4    7e-15   
ref|XP_009382144.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    7e-15   
ref|XP_010935746.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    8e-15   
dbj|BAM19951.1|  flapwing                                             78.2    8e-15   
ref|XP_002277816.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    9e-15   
gb|ABE93049.1|  Serine/threonine-specific protein phosphatase and...  81.3    1e-14   
ref|XP_007016295.1|  Type one serine/threonine protein phosphatase 2  81.3    1e-14   
gb|KDO69205.1|  hypothetical protein CISIN_1g020919mg                 80.9    1e-14   
ref|XP_003626624.1|  Serine/threonine protein phosphatase PP1         81.3    1e-14   
ref|XP_002908542.1|  serine/threonine-protein phosphatase, putative   84.0    1e-14   
ref|XP_007153420.1|  hypothetical protein PHAVU_003G033800g           80.9    1e-14   
gb|KHG03131.1|  Serine/threonine-protein phosphatase PP1 isozyme ...  80.5    1e-14   
ref|XP_006435598.1|  hypothetical protein CICLE_v10032138mg           81.3    1e-14   
ref|XP_006486426.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    1e-14   
gb|ERG80424.1|  serine threonine-protein phosphatase pp1 isozyme 7    78.6    1e-14   
gb|KIR26850.1|  serine/threonine-protein phosphatase PP1              78.6    2e-14   
ref|XP_008795019.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
gb|KJB19980.1|  hypothetical protein B456_003G128300                  80.9    2e-14   
ref|XP_011073522.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
ref|XP_004305060.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
ref|XP_001395377.2|  serine/threonine-protein phosphatase PP2A ca...  80.9    2e-14   
ref|XP_008796501.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
emb|CAK41137.1|  unnamed protein product                              80.9    2e-14   
ref|XP_009339616.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
ref|XP_008604603.1|  hypothetical protein SDRG_00878                  83.2    2e-14   
ref|XP_011085000.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    2e-14   
ref|XP_009398739.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
gb|KDO32597.1|  hypothetical protein SPRG_03070                       82.8    2e-14   
ref|XP_010935745.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
gb|KDO57610.1|  hypothetical protein CISIN_1g017614mg                 79.7    2e-14   
gb|EHA25766.1|  hypothetical protein ASPNIDRAFT_50362                 80.5    2e-14   
emb|CDS11155.1|  Putative Serine/threonine-protein phosphatase        80.5    2e-14   
ref|XP_009342488.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    2e-14   
ref|XP_006827474.1|  hypothetical protein AMTR_s00009p00134520        80.5    2e-14   
emb|CCA19201.1|  serine/threonineprotein phosphatase PP1gamma cat...  80.5    2e-14   
ref|XP_002319103.2|  hypothetical protein POPTR_0013s04310g           80.5    2e-14   
dbj|BAF48782.1|  hypothetical protein                                 81.3    2e-14   
emb|CDH50078.1|  serine threonine-protein phosphatase pp1             80.9    2e-14   
gb|KJB08919.1|  hypothetical protein B456_001G112800                  80.1    2e-14   
ref|XP_008784741.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
ref|XP_010935744.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
gb|KHG02218.1|  Serine/threonine-protein phosphatase PP1 isozyme ...  80.5    2e-14   
emb|CCI39850.1|  unnamed protein product                              80.5    2e-14   
emb|CDS04786.1|  Putative Serine/threonine-protein phosphatase        80.5    2e-14   
ref|XP_010261395.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
ref|XP_002905419.1|  serine/threonine-protein phosphatase PP1-gam...  80.5    2e-14   
gb|KDP23705.1|  hypothetical protein JCGZ_23538                       80.9    2e-14   
emb|CDY22350.1|  BnaA06g36720D                                        80.5    2e-14   
ref|XP_009101787.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
ref|XP_009101788.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    3e-14   
ref|XP_009398030.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    3e-14   
gb|EYU35261.1|  hypothetical protein MIMGU_mgv1a0105852mg             79.3    3e-14   
ref|XP_002521968.1|  serine/threonine protein phosphatase, putative   80.9    3e-14   
emb|CBI31141.3|  unnamed protein product                              79.7    3e-14   
emb|CDY60901.1|  BnaCnng37040D                                        80.5    3e-14   
gb|KHG29440.1|  hypothetical protein F383_12544                       80.1    3e-14   
emb|CAK36941.1|  unnamed protein product                              77.4    3e-14   
gb|KJB08918.1|  hypothetical protein B456_001G112800                  80.1    3e-14   
ref|XP_010940610.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
ref|XP_004296363.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
ref|XP_002298335.1|  Serine/threonine protein phosphatase PP1 iso...  80.1    3e-14   
ref|XP_002323107.1|  hypothetical protein POPTR_0016s14930g           79.7    3e-14   
ref|XP_001388833.2|  serine/threonine-protein phosphatase PP1         77.4    3e-14   
ref|XP_011462265.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
gb|ETP53871.1|  hypothetical protein F442_01262                       82.0    3e-14   
ref|XP_002282188.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
emb|CBI31608.3|  unnamed protein product                              79.7    3e-14   
ref|XP_002863660.1|  hypothetical protein ARALYDRAFT_494661           80.1    3e-14   
ref|XP_001985583.1|  GH17149                                          79.7    3e-14   
emb|CCF44786.1|  serine/threonine-protein phosphatase PP1             77.4    3e-14   
ref|XP_009381054.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
emb|CAQ58626.1|  Serine-threonine phosphatase type 1                  79.7    3e-14   
gb|KDO24417.1|  serine/threonine-protein phosphatase PP1              79.7    3e-14   
gb|ETO84799.1|  hypothetical protein F444_01323                       82.4    3e-14   
gb|AFW99159.1|  serine/threonine-protein phosphatase PP1 isozyme ...  79.0    3e-14   
ref|XP_002264806.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    3e-14   
gb|ETL49264.1|  hypothetical protein L916_01227                       82.4    4e-14   
ref|XP_008890978.1|  hypothetical protein PPTG_01130                  82.4    4e-14   
ref|XP_010272441.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    4e-14   
gb|ACN69491.1|  serine/threonine-protein phosphatase                  77.4    4e-14   
ref|XP_006648131.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    4e-14   
ref|XP_009845345.1|  serine/threonine-protein phosphatase             80.1    4e-14   
gb|AAK68780.1|  protein phosphatase                                   78.6    4e-14   
ref|XP_011006236.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    4e-14   
ref|XP_008341122.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    4e-14   
emb|CAN71489.1|  hypothetical protein VITISV_005340                   79.7    4e-14   
gb|KJB82281.1|  hypothetical protein B456_013G187100                  80.1    4e-14   
ref|XP_009522482.1|  hypothetical protein PHYSODRAFT_312787           81.6    4e-14   
ref|XP_009373991.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    4e-14   
ref|XP_005644561.1|  protein phosphatase 1                            79.7    4e-14   
gb|AFW99157.1|  serine/threonine-protein phosphatase PP1 isozyme ...  77.8    4e-14   
gb|ABW74579.1|  putative serine/threonine phosphatase                 79.7    4e-14   
gb|ETW45826.1|  serine/threonine-protein phosphatase PP1-gamma ca...  76.3    4e-14   
ref|XP_010759698.1|  serine/threonine-protein phosphatase PP1         77.4    4e-14   
ref|XP_008792366.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    4e-14   
ref|XP_009382143.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    4e-14   
gb|EGA59032.1|  Glc7p                                                 77.0    4e-14   
gb|EUR64176.1|  serine/threonine-protein phosphatase PP1-gamma ca...  76.6    4e-14   
gb|KJB82279.1|  hypothetical protein B456_013G187100                  80.1    4e-14   



