BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006J16

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57272.1|  elongation factor 1-alpha                              376   1e-125   Ipomoea nil [qian niu]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          372   4e-124   Nicotiana tomentosiformis
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               371   1e-123   Nicotiana tomentosiformis
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    370   2e-123   Nicotiana tabacum [American tobacco]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               370   2e-123   Nicotiana sylvestris
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    366   3e-123   
dbj|BAA23658.1|  EF-1 alpha                                             369   4e-123   Oryza sativa [red rice]
gb|AFW76429.1|  putative translation elongation factor Tu family ...    363   5e-123   
dbj|BAA34348.1|  elongation factor-1 alpha                              369   5e-123   Nicotiana paniculata
ref|NP_001049145.1|  Os03g0177400                                       369   5e-123   
gb|AAC15413.1|  translation elongation factor-1 alpha                   369   5e-123   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          369   5e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               369   6e-123   Nicotiana tomentosiformis
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          369   6e-123   Nicotiana sylvestris
ref|NP_001234035.1|  elongation factor 1-alpha                          369   7e-123   Solanum lycopersicum
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          369   7e-123   Nicotiana sylvestris
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          369   7e-123   Oryza brachyantha
gb|ABV26710.1|  elongation factor 1 alpha                               369   9e-123   Gerbera hybrid cultivar
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          368   1e-122   Solanum lycopersicum
gb|AAQ90154.1|  putative translation elongation factor protein          362   1e-122   Solanum tuberosum [potatoes]
gb|AGH55661.1|  elongation factor 1-alpha                               364   1e-122   Atropa belladonna [deadly nightshade]
gb|AAN77897.1|  elongation factor 1 alpha                               368   1e-122   Stevia rebaudiana
gb|AGT16628.1|  elongation factor 1 alpha                               366   2e-122   Saccharum hybrid cultivar R570
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    368   2e-122   
gb|AHE76183.1|  elongation factor 1-alpha                               368   2e-122   Chrysanthemum indicum
dbj|BAC23049.1|  Elongation factor 1-alpha                              367   3e-122   Solanum tuberosum [potatoes]
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   362   3e-122   Gossypium raimondii
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         360   3e-122   Jatropha curcas
emb|CAL25349.1|  elongation factor 1 alpha                              358   4e-122   Platanus x hispanica [London plane tree]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                361   4e-122   Ricinus communis
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    367   4e-122   Theobroma cacao [chocolate]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               367   4e-122   Tarenaya hassleriana [spider flower]
ref|XP_002539209.1|  elongation factor 1-alpha, putative                361   5e-122   Ricinus communis
gb|AGH32502.1|  translation elongation factor-1 alpha                   367   5e-122   Stylosanthes guianensis [stylo]
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   362   6e-122   Gossypium raimondii
dbj|BAL14665.1|  elongation factor 1-alpha                              366   6e-122   Chrysanthemum seticuspe f. boreale
dbj|BAN42602.1|  putative elongation factor 1-alpha                     357   6e-122   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          366   7e-122   Solanum tuberosum [potatoes]
gb|AAL79775.1|  elongation factor 1 alpha                               366   7e-122   Saccharum hybrid cultivar CP72-2086
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          366   8e-122   Tarenaya hassleriana [spider flower]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               366   9e-122   Elaeis guineensis
gb|ABU63160.1|  elongation factor                                       366   9e-122   Saccharum officinarum [noble cane]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          366   1e-121   Tarenaya hassleriana [spider flower]
gb|AGT16893.1|  elongation factor 1-alpha                               366   1e-121   Saccharum hybrid cultivar R570
ref|NP_001152668.1|  LOC100286309                                       365   1e-121   Zea mays [maize]
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             364   1e-121   Solanum tuberosum [potatoes]
gb|ACR38047.1|  unknown                                                 365   1e-121   Zea mays [maize]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               365   2e-121   Elaeis guineensis
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     365   2e-121   Saccharum hybrid cultivar CP65-357
gb|KHG20498.1|  Elongation factor 1-alpha                               365   2e-121   Gossypium arboreum [tree cotton]
gb|ABA12225.1|  translation elongation factor 1A-9                      365   2e-121   Gossypium hirsutum [American cotton]
gb|AID52924.1|  elongation factor 1-alpha                               365   3e-121   Carthamus tinctorius
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  363   3e-121   Solanum tuberosum [potatoes]
gb|KHG26926.1|  Elongation factor 1-alpha                               365   3e-121   Gossypium arboreum [tree cotton]
gb|AGY80449.1|  elongation factor 1-alpha                               365   3e-121   Dendrocalamus latiflorus [sweet bamboo]
gb|AGZ90153.1|  elongation factor 1-alpha                               357   3e-121   Litsea cubeba [may chang]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    365   3e-121   
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    365   3e-121   Eucalyptus grandis [rose gum]
ref|NP_001275481.1|  elongation factor 1-alpha-like                     365   3e-121   Solanum tuberosum [potatoes]
gb|AFC88830.1|  putative elongation factor 1-alpha                      364   3e-121   Miscanthus sinensis
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          364   4e-121   Solanum tuberosum [potatoes]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    364   4e-121   Theobroma cacao [chocolate]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          364   4e-121   Tarenaya hassleriana [spider flower]
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    358   4e-121   
gb|ABB86283.1|  elongation factor-1 alpha-like                          364   5e-121   Solanum tuberosum [potatoes]
gb|AGZ15393.1|  elongation factor 1-alpha                               359   5e-121   Phaseolus vulgaris [French bean]
gb|ABA12221.1|  translation elongation factor 1A-5                      364   5e-121   Gossypium hirsutum [American cotton]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  364   6e-121   Citrus sinensis [apfelsine]
ref|XP_002528020.1|  elongation factor 1-alpha, putative                360   6e-121   
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             363   6e-121   Citrus clementina [clementine]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    363   7e-121   Gossypium raimondii
gb|AFY06644.1|  elongation factor 1-alpha                               359   8e-121   Carica papaya [mamon]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          363   8e-121   Zea mays [maize]
gb|KHG23927.1|  Elongation factor 1-alpha                               363   8e-121   Gossypium arboreum [tree cotton]
ref|NP_001105587.1|  elongation factor 1-alpha                          363   1e-120   Zea mays [maize]
gb|AIX10769.1|  elongation factor 1 alpha                               363   1e-120   Panax notoginseng [san-qi]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          363   1e-120   Elaeis guineensis
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    363   1e-120   Eucalyptus grandis [rose gum]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    363   1e-120   Zea mays [maize]
gb|AEN79476.1|  elongation factor 1-alpha                               363   1e-120   Ziziphus jujuba [Chinese jujube]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    363   1e-120   Sesamum indicum [beniseed]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          363   1e-120   Eucalyptus grandis [rose gum]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               363   2e-120   Sesamum indicum [beniseed]
emb|CDX70032.1|  BnaA10g23810D                                          359   2e-120   
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          363   2e-120   Setaria italica
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         361   2e-120   Jatropha curcas
gb|ABA12220.1|  translation elongation factor 1A-4                      363   2e-120   Gossypium hirsutum [American cotton]
gb|ACG34498.1|  elongation factor 1-alpha                               363   2e-120   Zea mays [maize]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    362   2e-120   Setaria italica
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             362   2e-120   Citrus clementina [clementine]