>gb|EYU38112.1| hypothetical protein MIMGU_mgv1a0013162mg, partial [Erythranthe 
guttata]
Length=144

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  5    ENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  64

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGR LVIVPKLIHPLPPP  SP+TSPERV ++TWMQELNIQRP
Sbjct  65   SATNYCGTANNAGAILVVGRELVIVPKLIHPLPPPFQSPETSPERVTDETWMQELNIQRP  124

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQP+LDR+SLAYI
Sbjct  125  PTPTRGRPQPELDRSSLAYI  144



>ref|XP_004158630.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Cucumis 
sativus]
Length=321

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  182  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  241

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQR 
Sbjct  242  SATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQRR  301

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  302  PTPTRGRPQPDLDRSSLAYI  321



>gb|KGN47886.1| hypothetical protein Csa_6G409920 [Cucumis sativus]
Length=394

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  255  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  314

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQRP
Sbjct  315  SATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQRP  374

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  375  PTPTRGRPQPDLDRSSLAYI  394



>gb|EPS64063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=212

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            END V+GLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  73   ENDGVQGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  132

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPE   ++TWMQELNIQRP
Sbjct  133  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPEHAADETWMQELNIQRP  192

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  193  PTPTRGRPQPDLDRNSLAYI  212



>gb|KJB22565.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=538

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  399  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  458

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  459  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRP  518

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  519  PTPTRGRPQPDHDRSSLAYI  538



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  748  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  807

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNIQRP
Sbjct  808  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  868  PTPTRGRPQPDLDRSSLAYI  887



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   213 bits (543),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  748  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  807

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  808  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVADDTWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  868  PTPTRGRPQPDLDRSSLAYI  887



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  740  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  799

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNIQRP
Sbjct  800  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNIQRP  859

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  860  PTPTRGRPQPDHDRSSLAYI  879



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  740  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  799

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNIQRP
Sbjct  800  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNIQRP  859

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  860  PTPTRGRPQPDHDRSSLAYI  879



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  744  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  803

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPER+ E+ WMQELNIQRP
Sbjct  804  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEENWMQELNIQRP  863

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  864  PTPTRGRPQPDLDRNSLAYI  883



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  744  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  803

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER  EDTWMQELNIQRP
Sbjct  804  SATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERTVEDTWMQELNIQRP  863

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  864  PTPTRGRPQPDLDRSSLAYI  883



>gb|KJB22563.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
 gb|KJB22564.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=670

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  531  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  590

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  591  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRP  650

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  651  PTPTRGRPQPDHDRSSLAYI  670



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  766  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  825

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQRP
Sbjct  826  SATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQRP  885

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  886  PTPTRGRPQPDLDRSSLAYI  905



>ref|XP_008777710.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=552

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  413  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  472

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRG V+VPKLIHPLPPPL SPD+SP+ V EDTWMQELNIQRP
Sbjct  473  SATNYCGTANNAGAILVVGRGFVVVPKLIHPLPPPLRSPDSSPDHVLEDTWMQELNIQRP  532

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  533  PTPTRGRPQSANDRNSLAYI  552



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  746  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  805

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV ++TWMQELNIQRP
Sbjct  806  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVLDETWMQELNIQRP  865

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTP RGRPQPDLDR+SLAYI
Sbjct  866  PTPIRGRPQPDLDRSSLAYI  885



>emb|CAC11128.1| protein phosphatase [Fagus sylvatica]
Length=262

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQLITLF
Sbjct  123  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQLITLF  182

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQRP
Sbjct  183  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELNIQRP  242

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  243  PTPTRGRPQPDLDRSSLAYI  262



>ref|NP_001169882.1| uncharacterized protein LOC100383776 [Zea mays]
 gb|ACN35157.1| unknown [Zea mays]
Length=187

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  49   ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  108

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  109  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRP  167

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  168  PTPTRGRPQAAGDRNSLAYI  187



>ref|XP_010522673.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=837

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  698  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  757

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELNIQRP
Sbjct  758  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELNIQRP  817

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  818  PTPTRGRPQPDLDRNSLAYI  837



>gb|KJB22561.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=777

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  638  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  697

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  698  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRP  757

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  758  PTPTRGRPQPDHDRSSLAYI  777



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  748  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  807

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELNIQRP
Sbjct  808  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  868  PTPTRGRPQPDLDRNSLAYI  887



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  752  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  811

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  812  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRP  871

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  872  PTPTRGRPQPDHDRSSLAYI  891



>ref|XP_006366382.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Solanum 
tuberosum]
Length=293

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  154  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  213

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSP+TSPERV +D WMQELNIQRP
Sbjct  214  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELNIQRP  273

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  274  PTPTRGRPQPDHDRSSLAYI  293



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  715  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  774

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  775  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRP  834

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  835  PTPTRGRPQPDHDRSSLAYI  854



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  688  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  747

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  748  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRP  807

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  808  PTPTRGRPQPDHDRSSLAYI  827



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  748  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  807

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  808  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  868  PTPTRGRPQPDHDRSSLAYI  887



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  749  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  808

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGA+LVVGRGLVIVPKLIHPLPPP  SP+TSPERV  D WMQELNIQRP
Sbjct  809  SATNYCGTANNAGALLVVGRGLVIVPKLIHPLPPPFQSPETSPERVVHDAWMQELNIQRP  868

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQP+LDRNSLAYI
Sbjct  869  PTPTRGRPQPELDRNSLAYI  888



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   210 bits (535),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  743  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  802

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPER+ E+TWMQELNIQRP
Sbjct  803  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEETWMQELNIQRP  862

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  863  PTPTRGRPQPDHDRSSLAYI  882



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  738  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAHGQLITLF  797

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER  +DTWMQELNIQRP
Sbjct  798  SATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERCLDDTWMQELNIQRP  857

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DRNSLAYI
Sbjct  858  PTPTRGRPQPDHDRNSLAYI  877