gb|ADC68236.1|  elongation factor 1-alpha                               355   2e-120   Dendrobium nobile
gb|ABA12217.1|  translation elongation factor 1A-1                      362   2e-120   Gossypium hirsutum [American cotton]
dbj|BAN42601.1|  putative elongation factor 1-alpha                     353   2e-120   Pyrus pyrifolia var. culta [Asian pear]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             362   2e-120   Solanum tuberosum [potatoes]
gb|KJB48746.1|  hypothetical protein B456_008G084000                    361   2e-120   Gossypium raimondii
dbj|BAH56641.1|  elongation factor 1a                                   359   2e-120   Nelumbo nucifera [Indian lotus]
gb|ABA12218.1|  translation elongation factor 1A-2                      362   2e-120   Gossypium hirsutum [American cotton]
emb|CAL07988.1|  translation elongation factor 1 alpha                  355   2e-120   Platanus x hispanica [London plane tree]
gb|ADI24333.1|  elongation factor 1-alpha                               362   2e-120   Miscanthus sinensis
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          362   2e-120   Sesamum indicum [beniseed]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               362   2e-120   Phoenix dactylifera
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          362   3e-120   
ref|NP_001105933.1|  elongation factor alpha2                           362   3e-120   
ref|XP_002518073.1|  elongation factor 1-alpha, putative                362   3e-120   Ricinus communis
ref|NP_001288465.1|  elongation factor 1-alpha-like                     362   3e-120   Zea mays [maize]
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              362   3e-120   Capsicum annuum
ref|NP_001105617.1|  elongation factor alpha3                           362   3e-120   Zea mays [maize]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    362   3e-120   
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          362   3e-120   Phoenix dactylifera
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               362   4e-120   Fragaria vesca subsp. vesca
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               362   4e-120   Pyrus x bretschneideri [bai li]
gb|AGJ50595.1|  EF1alpha                                                362   4e-120   Pericallis cruenta
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          362   4e-120   Eucalyptus grandis [rose gum]
dbj|BAC66180.1|  elongation factor 1A                                   362   4e-120   Avicennia marina
emb|CAD60652.1|  elongation factor                                      362   4e-120   Solanum tuberosum [potatoes]
gb|ACG31866.1|  elongation factor 1-alpha                               362   5e-120   Zea mays [maize]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    362   5e-120   Theobroma cacao [chocolate]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            357   6e-120   
ref|NP_001288407.1|  elongation factor 1-alpha-like                     361   6e-120   Zea mays [maize]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    360   6e-120   Gossypium raimondii
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          361   6e-120   Eucalyptus grandis [rose gum]
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               361   7e-120   Eucalyptus grandis [rose gum]
ref|NP_001290506.1|  elongation factor 1-alpha                          361   7e-120   Elaeis guineensis
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          361   7e-120   Phoenix dactylifera
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         361   8e-120   Jatropha curcas
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         361   9e-120   Jatropha curcas
ref|XP_002528028.1|  elongation factor 1-alpha, putative                361   1e-119   
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          360   1e-119   Tarenaya hassleriana [spider flower]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             360   1e-119   Eutrema salsugineum [saltwater cress]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             360   1e-119   Citrus clementina [clementine]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          360   1e-119   Elaeis guineensis
gb|KHG01531.1|  Elongation factor 1-alpha                               360   1e-119   Gossypium arboreum [tree cotton]
gb|ABA12219.1|  translation elongation factor 1A-3                      360   1e-119   Gossypium hirsutum [American cotton]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    360   1e-119   Zea mays [maize]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               360   1e-119   Tarenaya hassleriana [spider flower]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          360   1e-119   Nelumbo nucifera [Indian lotus]
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     351   1e-119   Glycine max [soybeans]
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          360   1e-119   Elaeis guineensis
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   360   2e-119   Lilium longiflorum [Easter lily]
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      356   2e-119   Cicer arietinum [garbanzo]
emb|CDY61938.1|  BnaCnng38780D                                          359   2e-119   Brassica napus [oilseed rape]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          360   2e-119   Pyrus x bretschneideri [bai li]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          360   2e-119   Phoenix dactylifera
gb|AFJ04514.1|  elongation factor 1-alpha                               360   2e-119   Vernicia fordii [tung oil tree]
emb|CDY22710.1|  BnaC08g43440D                                          359   2e-119   Brassica napus [oilseed rape]
gb|ABA12223.1|  translation elongation factor 1A-7                      360   2e-119   Gossypium hirsutum [American cotton]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        360   2e-119   Brassica rapa
gb|KHG28979.1|  Elongation factor 1-alpha                               360   2e-119   Gossypium arboreum [tree cotton]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             360   2e-119   Brassica rapa
gb|AAL69396.1|  elongation factor 1-alpha                               360   2e-119   Elaeis oleifera
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        360   3e-119   Brassica rapa
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               360   3e-119   Malus domestica [apple tree]
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          359   3e-119   Elaeis guineensis
emb|CDX93604.1|  BnaA06g04440D                                          360   3e-119   
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    359   3e-119   
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        359   3e-119   Bruguiera sexangula
gb|KHN18669.1|  Elongation factor 1-alpha                               359   3e-119   Glycine soja [wild soybean]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             359   3e-119   Prunus persica
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       354   3e-119   Cucumis sativus [cucumbers]
gb|KHG24249.1|  Elongation factor 1-alpha                               357   4e-119   Gossypium arboreum [tree cotton]
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    359   5e-119   
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          359   5e-119   Malus domestica [apple tree]
gb|ABA12224.1|  translation elongation factor 1A-8                      359   5e-119   Gossypium hirsutum [American cotton]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        359   5e-119   Hevea brasiliensis [jebe]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          358   6e-119   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD66072.1|  elongation factor 1-alpha                               351   6e-119   Phoenix dactylifera
gb|AFP44110.1|  elongation factor 1-alpha                               358   6e-119   Lycoris longituba
gb|KHG27341.1|  Elongation factor 1-alpha                               358   7e-119   Gossypium arboreum [tree cotton]
emb|CDX95108.1|  BnaC05g05630D                                          360   7e-119   
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             358   7e-119   Phaseolus vulgaris [French bean]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          358   8e-119   Musa acuminata subsp. malaccensis [pisang utan]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    358   9e-119   Daucus carota [carrots]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             358   1e-118   Capsella rubella
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             358   1e-118   Prunus persica
ref|NP_200847.1|  elongation factor 1-alpha 4                           358   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    358   1e-118   Populus euphratica
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    358   1e-118   Populus euphratica
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          358   1e-118   
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               358   1e-118   Prunus mume [ume]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          358   1e-118   Populus euphratica
ref|NP_001105935.1|  elongation factor alpha8                           358   1e-118   