>dbj|BAK04150.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  241  ENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  300

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  301  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRP  360

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DRNSLAYI
Sbjct  361  PTPTRGRPHSAGDRNSLAYI  380



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  747  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  806

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV GRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELNIQRP
Sbjct  807  SATNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQRP  866

Query  406  ptptrgrpqPDLDRNSLAYI  347
             TPTRGRPQPD DR+SLAYI
Sbjct  867  QTPTRGRPQPDHDRSSLAYI  886



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  746  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  805

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV GRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELNIQRP
Sbjct  806  SATNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQRP  865

Query  406  ptptrgrpqPDLDRNSLAYI  347
             TPTRGRPQPD DR+SLAYI
Sbjct  866  QTPTRGRPQPDHDRSSLAYI  885



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  748  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  807

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGR LVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELNIQRP
Sbjct  808  SATNYCGTANNAGAILVVGRELVIVPKLIHPLPPPILSPENSPERSMDDTWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  868  PTPTRGRPQPDFDRSSLAYI  887



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  748  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  807

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV EDTWMQELNIQRP
Sbjct  808  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  868  PTPTRGRPQPDLDRNSLAYI  887



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  742  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  862  PTPTRGRPQPDFDRSSLAYI  881



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  755  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  814

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  815  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  874

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  875  PTPTRGRPQPDFDRSSLAYI  894



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  734  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  793

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV EDTWMQELNIQRP
Sbjct  794  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQRP  853

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  854  PTPTRGRPQPDLDRNSLAYI  873



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  754  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  813

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP++SPE   EDTWMQELNIQRP
Sbjct  814  SATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPESSPEHAVEDTWMQELNIQRP  873

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR+SLAYI
Sbjct  874  PTPTRGRPQSANDRSSLAYI  893



>gb|KDO87444.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=475

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  336  ENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  395

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  396  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRP  455

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  456  PTPTRGRPQPDLDRNSLAYI  475



>gb|AFN44702.1| Ser/Thr phosphatase-containing Kelch repeat domain protein, partial 
[Nicotiana benthamiana]
Length=490

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKL LIIRAHECVMDGFERFAQGQL TLF
Sbjct  363  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLXLIIRAHECVMDGFERFAQGQLXTLF  422

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  416
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNI
Sbjct  423  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNI  479



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  735  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  794

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  795  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  854

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  855  PTPTRGRPQPDFDRSSLAYI  874



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  741  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  800

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  801  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  860

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  861  PTPTRGRPQPDFDRSSLAYI  880



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   202 bits (515),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  747  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  806

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  807  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  866

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  867  PTPTRGRPQPDFDRSSLAYI  886



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   202 bits (515),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  742  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  862  PTPTRGRPQPDFDRSSLAYI  881



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   202 bits (515),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  747  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  806

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  807  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  866

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  867  PTPTRGRPQPDFDRSSLAYI  886



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  742  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  862  PTPTRGRPQPDFDRSSLAYI  881



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  742  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  862  PTPTRGRPQPDFDRSSLAYI  881



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  738  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  797

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  798  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  857

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  858  PTPTRGRPQPDFDRSSLAYI  877



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  739  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  798

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  799  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  858

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  859  PTPTRGRPQPDFDRSSLAYI  878



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  743  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  802

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  803  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  862

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  863  PTPTRGRPQPDFDRSSLAYI  882



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  742  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  862  PTPTRGRPQPDFDRSSLAYI  881



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  743  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  802

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  803  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  862

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  863  PTPTRGRPQPDFDRSSLAYI  882



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  761  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  820

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  821  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQRP  880

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DRNSLAYI
Sbjct  881  PTPTRGRPHSASDRNSLAYI  900



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  729  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  788

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  789  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQRP  848

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DRNSLAYI
Sbjct  849  PTPTRGRPHSASDRNSLAYI  868



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  739  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  798

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSP+TSPERV +D WMQELNIQRP
Sbjct  799  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELNIQRP  858

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  859  PTPTRGRPQPDHDRSSLAYI  878



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  750  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  809

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  810  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQRP  869

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DRNSLAYI
Sbjct  870  PTPTRGRPHSASDRNSLAYI  889



>ref|XP_006654987.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Oryza brachyantha]
Length=829

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQLITLF
Sbjct  690  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQLITLF  749

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  750  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRP  809

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  810  PTPTRGRPQSASDRNSLAYI  829



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  742  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAPGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  862  PTPTRGRPQPDFDRSSLAYI  881



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQLITLF
Sbjct  738  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQLITLF  797

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  798  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRP  857

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  858  PTPTRGRPQSASDRNSLAYI  877



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQLITLF
Sbjct  744  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQLITLF  803

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  804  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRP  863

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  864  PTPTRGRPQSASDRNSLAYI  883



>gb|EMS55151.1| Serine/threonine-protein phosphatase BSL1-like protein [Triticum 
urartu]
Length=770

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  631  ENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  690

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  691  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRP  750

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DRNSLAYI
Sbjct  751  PTPTRGRPHSAGDRNSLAYI  770



>emb|CAC09573.1| protein phosphatase 1 (PP1) [Fagus sylvatica]
Length=139

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQLITLF
Sbjct  9    ENDSAEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQLITLF  68

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  416
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNI
Sbjct  69   SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELNI  125



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  743  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  802

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQRP
Sbjct  803  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQRP  862

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  863  PTPTRGRPQPDLDRNSLAYI  882



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  745  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  804

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQRP
Sbjct  805  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQRP  864

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  865  PTPTRGRPQPDLDRNSLAYI  884



>gb|KDO87443.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=646

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  507  ENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  566

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  567  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRP  626

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  627  PTPTRGRPQPDLDRNSLAYI  646



>ref|XP_003591594.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=425

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  286  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  345

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQRP
Sbjct  346  SATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRP  405

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  406  PTPTRGRPQPDLDRGSLAYI  425



>gb|EMT11348.1| Serine/threonine phosphatase BSL1-like protein [Aegilops tauschii]
Length=840

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  701  ENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  760

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  761  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRP  820

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DRNSLAYI
Sbjct  821  PTPTRGRPHSAGDRNSLAYI  840



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   199 bits (507),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  747  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  806

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQRP
Sbjct  807  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELNIQRP  866

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  867  PTPTRGRPQPDLDRSSLAYI  886



>gb|KDO87442.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=679

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  540  ENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  599

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  600  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRP  659

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  660  PTPTRGRPQPDLDRNSLAYI  679



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   199 bits (506),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  746  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  805

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQRP
Sbjct  806  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELNIQRP  865

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  866  PTPTRGRPQPDLDRSSLAYI  885



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   199 bits (506),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  749  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  808

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER  +DTWMQELNIQRP
Sbjct  809  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERTVDDTWMQELNIQRP  868