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    358   1e-118   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02151.1|  elongation factor 1-alpha                              358   1e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             358   1e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82537.1|  At1g07930/T6D22_3                                       358   1e-118   Arabidopsis thaliana [mouse-ear cress]
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       353   1e-118   Cucumis sativus [cucumbers]
emb|CAA34456.1|  elongation factor 1-alpha                              358   1e-118   Arabidopsis thaliana [mouse-ear cress]
gb|ACI96243.1|  elongation factor 1-alpha                               358   1e-118   Prunus persica
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        358   1e-118   Hevea brasiliensis [jebe]
gb|AAL57653.1|  At1g07930/T6D22_3                                       358   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          358   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          354   2e-118   Populus euphratica
gb|AAY56337.1|  elongation factor-1 alpha                               357   2e-118   Musa acuminata [banana]
gb|ABA12222.1|  translation elongation factor 1A-6                      357   2e-118   Gossypium hirsutum [American cotton]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   357   2e-118   Ornithogalum longebracteatum [sea-onion]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          357   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     357   2e-118   Glycine max [soybeans]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               357   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    357   2e-118   Gossypium raimondii
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     357   2e-118   Glycine max [soybeans]
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   348   2e-118   Gossypium raimondii
gb|KHN42761.1|  Elongation factor 1-alpha                               357   2e-118   Glycine soja [wild soybean]
gb|KHN14872.1|  Elongation factor 1-alpha                               357   2e-118   Glycine soja [wild soybean]
gb|AEI29162.1|  EF1a-like protein                                       355   2e-118   Phalaenopsis hybrid cultivar
emb|CDY58828.1|  BnaAnng15460D                                          361   3e-118   Brassica napus [oilseed rape]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          357   3e-118   Cicer arietinum [garbanzo]
gb|ACS68200.1|  elongation factor 1 alpha                               357   3e-118   Brassica napus [oilseed rape]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          357   3e-118   Fragaria vesca subsp. vesca
gb|AIM48895.1|  elongation factor 1-alpha                               356   3e-118   Cinnamomum camphora
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        357   3e-118   Brassica rapa
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               357   4e-118   Vitis vinifera
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       353   4e-118   Cucumis sativus [cucumbers]
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         353   4e-118   Medicago truncatula
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          357   4e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               357   5e-118   Cucumis melo [Oriental melon]
gb|AEQ75495.1|  elongation factor 1-alpha                               356   5e-118   Rosa multiflora [Japanese rose]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     348   5e-118   Vitis vinifera
gb|AAX54511.1|  elongation factor 1 alpha                               356   5e-118   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          356   5e-118   Amborella trichopoda
ref|NP_001105565.1|  elongation factor alpha5                           356   5e-118   
gb|ACF81592.1|  unknown                                                 347   5e-118   Zea mays [maize]
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    356   5e-118   Populus euphratica
gb|AAF99703.1|  elongation factor                                       356   5e-118   Saccharum officinarum [noble cane]
gb|AGC94754.1|  elongation factor 1 alpha                               356   5e-118   Euphorbia lathyris
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               356   6e-118   Cucumis melo [Oriental melon]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    356   7e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AGI15328.1|  elongation factor 1                                     356   7e-118   Aegiceras corniculatum
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             356   7e-118   Populus trichocarpa [western balsam poplar]
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    356   8e-118   Daucus carota [carrots]
gb|EPS66340.1|  elongation factor 1-alpha                               355   8e-118   Genlisea aurea
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  356   8e-118   Solanum tuberosum [potatoes]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          356   8e-118   Amborella trichopoda
emb|CAJ38380.1|  translation elongation factor 1 alpha                  348   8e-118   Plantago major [cart-track plant]
ref|NP_001237425.1|  elongation factor-1A                               356   9e-118   
gb|ABS10822.1|  elongation factor 1-alpha                               347   9e-118   Phaseolus vulgaris [French bean]
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          356   9e-118   Populus euphratica
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   356   9e-118   Lilium longiflorum [Easter lily]
emb|CAA65453.1|  elongation factor                                      348   9e-118   Narcissus pseudonarcissus
dbj|BAH19898.1|  AT1G07930                                              355   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         355   1e-117   
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    355   1e-117   Manihot esculenta [manioc]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   355   1e-117   Lilium longiflorum [Easter lily]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     355   1e-117   Malus domestica [apple tree]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               355   1e-117   Fragaria vesca subsp. vesca
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          355   1e-117   Pyrus x bretschneideri [bai li]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               355   2e-117   Vitis vinifera
gb|KGN51228.1|  Elongation factor 1-alpha                               353   2e-117   Cucumis sativus [cucumbers]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            345   2e-117   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          355   2e-117   Cucumis sativus [cucumbers]
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               355   2e-117   Tarenaya hassleriana [spider flower]
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          355   2e-117   Cucumis sativus [cucumbers]
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               355   2e-117   Brachypodium distachyon [annual false brome]
gb|ABF00115.1|  elongation factor 1-alpha                               355   2e-117   Litchi chinensis [litchi]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          355   3e-117   
gb|AGV54713.1|  elongation factor 1-alpha                               355   3e-117   Phaseolus vulgaris [French bean]
gb|AHB86963.1|  elongation factor 1-alpha                               354   3e-117   Sedum alfredii
ref|NP_001183947.1|  uncharacterized protein LOC100502553               353   3e-117   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          354   3e-117   Malus domestica [apple tree]
ref|XP_002312029.1|  ADR12-2 family protein                             354   4e-117   Populus trichocarpa [western balsam poplar]
ref|XP_003604823.1|  Elongation factor 1-alpha                          354   4e-117   
dbj|BAM13877.1|  elongation factor 1 alpha                              354   4e-117   Arum maculatum [cuckoo-pint]
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          354   4e-117   Sorghum bicolor [broomcorn]
dbj|BAM13874.1|  elongation factor 1 alpha                              354   4e-117   Symplocarpus renifolius
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    354   4e-117   Glycine max [soybeans]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          354   4e-117   
gb|AAL32631.1|  putative elongation factor 1-a                          354   4e-117   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        354   4e-117   Salsola komarovii
ref|XP_002311107.1|  ADR12-2 family protein                             354   4e-117   Populus trichocarpa [western balsam poplar]
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    354   5e-117   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    358   5e-117   
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    354   5e-117   Glycine max [soybeans]
gb|EPS66069.1|  elongation factor 1-alpha                               353   5e-117   Genlisea aurea
ref|XP_003588821.1|  Elongation factor 1-alpha                          354   6e-117   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               353   7e-117   Beta vulgaris subsp. vulgaris [field beet]
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         354   7e-117   Medicago truncatula
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         353   7e-117   Medicago truncatula
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             353   7e-117   Prunus persica
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          353   8e-117   Amborella trichopoda
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             353   8e-117   Prunus persica
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    353   8e-117   
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         353   9e-117   
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          353   9e-117   
gb|ABD66517.1|  EF-1 alpha                                              353   1e-116   
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             352   2e-116   
ref|XP_002311106.1|  ADR12-2 family protein                             352   2e-116   
gb|AAV92325.1|  translation elongation factor-1 alpha                   345   2e-116   
ref|NP_001151074.1|  elongation factor 1-alpha                          352   2e-116   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         352   2e-116   
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          352   2e-116   
gb|ADK73624.1|  elongation factor 1 alpha                               347   2e-116   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             352   3e-116   
gb|ADW83729.1|  elongation factor 1-alpha                               342   3e-116   
ref|NP_001104938.1|  elongation factor 1 alpha                          352   4e-116   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          351   4e-116   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             352   4e-116   
ref|XP_003591959.1|  Elongation factor 1-alpha                          355   4e-116   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    350   5e-116   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        351   7e-116   
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               350   9e-116   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          350   1e-115   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             350   1e-115   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        350   1e-115   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          350   2e-115   
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               350   2e-115   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             350   2e-115   
dbj|BAF75826.1|  hypothetical protein                                   340   2e-115   
dbj|BAH20400.1|  AT1G07940                                              340   3e-115   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             349   3e-115   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             349   3e-115   
dbj|BAF75825.1|  hypothetical protein                                   339   4e-115   
gb|ABW74483.1|  elongation factor                                       339   4e-115   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         348   9e-115   
ref|NP_001105934.1|  elongation factor alpha7                           348   9e-115   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                348   1e-114   
ref|NP_001104939.1|  elongation factor alpha6                           348   1e-114   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             348   1e-114   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             348   1e-114   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    347   2e-114   
gb|EMS52529.1|  Elongation factor 1-alpha                               347   2e-114   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    347   3e-114   
gb|KHG15275.1|  Elongation factor 1-alpha                               346   4e-114   
gb|EMS59091.1|  Elongation factor 1-alpha                               347   6e-114   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                345   9e-114   
emb|CAC27139.1|  translation elongation factor-1 alpha                  345   1e-113   
gb|ACN41180.1|  unknown                                                 345   1e-113   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    358   2e-113   
gb|ABK25072.1|  unknown                                                 345   2e-113   
gb|ACN40081.1|  unknown                                                 345   2e-113   
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         343   2e-113   
gb|EMS49772.1|  Elongation factor 1-alpha                               344   3e-113   
ref|XP_002892424.1|  T6D22.2                                            358   3e-113   
gb|AER42621.1|  elongation factor 1 alpha                               344   4e-113   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    343   5e-113   
gb|AGO97079.1|  elongation factor 1-alpha                               334   5e-113   
gb|EMT12343.1|  Elongation factor 1-alpha                               343   6e-113   
gb|AAF79822.1|AC026875_2  T6D22.2                                       358   6e-113   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   343   8e-113   
ref|XP_003604587.1|  Elongation factor 1-alpha                          343   8e-113   
gb|AGI78242.1|  elongation factor 1 alpha                               343   9e-113   
gb|ABK24265.1|  unknown                                                 343   9e-113   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    342   2e-112   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 342   3e-112   
gb|AHA84124.1|  elongation factor 1-alpha                               341   3e-112   
gb|AGO97080.1|  elongation factor 1-alpha                               332   4e-112   
gb|ACN40740.1|  unknown                                                 341   4e-112   
gb|EMS65134.1|  Elongation factor 1-alpha                               347   4e-112   
gb|ABK24843.1|  unknown                                                 341   4e-112   
ref|XP_001763198.1|  predicted protein                                  337   1e-111   
gb|EMT09703.1|  Elongation factor 1-alpha                               348   3e-111   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    355   4e-111   
gb|ABR17675.1|  unknown                                                 338   6e-111   
ref|XP_003618775.1|  Elongation factor 1-alpha                          353   7e-111   
gb|AGO97078.1|  elongation factor 1-alpha                               328   8e-111   
ref|XP_001766482.1|  predicted protein                                  337   1e-110   
gb|AEE98364.1|  elongation factor 1-alpha                               337   1e-110   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 337   2e-110   
ref|XP_001753167.1|  predicted protein                                  337   3e-110   
ref|XP_001763194.1|  predicted protein                                  336   3e-110   
ref|XP_001763201.1|  predicted protein                                  336   4e-110   
ref|XP_001753181.1|  predicted protein                                  336   4e-110   
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    326   8e-110   
gb|ABQ81936.1|  elongation factor 1-alpha                               334   2e-109   
ref|XP_001753059.1|  predicted protein                                  334   2e-109   
dbj|BAK08744.1|  elongation factor 1-alpha                              333   4e-109   
dbj|BAK08818.1|  elongation factor 1-alpha                              333   5e-109   
gb|ABQ81942.1|  elongation factor 1-alpha                               325   7e-109   
gb|AHZ58493.1|  translation elongation factor alpha                     333   8e-109   
dbj|BAK08819.1|  elongation factor 1-alpha                              332   2e-108   
gb|AFN42763.1|  elongation factor 1-alpha                               324   2e-108   
gb|AAO61852.1|  translation elongation factor-1 alpha                   328   2e-107   
gb|AAR83865.1|  elongation factor 1-alpha                               317   1e-106   
dbj|BAH23674.1|  elongation factor 1-alpha                              315   1e-105   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    316   9e-105   
gb|ABL10112.1|  translation elongation factor 1-alpha                   311   3e-104   
gb|ACT36602.1|  elongation factor 1 alpha                               315   7e-103   
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     317   7e-103   
gb|AAV34150.1|  EF-1 alpha                                              308   3e-102   
gb|ACO50109.1|  elongation factor 1 alpha                               308   3e-101   
gb|ACL97363.1|  elongation factor-1 alpha                               312   5e-101   
gb|EEE58429.1|  hypothetical protein OsJ_09630                          311   7e-101   
gb|AFB18314.1|  translation elongation factor-1 alpha                   309   2e-100   
ref|XP_005650451.1|  translation elongation factor                      310   4e-100   
gb|ACO50110.1|  elongation factor 1 alpha                               310   7e-100   
gb|ACL97366.1|  elongation factor-1 alpha                               309   8e-100   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             306   9e-100   
gb|ABQ81935.1|  elongation factor 1-alpha                               309   1e-99    
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             307   3e-99    
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          302   3e-99    
gb|ACL97367.1|  elongation factor-1 alpha                               306   9e-99    