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  869  PTPTRGRPQPDLDRNSLAYI  888



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            END VEGLRPNARGPGLVTFGPDRV DFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  744  ENDGVEGLRPNARGPGLVTFGPDRVMDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  803

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQRP
Sbjct  804  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIQSPETSPERVIDDTWMQELNIQRP  863

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  864  PTPTRGRPQPDLDRNSLAYI  883



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  747  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  806

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV  D WMQELNIQRP
Sbjct  807  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELNIQRP  866

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  867  PTPTRGRPQPDLDRNSLAYI  886



>gb|KDO87440.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87441.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=810

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  671  ENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  730

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  731  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRP  790

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  791  PTPTRGRPQPDLDRNSLAYI  810



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  746  ENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  805

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  806  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRP  865

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  866  PTPTRGRPQPDLDRNSLAYI  885



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  746  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  805

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV  D WMQELNIQRP
Sbjct  806  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELNIQRP  865

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  866  PTPTRGRPQPDLDRNSLAYI  885



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  750  ENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  809

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  810  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRP  869

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  870  PTPTRGRPQPDLDRNSLAYI  889



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLI+RAHECVMDGFERFAQGQLITLF
Sbjct  747  ENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIVRAHECVMDGFERFAQGQLITLF  806

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQRP
Sbjct  807  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQRP  866

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  867  PTPTRGRPQPDLDRNSLAYI  886



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLI+RAHECVMDGFERFAQGQLITLF
Sbjct  746  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIVRAHECVMDGFERFAQGQLITLF  805

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  806  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELNIQRP  865

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  866  PTPTRGRPQPDLDRNSLAYI  885



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV+DFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  751  ENDSIEGLRPNARGPGLVTFGPDRVSDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  810

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQRP
Sbjct  811  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELNIQRP  870

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  871  PTPTRGRPQPDLDRNSLAYI  890



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  757  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  816

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  817  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRP  875

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  876  PTPTRGRPQAAGDRNSLAYI  895



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score =   197 bits (500),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  841  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  900

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  901  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRP  959

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  960  PTPTRGRPQAAGDRNSLAYI  979



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  849  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  908

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  909  SATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRP  967

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  968  PTPTRGRPQAAGDRNSLAYI  987



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  742  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPERV ++TWMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  862  PTPTRGRPQPDLDRGSLAYI  881



>gb|KHN46606.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=818

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  679  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  738

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPERV ++TWMQELNIQRP
Sbjct  739  SATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELNIQRP  798

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  799  PTPTRGRPQPDLDRGSLAYI  818



>ref|XP_007201685.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
 gb|EMJ02884.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
Length=729

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCKR KLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  483  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRKKLQLIIRAHECVMDGFERFAQGQLITLF  542

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV ED WMQELNIQRP
Sbjct  543  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDMWMQELNIQRP  602

Query  406  ptptrgrpqPDLDRNSLA  353
            PTPTRGRPQPDLDRNSLA
Sbjct  603  PTPTRGRPQPDLDRNSLA  620



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  749  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  808

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V ++TWMQELNIQRP
Sbjct  809  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELNIQRP  868

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  869  PTPTRGRPQPDLDRSSLAYI  888



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  758  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  817

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V ++TWMQELNIQRP
Sbjct  818  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELNIQRP  877

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR+SLAYI
Sbjct  878  PTPTRGRPQPDLDRSSLAYI  897



>ref|XP_003591586.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=771

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  632  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  691

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQRP
Sbjct  692  SATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRP  751

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  752  PTPTRGRPQPDLDRGSLAYI  771



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  740  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  799

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQRP
Sbjct  800  SATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRP  859

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  860  PTPTRGRPQPDLDRGSLAYI  879



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  737  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  796

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQRP
Sbjct  797  SATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRP  856

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  857  PTPTRGRPQPDLDRGSLAYI  876



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  739  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  798

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER  ++TWMQELNIQRP
Sbjct  799  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERGMDETWMQELNIQRP  858

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  859  PTPTRGRPQPDLDRGSLAYI  878



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   194 bits (493),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  753  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  812

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELNIQRP
Sbjct  813  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQRP  872

Query  406  ptptrgrpqPDLDRNSLAYI  347
             TPTRGRPQPD DR+SLAYI
Sbjct  873  QTPTRGRPQPDHDRSSLAYI  892



>ref|XP_006826451.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
 gb|ERM93688.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
Length=671

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFAQG LITLF
Sbjct  532  ENDSIEGLRPNARGPGLVTFGPDRVLDFCKKNRLQLIIRAHECVMDGFERFAQGHLITLF  591

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGR LV+VPKLIHPLPPP  SP++SP+   E+TWMQELNIQRP
Sbjct  592  SATNYCGTANNAGAILVVGRDLVVVPKLIHPLPPPFQSPESSPDHALEETWMQELNIQRP  651

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQP  DRNSLA+I
Sbjct  652  PTPTRGRPQPAHDRNSLAFI  671



>ref|XP_010914371.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Elaeis guineensis]
Length=611

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  472  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  531

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELNIQRP
Sbjct  532  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQRP  591

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR+SLAYI
Sbjct  592  PTPTRGRPQSANDRHSLAYI  611



>ref|XP_010914370.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Elaeis guineensis]
Length=619

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  480  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  539

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELNIQRP
Sbjct  540  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQRP  599

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR+SLAYI
Sbjct  600  PTPTRGRPQSANDRHSLAYI  619



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  742  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  801

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPER  ++TWMQELNIQRP
Sbjct  802  SATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERGMDETWMQELNIQRP  861

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDR SLAYI
Sbjct  862  PTPTRGRPQPDLDRGSLAYI  881



>gb|KGN66603.1| hypothetical protein Csa_1G638500 [Cucumis sativus]
Length=288

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  149  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  208

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  RP
Sbjct  209  SATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRP  268

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA++
Sbjct  269  PTPTRGRPQVANDRGSLAWM  288



>ref|XP_010914369.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Elaeis guineensis]
Length=669

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  530  ENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  589

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELNIQRP
Sbjct  590  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQRP  649

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR+SLAYI
Sbjct  650  PTPTRGRPQSANDRHSLAYI  669



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  748  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  807

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPLLSP+TSPERV +D WMQELNIQRP
Sbjct  808  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVIDDAWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPDLDRNSLAYI
Sbjct  868  PTPTRGRPQPDLDRNSLAYI  887



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  739  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  798

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPLLSP+TSPERV +DTWMQELNIQRP
Sbjct  799  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVMDDTWMQELNIQRP  858

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  859  PTPTRGRPQPDHDRSSLAYI  878



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFA GQLITLF
Sbjct  739  ENDSVEGLRPNARGPGLVTFGPDRVADFCKKNRLQLIIRAHECVMDGFERFAHGQLITLF  798

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+ SPERV +D WMQELNIQRP
Sbjct  799  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELNIQRP  858

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQP++DRNSLAYI
Sbjct  859  PTPTRGRPQPEVDRNSLAYI  878



>gb|EYU41290.1| hypothetical protein MIMGU_mgv1a0202662mg, partial [Erythranthe 
guttata]
Length=554

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  415  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  474

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER+ EDTWMQELN  RP
Sbjct  475  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELNANRP  534

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  535  PTPTRGRPQVTNDRGSLAWI  554



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFA GQLITLF
Sbjct  699  ENDSIEGLRPNARGPGLVTFGPDRVADFCKKNRLQLIIRAHECVMDGFERFAHGQLITLF  758

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+ SPERV +D WMQELNIQRP
Sbjct  759  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELNIQRP  818

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQP++DRNSLAYI
Sbjct  819  PTPTRGRPQPEVDRNSLAYI  838



>gb|ACR38393.1| unknown [Zea mays]
Length=213

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  73   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  132

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  133  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  188



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVT+GPDRV +FCK N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  823  ENDSVEGLRPNARGPGLVTYGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLITLF  882

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPER  EDTWMQ+LN+ RP
Sbjct  883  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQDLNVARP  942

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQP  DRNSLA+I
Sbjct  943  PTPTRGRPQPTSDRNSLAWI  962



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score =   189 bits (480),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  815  ENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLITLF  874

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP++SPER  EDTWMQELN+QRP
Sbjct  875  SATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAITSPESSPERHLEDTWMQELNVQRP  934

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  935  PTPTRGRPQAGNDRGSLAWI  954



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   188 bits (478),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  739  ENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  798

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+LSP+ SPE   +D WMQELNIQRP
Sbjct  799  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRP  858

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQPD DR+SLAYI
Sbjct  859  PTPTRGRPQPDFDRSSLAYI  878



>gb|EYU25965.1| hypothetical protein MIMGU_mgv1a0006241mg, partial [Erythranthe 
guttata]
Length=701

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  562  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  621

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER+ EDTWMQELN  RP
Sbjct  622  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELNANRP  681

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  682  PTPTRGRPQVTNDRGSLAWI  701



>ref|NP_001131445.1| uncharacterized LOC100192777 [Zea mays]
 gb|ACF79850.1| unknown [Zea mays]
Length=290

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  150  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  209

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  210  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  265



>ref|NP_001167772.1| uncharacterized protein LOC100381465 [Zea mays]
 gb|ACN26023.1| unknown [Zea mays]
Length=157

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  18   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  77

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+ + EDTWMQELN
Sbjct  78   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEASPDHI-EDTWMQELN  132



>gb|KJB55562.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=528

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  389  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  448

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  449  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  508

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  509  PTPTRGRPQVANDRGSLAWI  528



>ref|XP_010647448.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
 ref|XP_010647506.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
Length=660

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  521  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  580

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  581  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  640

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  641  PTPTRGRPQVTNDRGSLAWI  660



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  862   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  921

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN+ RP
Sbjct  922   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNVNRP  981

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  982   PTPTRGRPQNPNDRGSLAWI  1001



>ref|XP_003538088.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=1010

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  871   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  930

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPDTSPER  EDTWMQELN  RP
Sbjct  931   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELNANRP  990

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  991   PTPTRGRPQVTNDRGSLAWI  1010



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  858  ENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLITLF  917

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  RP
Sbjct  918  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHVDDTWMQELNANRP  977

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  978  PTPTRGRPQTPDDRGSLAWI  997



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  867   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  926

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN+ RP
Sbjct  927   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNVNRP  986

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  987   PTPTRGRPQNPNDRGSLAWI  1006



>ref|XP_006591057.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=1014

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  875   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  934

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPDTSPER  EDTWMQELN  RP
Sbjct  935   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELNANRP  994

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  995   PTPTRGRPQVTNDRGSLAWI  1014



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  866   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  925

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  926   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRP  985

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  986   PTPTRGRPQTPNDRGSLAWI  1005



>gb|KHN36505.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=861

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  722  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  781

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  782  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  841

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  842  PTPTRGRPPVTNDRGSLAWI  861



>gb|KEH38997.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=882

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  743  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  802

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  803  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  862

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  863  PTPTRGRPPVTNDRGSLAWI  882



>ref|XP_004170230.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=654

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  515  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  574

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  575  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNANRP  634

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  635  PTPTRGRPQVTNDRGSLAWI  654



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   186 bits (473),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  859  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  918

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  919  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  978

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  979  PTPTRGRPQVANDRGSLAWI  998



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  866   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  925

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  926   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  985

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  986   PTPTRGRPQVANDRGSLAWI  1005



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  860  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNINDLQLIVRAHECVMDGFERFAQGHLITLF  919

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  920  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  979

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  980  PTPTRGRPQVATDRGSLAWI  999



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  867   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  926

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  927   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  986

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  987   PTPTRGRPQVPNDRGSLAWI  1006



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  868   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  927

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  928   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  987

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  988   PTPTRGRPQVPNDRGSLAWI  1007



>ref|XP_003540821.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1001

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  862   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  921

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  922   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  981

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  982   PTPTRGRPQVTNDRGSLAWI  1001



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  866   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  925

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  926   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  985

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  986   PTPTRGRPQVANDRGSLAWI  1005



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  923   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRP  982

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  983   PTPTRGRPQNPNDRGSLAWI  1002



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  865   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  924

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  925   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  984

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  985   PTPTRGRPQVANDRGSLAWI  1004



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score =   186 bits (472),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  849  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  908

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  909  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  968

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  969  PTPTRGRPPVTNDRGSLAWI  988



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  856  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  915

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  916  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  975

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  976  PTPTRGRPPVTNDRGSLAWI  995



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  867   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  926

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  927   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELNANRP  986

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  987   PTPTRGRPQVTNDRGSLAWI  1006



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  923   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  982

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  983   PTPTRGRPQVANDRGSLAWI  1002



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  864   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  923

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  924   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  983

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  984   PTPTRGRPQVTNDRGSLAWI  1003



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  857  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  916

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  917  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  976

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  977  PTPTRGRPPVTNDRGSLAWI  996



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  862   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  921

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  922   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  981

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  982   PTPTRGRPQGANDRGSLAWI  1001



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  862   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  921

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  922   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  981

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  982   PTPTRGRPQGANDRGSLAWI  1001



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  862   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  921

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  922   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  981

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  982   PTPTRGRPQGANDRGSLAWI  1001



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  860  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  919

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  920  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRP  979

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  980  PTPTRGRPQNPNDRGSLAWI  999



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  865   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  924

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  925   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  984

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  985   PTPTRGRPQVANDRGSLAWI  1004



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  906   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  965

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  966   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRP  1025