gb|AAR82894.1|  elongation factor 1-alpha                               307   1e-98    
gb|AIM46989.1|  translation elongation factor 1-alpha                   307   1e-98    
emb|CCI49302.1|  unnamed protein product                                306   2e-98    
emb|CCA22726.1|  PREDICTED: hypothetical protein                        305   4e-98    
emb|CAA40028.1|  42Sp48                                                 301   4e-98    
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     305   5e-98    
gb|ABR13275.1|  putative elongation factor-1 alpha 3                    295   6e-98    
dbj|BAN14716.1|  elongation factor 1-alpha                              295   7e-98    
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    304   2e-97    
gb|ACO50115.1|  elongation factor 1 alpha                               303   3e-97    
gb|ABB46371.1|  elongation factor-1 alpha                               294   3e-97    
emb|CDH51884.1|  elongation factor 1-alpha                              296   3e-97    
gb|ADB55729.1|  elongation factor 1-alpha                               305   3e-97    
gb|KHN88882.1|  Elongation factor 1-alpha                               303   4e-97    
gb|EJW86012.1|  translation elongation factor EF-1                      301   4e-97    
ref|NP_001079602.1|  elongation factor 1-alpha, oocyte form             303   5e-97    
gb|EJW73271.1|  elongation factor 1-alpha                               297   5e-97    
gb|ABD98043.1|  elongation factor 1 alpha subunit                       293   6e-97    
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    297   8e-97    
ref|NP_989301.1|  eukaryotic translation elongation factor 1 alph...    302   1e-96    
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          299   1e-96    
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             302   1e-96    
tpg|DAA05869.1|  TPA: eukaryotic translation elongation factor 1A       302   1e-96    
ref|XP_003141904.1|  elongation factor 1-alpha                          301   1e-96    
gb|EPR59445.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         295   2e-96    
gb|AEG78376.1|  elongation factor 1 alpha                               293   2e-96    
ref|NP_001081521.1|  elongation factor 1-alpha, oocyte form             301   2e-96    
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   301   2e-96    
emb|CDQ04680.1|  Protein Bm5196, isoform a                              300   2e-96    
ref|XP_001893409.1|  elongation factor 1-alpha                          301   2e-96    
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  301   2e-96    
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   301   2e-96    
gb|AJP77649.1|  elongation factor 1-alpha                               294   2e-96    
gb|AAH14892.1|  Unknown (protein for IMAGE:3909122)                     294   3e-96    
emb|CAB59358.1|  translation elongation factor eEF-1 alpha chain        301   3e-96    
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        301   3e-96    
gb|AAH65761.1|  EEF1A1 protein                                          294   3e-96    
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             301   3e-96    
ref|XP_001732312.1|  hypothetical protein MGL_0087                      301   3e-96    
ref|XP_003380597.1|  elongation factor 1-alpha                          303   4e-96    
emb|CCW70819.1|  unnamed protein product                                293   4e-96    
gb|ETL93490.1|  elongation factor 1-alpha 2                             291   5e-96    
gb|ADO51768.1|  elongation factor 1-alpha                               300   5e-96    
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    297   5e-96    
gb|ADK90073.1|  elongation factor 1 alpha                               300   5e-96    
sp|P27592.1|EF1A_ONCVO  RecName: Full=Elongation factor 1-alpha; ...    300   6e-96    
dbj|BAH28836.1|  elongation factor 1-alpha                              300   6e-96    
gb|KFG40151.1|  elongation factor 1-alpha                               293   6e-96    
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       300   6e-96    
emb|CAA37169.1|  elongation factor 1-alpha (454 AA)                     300   6e-96    
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          293   8e-96    
emb|CCU97773.1|  unnamed protein product                                300   1e-95    
gb|AIM46986.1|  translation elongation factor 1-alpha                   299   1e-95    
sp|P17508.2|EF1A3_XENLA  RecName: Full=Elongation factor 1-alpha,...    300   1e-95    
gb|AAH63511.1|  EEF1A1 protein                                          293   1e-95    
gb|ABR16818.1|  unknown                                                 289   1e-95    
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  299   1e-95    
gb|EPR56707.1|  elongation factor 1-alpha                               293   2e-95    
gb|AAH14377.1|  Unknown (protein for IMAGE:4041545)                     293   2e-95    
gb|EPR57682.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         294   2e-95    
gb|EFQ26666.1|  translation elongation factor EF-1                      299   2e-95    
dbj|BAG65087.1|  unnamed protein product                                294   2e-95    
ref|XP_005405386.1|  PREDICTED: elongation factor 1-alpha 1             294   2e-95    
ref|XP_003144331.1|  eukaryotic translation elongation factor 1A        299   2e-95    
dbj|BAE88353.1|  unnamed protein product                                294   2e-95    
ref|XP_009490775.1|  PREDICTED: elongation factor 1-alpha 2             292   2e-95    
ref|XP_005993968.1|  PREDICTED: elongation factor 1-alpha, oocyte...    298   2e-95    
gb|AAB65435.1|  elongation factor 1 alpha                               294   2e-95    
gb|AAA52367.1|  elongation factor 1-alpha                               294   3e-95    
ref|XP_009576931.1|  PREDICTED: elongation factor 1-alpha 2             292   3e-95    
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             298   3e-95    
ref|XP_007762783.1|  translation elongation factor 1a                   298   3e-95    
gb|KFV92956.1|  Elongation factor 1-alpha 2                             292   3e-95    
ref|XP_007061563.1|  PREDICTED: elongation factor 1-alpha 1             298   3e-95    
gb|KDO24362.1|  elongation factor 1-alpha 1                             296   3e-95    
gb|AEV12206.1|  elongation factor 1-alpha                               295   3e-95    
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    298   4e-95    
ref|XP_003037261.1|  translation elongation factor 1a                   298   4e-95    
ref|XP_002392294.1|  hypothetical protein MPER_08150                    293   4e-95    
gb|KIO18434.1|  hypothetical protein M407DRAFT_16247                    297   4e-95    
emb|CCX05343.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    298   4e-95    
gb|ACJ61697.1|  translation elongation factor-1 alpha                   290   4e-95    
gb|EMF17352.1|  translation elongation factor 1-alpha                   298   4e-95    
gb|AAH22412.1|  Unknown (protein for IMAGE:4134193)                     291   4e-95    
gb|KFH42761.1|  Elongation factor 1-alpha-like protein                  298   4e-95    
gb|EQB55271.1|  hypothetical protein CGLO_04815                         291   4e-95    
ref|XP_007079072.1|  PREDICTED: elongation factor 1-alpha, oocyte...    295   4e-95    
emb|CDH51795.1|  elongation factor 1-alpha                              298   4e-95    
gb|AGT48259.1|  elongation factor 1-alpha                               298   4e-95    
ref|WP_033581549.1|  elongation factor 1-alpha                          287   5e-95    
emb|CBY16376.1|  unnamed protein product                                290   5e-95    
emb|CDP93912.1|  Protein Bm5195, isoform g                              298   5e-95    
ref|NP_001098132.1|  elongation factor 1-alpha                          298   5e-95    
ref|XP_008404506.1|  PREDICTED: elongation factor 1-alpha 1             298   5e-95    
gb|AEK26871.1|  elongation factor 1-alpha                               286   5e-95    
gb|AGW84083.1|  elongation factor 1-alpha                               294   5e-95    
gb|AIZ09099.1|  elongation factor 1-alpha                               290   5e-95    
gb|EPY25861.1|  elongation factor 1-alpha                               294   5e-95    
ref|XP_009651507.1|  elongation factor 1-alpha                          298   5e-95    
emb|CBY85304.1|  eukaryotic translation elongation factor 1 alpha 1     297   5e-95    
ref|XP_009965335.1|  PREDICTED: elongation factor 1-alpha 1             294   5e-95    
gb|AAN09722.1|AF328730_1  CTCL tumor antigen HD-CL-08                   295   5e-95    
gb|AEU59990.1|  elongation factor 1 alpha                               288   5e-95    
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  298   5e-95    
gb|EPY33803.1|  elongation factor 1-alpha                               293   6e-95    
ref|XP_006794564.1|  PREDICTED: elongation factor 1-alpha-like          289   6e-95    
gb|KFV51009.1|  Elongation factor 1-alpha 1                             294   6e-95    
gb|KIK71054.1|  hypothetical protein GYMLUDRAFT_33174                   298   7e-95    
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 298   7e-95    
emb|CDQ71533.1|  unnamed protein product                                290   8e-95    
ref|XP_003873869.1|  elongation factor 1-alpha                          289   8e-95    



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/183 (100%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   372 bits (955),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   366 bits (940),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  153  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  212

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  213  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  272

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  273  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  332

Query  185  PTG  177
            PTG
Sbjct  333  PTG  335



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   369 bits (948),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   363 bits (933),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  100  RVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  159

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  160  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  219

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  220  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  279

Query  185  PTG  177
            PTG
Sbjct  280  PTG  282



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   369 bits (947),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   369 bits (947),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   369 bits (947),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   369 bits (948),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  256  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  315

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  316  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  375

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  376  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  435

Query  185  PTG  177
            PTG
Sbjct  436  PTG  438



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   369 bits (947),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   369 bits (947),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   369 bits (947),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   369 bits (946),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   369 bits (946),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 178/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   369 bits (946),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   362 bits (930),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  93   RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  152

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  153  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  212

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  213  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  272

Query  185  PTG  177
            PTG
Sbjct  273  PTG  275



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  141  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  200

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFA +LTKIDRRSGK
Sbjct  201  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAXILTKIDRRSGK  260

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  261  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  320

Query  185  PTG  177
            PTG
Sbjct  321  PTG  323



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  206  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  265

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  266  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  325

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  326  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  385

Query  185  PTG  177
            PTG
Sbjct  386  PTG  388



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   362 bits (928),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  107  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFV  166

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  167  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  226

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  227  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  286

Query  185  PTG  177
            PTG
Sbjct  287  PTG  289



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   360 bits (923),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  54   RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  113

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  114  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  173

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  174  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  233

Query  185  PTG  177
            P+G
Sbjct  234  PSG  236



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   358 bits (918),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  6    RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  65

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  66   ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  125

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  126  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  185

Query  185  PTG  177
            P+G
Sbjct  186  PSG  188



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   361 bits (927),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  100  RVETGVLKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  159

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  160  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  219

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  220  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  279

Query  185  PTG  177
            P+G
Sbjct  280  PSG  282



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   367 bits (941),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   367 bits (941),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/183 (97%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   361 bits (926),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  100  RVETGVLKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  159

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  160  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  219

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  220  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  279

Query  185  PTG  177
            P+G
Sbjct  280  PSG  282



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   367 bits (941),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   362 bits (929),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  129  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFV  188

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  189  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  248

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  249  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  308

Query  185  PTG  177
            PTG
Sbjct  309  PTG  311



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   366 bits (940),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   357 bits (917),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  8    RVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  67

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  68   ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  127

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKMLPT+PMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  128  EIEKEPKFLKNGDAGMVKMLPTRPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  187

Query  185  PTG  177
            P+G
Sbjct  188  PSG  190



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   366 bits (940),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   366 bits (939),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  248  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  307

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  308  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  367

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  368  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  427

Query  185  PTG  177
            PTG
Sbjct  428  PTG  430



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   366 bits (940),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGM+VTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMLVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   366 bits (939),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
             +G
Sbjct  434  ASG  436



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   366 bits (939),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  206  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  265

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  266  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  325

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  326  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  385

Query  185  PTG  177
            PTG
Sbjct  386  PTG  388



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPM+VETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMLVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFQELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEV+SVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  206  RVETGVIKPGMVVTFGPTGLTTEVQSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  265

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  266  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  325

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  326  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  385

Query  185  PTG  177
            PTG
Sbjct  386  PTG  388



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   357 bits (916),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  46   RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  105

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  106  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  165

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  166  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  225

Query  185  PTG  177
            P+G
Sbjct  226  PSG  228



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   364 bits (935),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   364 bits (935),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGMLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDSGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   364 bits (935),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGM+VTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMLVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   358 bits (920),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  100  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  159

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  160  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  219

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  220  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  279

Query  185  PTG  177
            P+G
Sbjct  280  PSG  282



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   359 bits (921),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  100  RVETGVIKPGMVVTFAPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  159

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  160  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGK  219

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  220  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  279

Query  185  PTG  177
            PTG
Sbjct  280  PTG  282



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   364 bits (934),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+LQEALPGDNVGFNVKNV+VKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLQEALPGDNVGFNVKNVSVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   360 bits (924),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  153  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  212