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  1026  PTPTRGRPQNPNDRGSLAWI  1045



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  869   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  928

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  929   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  988

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  989   PTPTRGRPQVANDRGSLAWI  1008



>ref|XP_004506226.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506227.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Cicer arietinum]
Length=1003

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  864   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  923

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN  RP
Sbjct  924   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRP  983

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRP    DR SLA+I
Sbjct  984   PTPTRGRPPVANDRGSLAWI  1003



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLIIRAHECVMDGFERFAQG LITLF
Sbjct  846  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIIRAHECVMDGFERFAQGHLITLF  905

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  906  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELNANRP  965

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  966  PTPTRGRPQVANDRGSLAWI  985



>gb|KJB55561.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=700

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  561  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  620

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  621  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  680

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  681  PTPTRGRPQVANDRGSLAWI  700



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLIIRAHECVMDGFERFAQG LITLF
Sbjct  847  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIIRAHECVMDGFERFAQGHLITLF  906

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  907  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELNANRP  966

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  967  PTPTRGRPQVANDRGSLAWI  986



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  842  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  901

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPD SPE   EDTWMQELN  RP
Sbjct  902  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDASPEHHTEDTWMQELNANRP  961

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  962  PTPTRGRPQSSNDRGSLAWI  981



>ref|XP_004164757.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like, partial 
[Cucumis sativus]
Length=864

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  725  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  784

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  RP
Sbjct  785  SATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRP  844

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA++
Sbjct  845  PTPTRGRPQVANDRGSLAWM  864



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  843  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  902

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  903  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAINSPEASPERHTEDTWMQELNANRP  962

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  963  PTPTRGRPQTSNDRGSLAWI  982



>ref|XP_007015660.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
 gb|EOY33279.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
Length=822

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  683  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  742

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  743  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  802

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  803  PTPTRGRPQVTNDRGSLAWI  822



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  910   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  969

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  970   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELNANRP  1029

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  1030  PTPTRGRPQVTNDRGSLAWI  1049



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  880   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  939

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  940   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  999

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  1000  PTPTRGRPQVANDRGSLAWI  1019



>dbj|BAK06303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  257  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  316

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  317  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPTITSPETSPEHHIEDTWMQELN  372



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  842  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  901

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  RP
Sbjct  902  SATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRP  961

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA++
Sbjct  962  PTPTRGRPQVANDRGSLAWM  981



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  859  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  918

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  RP
Sbjct  919  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELNANRP  978

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  979  PTPTRGRPQTPDDRGSLAWI  998



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  869   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  928

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  RP
Sbjct  929   SATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRP  988

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA++
Sbjct  989   PTPTRGRPQVANDRGSLAWM  1008



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDS+EGLRPNARGPGLV FGPDRV DFC +N+LQLIIRAHECVMDGFERFAQGQLIT+F
Sbjct  749  ENDSIEGLRPNARGPGLVAFGPDRVADFCTKNQLQLIIRAHECVMDGFERFAQGQLITVF  808

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP  SP++SPE V EDTWMQELNIQRP
Sbjct  809  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPQQSPESSPEHVLEDTWMQELNIQRP  868

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  869  PTPTRGRPQSANDRNSLAYI  888



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  859  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  918

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  RP
Sbjct  919  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELNANRP  978

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  979  PTPTRGRPQTPDDRGSLAWI  998



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  852  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  911

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  912  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  971

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  972  PTPTRGRPQSPNDRGSLAWI  991



>ref|XP_009775149.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=286

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 114/140 (81%), Gaps = 3/140 (2%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  150  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  209

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR   +V       P P  SP+ SPER+ EDTWMQELN  RP
Sbjct  210  SATNYCGTANNAGAILVLGRD--LVVVPKLIHPLPPASPENSPERM-EDTWMQELNANRP  266

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  267  PTPTRGRPQTANDRGSLAWI  286



>gb|KHN03759.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=820

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 11/151 (7%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLITLF
Sbjct  670  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLITLF  729

Query  586  SATNYC-----------GTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNED  440
            SATNYC           GTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPER  ++
Sbjct  730  SATNYCAFQSHAGCVILGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERGMDE  789

Query  439  TWMQELNIqrpptptrgrpqPDLDRNSLAYI  347
            TWMQELNIQRPPTPTRGRPQPDLDR SLAYI
Sbjct  790  TWMQELNIQRPPTPTRGRPQPDLDRGSLAYI  820



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  876   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  935

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  936   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  995

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  996   PTPTRGRPQSPNDRGSLAWI  1015



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  869   ENDSVEGLRPNARGPGLVTFGPDRVMEFCSNNDLQLIVRAHECVMDGFERFAQGHLITLF  928

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  929   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  988

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  989   PTPTRGRPQAPNDRGSLAWI  1008



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  876   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  935

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  936   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  995

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  996   PTPTRGRPQVANDRGSLAWI  1015



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  861  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  920

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  921  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNANRP  980

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  981  PTPTRGRPQVTNDRGSLAWI  1000



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  880   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  939

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  940   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  999

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  1000  PTPTRGRPQVTNDRGSLAWI  1019



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  872   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  931

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+ P+ IHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  932   SATNYCGTANNAGAILVLGRDLVVGPQHIHPLPPAISSPEASPERHIEDTWMQELNANRP  991

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  992   PTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  923   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNANRP  982

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  983   PTPTRGRPQVTNDRGSLAWI  1002



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  872   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  931

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  932   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNANRP  991

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  992   PTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  872   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  931

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  932   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNANRP  991

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  992   PTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  923   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNANRP  982

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  983   PTPTRGRPQVTNDRGSLAWI  1002



>ref|XP_007132502.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
 gb|ESW04496.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
Length=1007

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  868   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  927

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  928   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  987

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   +R SLA+I
Sbjct  988   PTPTRGRPQVTNERGSLAWI  1007



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  877   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  936

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  937   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  996

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  997   PTPTRGRPQVANDRGSLAWI  1016



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score =   184 bits (468),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  866   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  925

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  RP
Sbjct  926   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIDDTWMQELNANRP  985

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  986   PTPTRGRPQVANDRGSLAWI  1005



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLITLF
Sbjct  749  ENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLITLF  808

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP++SPER  + TWMQELNIQRP
Sbjct  809  SATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRP  867

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DRNSLAYI
Sbjct  868  PTPTRGRPQAAGDRNSLAYI  887



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score =   184 bits (468),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  877   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  936

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  937   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  996

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  997   PTPTRGRPQVANDRGSLAWI  1016



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score =   184 bits (467),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  876   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  935

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  936   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELNANRP  995

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  996   PTPTRGRPQVANDRGSLAWI  1015



>gb|KJB35468.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35469.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=682

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  543  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  602

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  603  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  662