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  213  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  272

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  273  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  332

Query  185  PTG  177
            P+G
Sbjct  333  PSG  335



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+LQEALPGDNVGFNVKNV+VKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLQEALPGDNVGFNVKNVSVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   363 bits (933),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   359 bits (922),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  141  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  200

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  201  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  260

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  261  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKD  320

Query  185  PTG  177
            P+G
Sbjct  321  PSG  323



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   363 bits (933),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   363 bits (933),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGTLKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGLIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELE+EPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEREPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  149  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  208

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  209  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  268

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  269  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  328

Query  185  PTG  177
            PTG
Sbjct  329  PTG  331



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGM+VTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMLVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  206  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  265

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  266  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  325

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  326  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  385

Query  185  PTG  177
            P+G
Sbjct  386  PSG  388



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   355 bits (910),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  46   RVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  105

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGK
Sbjct  106  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGK  165

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PT+PMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  166  ELEKEPKFLKNGDAGFVKMVPTRPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  225

Query  185  PTG  177
            PTG
Sbjct  226  PTG  228



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   353 bits (907),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEA+ EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  8    RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMLEALPGDNVGFNVKNVAVKDLKRGYV  67

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  68   ASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  127

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  128  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  187

Query  185  PTG  177
            PTG
Sbjct  188  PTG  190



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 183/184 (99%), Gaps = 1/184 (1%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHH-EALQEALPGDNVGFNVKNVAVKDLKRGY  549
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHH EALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHHEALQEALPGDNVGFNVKNVAVKDLKRGF  313

Query  548  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  369
            VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSG
Sbjct  314  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  373

Query  368  KELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  189
            KELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKK
Sbjct  374  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  433

Query  188  DPTG  177
            DPTG
Sbjct  434  DPTG  437



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  206  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  265

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDD AK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  266  ASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  325

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  326  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  385

Query  185  PTG  177
            PTG
Sbjct  386  PTG  388



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LK GMVVTFGPSGLTTEVKSVEMHHE LQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  173  RVETGILKAGMVVTFGPSGLTTEVKSVEMHHETLQEALPGDNVGFNVKNVAVKDLKRGFV  232

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  233  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  292

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK VDKKD
Sbjct  293  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKD  352

Query  185  PTG  177
            PTG
Sbjct  353  PTG  355



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   355 bits (910),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVV FGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  43   RVETGVLKPGMVVAFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  102

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  103  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  162

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  163  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  222

Query  185  PTG  177
            P+G
Sbjct  223  PSG  225



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGM+VTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMLVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK+
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKE  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGIIKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  253  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  312

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDR SGK
Sbjct  313  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRWSGK  372

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+E PPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  373  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAENPPLGRFAVRDMRQTVAVGVVKNVDKKD  432

Query  185  PTG  177
            PTG
Sbjct  433  PTG  435



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKE  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   362 bits (929),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKD+KRGYV
Sbjct  254  RVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDIKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMMPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AASF SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAREAASFASQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGM+VTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNV+VKDLKRGYV
Sbjct  254  RVETGMLKPGMLVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVSVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKE  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   362 bits (928),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNS DDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSXDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   362 bits (928),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   357 bits (916),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  130  RVETGLIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  189

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  190  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  249

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  250  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  309

Query  185  PTG  177
            PTG
Sbjct  310  PTG  312



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   361 bits (927),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSV+MHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVKMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   360 bits (925),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  233  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  292

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDD AK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  293  ASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  352

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  353  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  412

Query  185  PTG  177
            PTG
Sbjct  413  PTG  415



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   361 bits (927),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   361 bits (927),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAATFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   361 bits (927),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   361 bits (926),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   361 bits (926),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   361 bits (926),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF PSGL TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFAPSGLPTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELL+KIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLSKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEY PLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYSPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGLIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            AS SKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGM+VTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMLVTFAPSGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LK GMVVTFGP+GLTTEVKSVEMHHE LQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKSGMVVTFGPTGLTTEVKSVEMHHETLQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSK+DPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKEDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   351 bits (900),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -2

Query  713  GVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNS  534
            GVLKPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNS
Sbjct  4    GVLKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNS  63

Query  533  KDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEK  354
            KDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEK
Sbjct  64   KDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEK  123

Query  353  EPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  177
            EPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  124  EPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  182



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK A SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAGSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPG++VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  133  RVETGVIKPGVIVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFV  192

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  193  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  252

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  253  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  312

Query  185  PTG  177
            PTG
Sbjct  313  PTG  315



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  233  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  292

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  293  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  352

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  353  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  412

Query  185  PTG  177
            PTG
Sbjct  413  PTG  415



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKE  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  253  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  312

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  313  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  372

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  373  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  432

Query  185  PTG  177
            P+G
Sbjct  433  PSG  435



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  232  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  291

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  292  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  351

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  352  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  411

Query  185  PTG  177
            PTG
Sbjct  412  PTG  414



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQ IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQGIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK +ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKVSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+F +QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFIAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   360 bits (923),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   360 bits (923),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKE  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   360 bits (923),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  265  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  324

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  325  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  384

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  385  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  444

Query  185  PTG  177
            PTG
Sbjct  445  PTG  447



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNV+VKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVSVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK A+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKE  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   354 bits (908),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EA+PGDNVGFNVKNVAVKDLKRG+V
Sbjct  100  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEAVPGDNVGFNVKNVAVKDLKRGFV  159

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  160  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  219

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  220  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  279

Query  185  PTG  177
            P+G
Sbjct  280  PSG  282



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   357 bits (917),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  206  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGYV  265

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  266  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  325

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  326  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  385

Query  185  PTG  177
            P+G
Sbjct  386  PSG  388



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE++QEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHESMQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPG+VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGIVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABD66072.1| elongation factor 1-alpha [Phoenix dactylifera]
Length=245

 Score =   351 bits (901),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  65   RVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  124

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LT+IDRRSGK
Sbjct  125  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTEIDRRSGK  184

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLK+GDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  185  ELEKEPKFLKSGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  244

Query  185  P  183
            P
Sbjct  245  P  245



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+P+KPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMVPSKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   358 bits (920),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   360 bits (924),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  275  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  334

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  335  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  394

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  395  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  454

Query  185  PTG  177
            PTG
Sbjct  455  PTG  457



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   358 bits (920),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFAPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSK+DP K AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKEDPTKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   358 bits (919),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG +KPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNV+VKDLKRGYV
Sbjct  254  RVETGTIKPGMVVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVSVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVR MRQTVAVGVIK V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRVMRQTVAVGVIKAVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGLIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|NP_001105935.1| elongation factor alpha8 [Zea mays]
 gb|AAF42982.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLK+GDAGMVKM+PTKPMVVETFS +PPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKDGDAGMVKMIPTKPMVVETFSAFPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  137  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGFV  196

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRS K
Sbjct  197  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSAK  256

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  257  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKD  316

Query  185  PTG  177
            PTG
Sbjct  317  PTG  319



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPG VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  145  RVETGVIKPGTVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  204

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  205  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  264

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  265  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  324

Query  185  PT  180
             +
Sbjct  325  AS  326



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEAFPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPTGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSK+DPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKEDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   348 bits (892),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = -2

Query  701  PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDP  522
            PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDP
Sbjct  1    PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDP  60

Query  521  AKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKF  342
            AK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKF
Sbjct  61   AKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKF  120

Query  341  LKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  177
            LKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  121  LKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  175



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPG+VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  205  RVETGXLKPGIVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  264

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  265  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  324

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  325  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  384

Query  185  PTG  177
            PTG
Sbjct  385  PTG  387



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  232  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  291

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  292  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  351

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  352  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  411

Query  185  PTG  177
            PTG
Sbjct  412  PTG  414



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPG++VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGVIVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASN KDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNPKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGD+GMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  EIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AIM48895.1| elongation factor 1-alpha, partial [Cinnamomum camphora]
Length=432

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRG+V
Sbjct  245  RVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGFV  304

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  305  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  364

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  365  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  424

Query  185  PTG  177
            PTG
Sbjct  425  PTG  427



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK 
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKH  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|KGN51227.1| hypothetical protein Csa_5G495940 [Cucumis sativus]
Length=344

 Score =   353 bits (905),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  149  RVETGIIKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  208

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  209  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  268

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK V+KKD
Sbjct  269  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKAVEKKD  328

Query  185  PTG  177
             +G
Sbjct  329  ASG  331



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   353 bits (906),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  153  RVETGVIKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYV  212

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  213  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  272

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKD
Sbjct  273  EIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKD  332

Query  185  PTG  177
            P+G
Sbjct  333  PSG  335



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGTLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMVPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   357 bits (915),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EA+PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALPEAVPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   348 bits (894),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGPSGLTTEVKSVEMHHE+L E LPGDNVGFNVKNVAVKDLKRG+V
Sbjct  33   RVETGIIKPGMVVTFGPSGLTTEVKSVEMHHESLVEGLPGDNVGFNVKNVAVKDLKRGFV  92

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSGK
Sbjct  93   ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEITTKIDRRSGK  152

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  153  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  212

Query  185  PTG  177
            P+G
Sbjct  213  PSG  215



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EA PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEASPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGLLKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KP MVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDL RG+V
Sbjct  254  RVETGVIKPDMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLNRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAV DMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVLDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   347 bits (889),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/173 (96%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = -2

Query  695  MVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK  516
            MVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK
Sbjct  1    MVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK  60

Query  515  GAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLK  336
             AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLK
Sbjct  61   EAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLK  120

Query  335  NGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  177
            NGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  121  NGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  173



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PT  180
             +
Sbjct  434  AS  435



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 1/183 (1%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  256  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  315

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVI MNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  316  ASNSKDDPAKEAASFTSQVI-MNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGK  374

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKE KFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVG+IK+V+KKD
Sbjct  375  ELEKEAKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGIIKSVEKKD  434

Query  185  PTG  177
            PTG
Sbjct  435  PTG  437



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   356 bits (914),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMVKMVPTKPMVVETFSSYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   356 bits (914),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKN AVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNFAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK A+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KK+
Sbjct  374  ELEKEPKFLKNGDAGMVKMNPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKE  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>sp|P34823.1|EF1A2_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 dbj|BAA02205.1| elongation factor 1-alpha [Daucus carota]
Length=447

 Score =   356 bits (913),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGALKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
             +G
Sbjct  434  ASG  436



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   356 bits (913),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GL TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVIKPGMVVTFGPTGLPTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC  SHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCTLSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKE KFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKD
Sbjct  374  ELEKEAKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   356 bits (913),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   348 bits (894),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE++ EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  54   RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESMPEALPGDNVGFNVKNVAVKDLKRGFV  113

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  114  ASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  173

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KK+
Sbjct  174  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKE  233

Query  185  PTG  177
            P+G
Sbjct  234  PSG  236



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   356 bits (913),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   347 bits (889),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  18   RVETGVIKPGMLVTFAPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  77

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  78   ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  137

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  138  EIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  197

Query  185  P  183
            P
Sbjct  198  P  198



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   356 bits (913),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   356 bits (913),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKP MVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPAMVVTFGPTGLTTEVKSVEMHHEALVEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFNEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KK+
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKE  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   348 bits (893),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGM+VTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGYV
Sbjct  49   RVETGVLKPGMLVTFAPTGLTTEVKSVEMHHESLLEAHPGDNVGFNVKNVAVKDLKRGYV  108

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAV+FAE+LTKIDRRSGK
Sbjct  109  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVRFAEILTKIDRRSGK  168

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPP+GRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  169  ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGRFAVRDMRQTVAVGVIKSVEKKD  228

Query  185  PTG  177
            PTG
Sbjct  229  PTG  231



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAGMV M PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD
Sbjct  374  EIEKEPKFLKNGDAGMVMMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG V
Sbjct  254  RVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGIV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            E+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  EIEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+F +QVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFIAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTFGP+GLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  254  RVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FT+QVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELE+EPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEREPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            PTG
Sbjct  434  PTG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+F SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD
Sbjct  374  ELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV
Sbjct  207  RVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  266

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AASFTSQVIIM HPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGK
Sbjct  267  ASNSKDDPAKEAASFTSQVIIMKHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGK  326

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  327  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  386

Query  185  PTG  177
            P+G
Sbjct  387  PSG  389



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   345 bits (886),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -2

Query  701  PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDP  522
            PGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDP
Sbjct  1    PGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDP  60

Query  521  AKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKF  342
            AKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKF
Sbjct  61   AKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKF  120

Query  341  LKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  177
            LKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  121  LKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  175



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EA+PGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEAVPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  725  RVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYV  546
            RVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+V
Sbjct  254  RVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFV  313

Query  545  ASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGK  366
            ASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGK
Sbjct  314  ASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGK  373

Query  365  ELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  186
            ELEKEPKFLKNGDAG VKM+PTKPMVVETF E PPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  374  ELEKEPKFLKNGDAGFVKMIPTKPMVVETFWESPPLGRFAVRDMRQTVAVGVIKSVEKKD  433

Query  185  PTG  177
            P+G
Sbjct  434  PSG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455