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA I
Sbjct  663  PTPTRGRPQVANDRGSLACI  682



>dbj|BAF02235.1| putative protein serine/threonine phosphatase alpha [Arabidopsis 
thaliana]
Length=737

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  597  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  656

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  657  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  712



>ref|XP_009606099.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana tomentosiformis]
Length=643

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  505  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  564

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  RP
Sbjct  565  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRP  623

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  624  PTPTRGRPQVANDRGSLAWI  643



>gb|KHN17986.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=929

 Score =   183 bits (464),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  790  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  849

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  850  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELNANRP  909

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  910  PTPTRGRPPVTNDRGSLAWI  929



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score =   183 bits (465),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  876   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  935

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP TSPE   EDTWMQELN  RP
Sbjct  936   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVASPQTSPEHHIEDTWMQELNANRP  995

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  996   PTPTRGRPQVANDRGSLAWI  1015



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score =   183 bits (465),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 5/145 (3%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVT+GPDRV +FCK N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  842  ENDSVEGLRPNARGPGLVTYGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLITLF  901

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQ-----EL  422
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPER  EDTWMQ     +L
Sbjct  902  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQARNSKDL  961

Query  421  NIqrpptptrgrpqPDLDRNSLAYI  347
            N+ RPPTPTRGRPQP  DRNSLA+I
Sbjct  962  NVARPPTPTRGRPQPTSDRNSLAWI  986



>ref|XP_009606096.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana tomentosiformis]
Length=678

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  540  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  599

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  RP
Sbjct  600  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRP  658

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  659  PTPTRGRPQVANDRGSLAWI  678



>ref|XP_008787777.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Phoenix dactylifera]
Length=825

 Score =   182 bits (461),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  686  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  745

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN  RP
Sbjct  746  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNANRP  805

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  806  PTPTRGRPQVANDRGSLAWI  825



>ref|XP_008787776.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Phoenix dactylifera]
Length=826

 Score =   182 bits (461),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  687  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  746

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN  RP
Sbjct  747  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNANRP  806

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  807  PTPTRGRPQVANDRGSLAWI  826



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score =   183 bits (465),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  874   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  933

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  934   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRP  993

Query  406   ptptrgrpqPDLDRNSLA  353
             PTPTRGRPQ   DR SLA
Sbjct  994   PTPTRGRPQNPNDRGSLA  1011



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score =   183 bits (465),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  864   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  923

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  924   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELNANRP  983

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRP    DR SLA+I
Sbjct  984   PTPTRGRPPVTNDRGSLAWI  1003



>gb|KDO46579.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=744

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  609  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  668

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  669  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  724



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score =   183 bits (464),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  847  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  906

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+ SPE   EDTWMQELN  RP
Sbjct  907  SATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAVSSPEASPEHHIEDTWMQELNANRP  966

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  967  PTPTRGRPQVASDRGSLAWI  986



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  860  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  919

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  920  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  979

Query  406  ptptrgrpqPDLDRNSLAY  350
            PTPTRGRPQ   DR S+A+
Sbjct  980  PTPTRGRPQVANDRGSVAW  998



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  882   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  941

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + +P TSPE   EDTWMQELN  RP
Sbjct  942   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAIATPQTSPEHHIEDTWMQELNANRP  1001

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA+I
Sbjct  1002  PTPTRGRPQVASDRGSLAWI  1021



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  843  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  902

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  903  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  962

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA I
Sbjct  963  PTPTRGRPQVANDRGSLACI  982



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  857  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  916

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  RP
Sbjct  917  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRP  976

Query  406  ptptrgrpqPDLDRNSLAY  350
            PTPTRGRPQ   DR S+A+
Sbjct  977  PTPTRGRPQVANDRGSVAW  995



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  876   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  935

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  RP
Sbjct  936   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRP  995

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA I
Sbjct  996   PTPTRGRPQVANDRGSLACI  1015



>ref|XP_006367582.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=744

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  606  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  665

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+ SPER+ EDTWMQELN  RP
Sbjct  666  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELNANRP  724

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  725  PTPTRGRPQTANDRGSLAWI  744



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  811  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  870

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  RP
Sbjct  871  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRP  929

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  930  PTPTRGRPQVANDRGSLAWI  949



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  846  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  905

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  RP
Sbjct  906  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRP  964

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  965  PTPTRGRPQVANDRGSLAWI  984



>ref|XP_010907354.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Elaeis guineensis]
Length=1028

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  890   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  949

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE + EDTWMQELN  RP
Sbjct  950   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELNANRP  1008

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGR Q   DR+SLA+I
Sbjct  1009  PTPTRGRSQAANDRSSLAWI  1028



>ref|XP_003605992.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=875

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  737  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  796

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP LSP+TSPER  EDTWMQELN  RP
Sbjct  797  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELNANRP  855

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  856  PTPTRGRPPVANDRGSLAWI  875



>ref|XP_010907353.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Elaeis guineensis]
Length=1029

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  891   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  950

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE + EDTWMQELN  RP
Sbjct  951   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELNANRP  1009

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGR Q   DR+SLA+I
Sbjct  1010  PTPTRGRSQAANDRSSLAWI  1029



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  839  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  898

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN  RP
Sbjct  899  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNANRP  958

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  959  PTPTRGRPQVANDRGSLAWI  978



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  851  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  910

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  RP
Sbjct  911  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRP  969

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  970  PTPTRGRPQVANDRGSLAWI  989



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  856  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  915

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN  RP
Sbjct  916  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNANRP  975

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGR Q   DR+SLA+I
Sbjct  976  PTPTRGRSQAANDRSSLAWI  995



>gb|AES88189.2| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=999

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  861  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  920

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP LSP+TSPER  EDTWMQELN  RP
Sbjct  921  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELNANRP  979

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRP    DR SLA+I
Sbjct  980  PTPTRGRPPVANDRGSLAWI  999



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  856  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  915

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN  RP
Sbjct  916  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNANRP  975

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGR Q   DR+SLA+I
Sbjct  976  PTPTRGRSQAANDRSSLAWI  995



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  844  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  903

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+ SPER+ EDTWMQELN  RP
Sbjct  904  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELNANRP  962

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  963  PTPTRGRPQTANDRGSLAWI  982



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  882  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  941

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  942  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  997



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  923  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  855  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  914

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN  RP
Sbjct  915  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNANRP  974

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGR Q   DR+SLA+I
Sbjct  975  PTPTRGRSQAANDRSSLAWI  994



>ref|XP_002513730.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF48677.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=874

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  735  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  794

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + S + SPER  EDTWMQELN  RP
Sbjct  795  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSAEASPERHIEDTWMQELNANRP  854

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SLA+I
Sbjct  855  PTPTRGRPQVTNDRGSLAWI  874



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  883  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  942

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  943  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  998



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  923  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>ref|XP_006592359.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=996

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  862  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  921

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  922  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  878  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  937

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  938  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  857  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  916

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  917  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  972



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  877  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  936

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  937  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  992



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  878  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  937

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  938  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  878  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  937

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  938  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  873  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  932

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  933  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  988



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  868  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  927

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  928  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  983



>gb|EEE65895.1| hypothetical protein OsJ_21718 [Oryza sativa Japonica Group]
Length=944

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  804  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  863

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  864  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNANRP  923

Query  406  ptptr-grpqPDLDRNSLAYI  347
            PTPTR      + DR SLA+I
Sbjct  924  PTPTRGRPQAANNDRGSLAWI  944



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  877  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  936

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  937  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  992



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  875  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  934

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  935  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  990



>ref|NP_001067290.1| Os12g0617900 [Oryza sativa Japonica Group]
 sp|Q2QM47.2|BSL2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL2 homolog; 
AltName: Full=BSU1-like protein 2 homolog [Oryza sativa 
Japonica Group]
 gb|ABA99873.2| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30309.1| Os12g0617900 [Oryza sativa Japonica Group]
 dbj|BAG89347.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69687.1| hypothetical protein OsI_39138 [Oryza sativa Indica Group]
Length=1009

 Score =   181 bits (459),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  869   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  928

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-qr  410
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  + 
Sbjct  929   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNANRP  988

Query  409   pptptrgrpqPDLDRNSLAYI  347
             P          + DR SLA+I
Sbjct  989   PTPTRGRPQAANNDRGSLAWI  1009



>gb|AFW68155.1| putative kelch repeat-containing protein containing ser/thr protein 
kinase family protein [Zea mays]
Length=396

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  257  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  316

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+ + EDTWMQELN
Sbjct  317  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEASPDHI-EDTWMQELN  371



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  857  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  916

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-qr  410
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  + 
Sbjct  917  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRP  976

Query  409  pptptrgrpqPDLDRNSLAYI  347
            P         P+ DR SLA+I
Sbjct  977  PTPTRGRPQAPNNDRGSLAWI  997



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score =   181 bits (458),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  858  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  917

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-qr  410
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  + 
Sbjct  918  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRP  977

Query  409  pptptrgrpqPDLDRNSLAYI  347
            P         P+ DR SLA+I
Sbjct  978  PTPTRGRPQAPNNDRGSLAWI  998



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score =   181 bits (458),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  853  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  912

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  RP
Sbjct  913  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRP  971

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SL +I
Sbjct  972  PTPTRGRPQVANDRGSLTWI  991



>gb|EMS59471.1| Serine/threonine-protein phosphatase BSL2-like protein [Triticum 
urartu]
Length=864

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  723  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  782

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  783  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  838



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score =   180 bits (457),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  818  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  877

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  RP
Sbjct  878  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRP  936

Query  406  ptptrgrpqPDLDRNSLAYI  347
            PTPTRGRPQ   DR SL +I
Sbjct  937  PTPTRGRPQVANDRGSLTWI  956



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  908   ENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLITLF  967

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   +D WMQELN  RP
Sbjct  968   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEHSPEHHLDDIWMQELNEHRP  1027

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQP  DR SLA+I
Sbjct  1028  PTPTRGRPQPAHDRGSLAWI  1047



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  874   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  933

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ S ER  EDTWMQELN  RP
Sbjct  934   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASSERHIEDTWMQELNANRP  993

Query  406   ptptrgrpqPDLDRNSLAYI  347
             PTPTRGRPQ   DR SLA++
Sbjct  994   PTPTRGRPQVTNDRGSLAWV  1013



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  868   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  927

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  928   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRP  987

Query  406   ptptr-grpqPDLDRNSLAYI  347
             PTPTR     P+ DR SLA+I
Sbjct  988   PTPTRGRPQAPNNDRGSLAWI  1008



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  855  ENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNNLQLIVRAHECVMDGFERFAQGHLITLF  914

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  416
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPE   EDTWM ELN+
Sbjct  915  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVTSPESSPEHQLEDTWMHELNV  971



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  800  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  859

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  860  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRP  919

Query  406  ptptrgrpqPDL-DRNSLAYI  347
            PTPTRGRPQ    DR SLA+I
Sbjct  920  PTPTRGRPQVAANDRGSLAWI  940



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  854  ENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNNLQLIVRAHECVMDGFERFAQGHLITLF  913

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  416
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPE   EDTWM ELN+
Sbjct  914  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVTSPESSPEHQLEDTWMHELNV  970



>gb|EEE59591.1| hypothetical protein OsJ_11899 [Oryza sativa Japonica Group]
Length=936

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  796  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  855

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  856  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRP  915

Query  406  ptptrgrpqPDL-DRNSLAYI  347
            PTPTRGRPQ    DR SLA+I
Sbjct  916  PTPTRGRPQVAANDRGSLAWI  936



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  853  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  912

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  913  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELN  968



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  860  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  919

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  ED WMQELN
Sbjct  920  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHMEDIWMQELN  975



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  923   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRP  982

Query  406   ptptrgrpqPDL-DRNSLAYI  347
             PTPTRGRPQ    DR SLA+I
Sbjct  983   PTPTRGRPQVAANDRGSLAWI  1003



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  863   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  922

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIqrp  407
             SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  RP
Sbjct  923   SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRP  982

Query  406   ptptrgrpqPDL-DRNSLAYI  347
             PTPTRGRPQ    DR SLA+I
Sbjct  983   PTPTRGRPQVAANDRGSLAWI  1003



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  855  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  914

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  915  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  970



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  856  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  915

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  916  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  971



>ref|XP_006664752.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=941

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQL++RAHECVMDGFERFAQG LITLF
Sbjct  801  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLMVRAHECVMDGFERFAQGHLITLF  860

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-qr  410
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  + 
Sbjct  861  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNANRP  920

Query  409  pptptrgrpqPDLDRNSLAYI  347
            P          + DR SLA+I
Sbjct  921  PTPTRGRPQVANNDRGSLAWI  941



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  876  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  935

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  936  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELN  991



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = -2

Query  766   ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
             ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  871   ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  930

Query  586   SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVN-EDTWMQELNIqr  410
             SATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPE  + EDTWMQELN  R
Sbjct  931   SATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPEHHHIEDTWMQELNANR  990

Query  409   pptptrgrpqPDLDRNSLAYI  347
             PPTPTRGRPQ   DR SLA++
Sbjct  991   PPTPTRGRPQVTNDRGSLAWM  1011



>ref|XP_009606098.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana tomentosiformis]
Length=676

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  540  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  599

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  600  SATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  654



>ref|XP_006592783.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=998

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  766  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF  587
            ENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LITLF
Sbjct  864  ENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLF  923

Query  586  SATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  419
            SATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  924  SATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELN  979



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890