BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006J06

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631700.1|  PREDICTED: squalene synthase                       309   9e-100   Nicotiana tomentosiformis
sp|P53800.1|FDFT_NICBE  RecName: Full=Squalene synthase; Short=SQ...    307   5e-99    Nicotiana benthamiana
ref|XP_009802568.1|  PREDICTED: squalene synthase                       306   1e-98    Nicotiana sylvestris
gb|AAB08578.1|  squalene synthase                                       306   1e-98    Nicotiana tabacum [American tobacco]
gb|AAY22201.1|  squalene synthase                                       301   3e-97    Datura inoxia [downy thornapple]
gb|AAD20626.1|  squalene synthase                                       302   4e-97    Capsicum annuum
dbj|BAA82093.1|  squalene synthase                                      301   9e-97    Solanum tuberosum [potatoes]
gb|AEX26929.1|  squalene synthase 1-1                                   301   1e-96    Solanum tuberosum [potatoes]
gb|ADW78251.1|  squalene synthase                                       300   2e-96    Withania somnifera [ashwagandha]
ref|XP_006362006.1|  PREDICTED: squalene synthase-like isoform X1       299   7e-96    Solanum tuberosum [potatoes]
gb|AEX26930.1|  squalene synthase 1-2                                   298   2e-95    Solanum tuberosum [potatoes]
ref|NP_001234716.1|  squalene synthase                                  296   7e-95    
gb|AGS57530.1|  squalene synthase                                       296   1e-94    Solanum nigrum
gb|AEX26932.1|  squalene synthase                                       295   2e-94    Solanum chacoense
ref|XP_007042047.1|  Squalene synthase 1 isoform 1                      288   2e-91    
gb|AGB05603.1|  squalene synthase                                       287   5e-91    Camellia oleifera [abura-tsubaki]
ref|XP_009594336.1|  PREDICTED: squalene synthase-like                  286   1e-90    Nicotiana tomentosiformis
gb|ACS66750.1|  squalene synthase                                       285   3e-90    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_011088477.1|  PREDICTED: squalene synthase-like                  284   5e-90    Sesamum indicum [beniseed]
ref|XP_006360639.1|  PREDICTED: squalene synthase-like                  283   8e-90    
gb|KJB32575.1|  hypothetical protein B456_005G247700                    279   1e-89    Gossypium raimondii
gb|AAB02945.1|  squalene synthase                                       282   1e-89    Nicotiana tabacum [American tobacco]
ref|XP_009759256.1|  PREDICTED: squalene synthase-like                  283   2e-89    Nicotiana sylvestris
gb|ADG36702.1|  squalene synthase 1                                     282   2e-89    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_004248691.1|  PREDICTED: squalene synthase-like                  282   2e-89    Solanum lycopersicum
gb|ADG36707.1|  squalene synthase 1                                     282   3e-89    Glycyrrhiza uralensis [Chinese licorice]
emb|CDP20866.1|  unnamed protein product                                282   4e-89    Coffea canephora [robusta coffee]
gb|AFR77735.1|  squalene synthase                                       282   4e-89    Camellia oleifera [abura-tsubaki]
gb|ADG36709.1|  squalene synthase 1                                     281   5e-89    Glycyrrhiza uralensis [Chinese licorice]
gb|ACN69082.1|  squalene synthase                                       281   8e-89    Diospyros kaki [Japanese persimmon]
gb|ADG36705.1|  squalene synthase 1                                     281   9e-89    Glycyrrhiza uralensis [Chinese licorice]
gb|KJB32577.1|  hypothetical protein B456_005G247700                    280   1e-88    Gossypium raimondii
gb|KJB32578.1|  hypothetical protein B456_005G247700                    280   2e-88    Gossypium raimondii
gb|ADG36708.1|  squalene synthase 1                                     280   2e-88    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_002313765.1|  squalene synthase family protein                   280   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_002266150.1|  PREDICTED: squalene synthase                       280   3e-88    Vitis vinifera
gb|KJB32574.1|  hypothetical protein B456_005G247700                    279   4e-88    Gossypium raimondii
gb|AFJ15526.1|  squalene synthase                                       278   5e-88    Azadirachta indica [Indian-lilac]
gb|ADG36704.1|  squalene synthase 1                                     279   5e-88    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36703.1|  squalene synthase 1                                     279   5e-88    Glycyrrhiza uralensis [Chinese licorice]
dbj|BAA13083.1|  squalene synthase                                      279   5e-88    Glycyrrhiza glabra
gb|KJB12167.1|  hypothetical protein B456_002G004400                    275   6e-88    Gossypium raimondii
gb|ACT52826.1|  squalene synthase 1                                     278   7e-88    Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ77652.1|  squalene synthase 1                                    278   9e-88    Glycyrrhiza uralensis [Chinese licorice]
gb|EYU42585.1|  hypothetical protein MIMGU_mgv1a007225mg                278   1e-87    Erythranthe guttata [common monkey flower]
ref|XP_011047498.1|  PREDICTED: squalene synthase isoform X1            278   1e-87    Populus euphratica
gb|KJB12168.1|  hypothetical protein B456_002G004400                    274   2e-87    Gossypium raimondii
gb|ADC95435.1|  squalene synthase                                       277   2e-87    Withania somnifera [ashwagandha]
gb|AED99863.1|  squalene synthase                                       277   3e-87    Panax quinquefolius
ref|XP_010066209.1|  PREDICTED: squalene synthase                       277   4e-87    Eucalyptus grandis [rose gum]
gb|KHN25422.1|  Squalene synthase                                       276   4e-87    Glycine soja [wild soybean]
gb|ABX10442.1|  squalene synthase 2                                     276   4e-87    Gossypium hirsutum [American cotton]
gb|AER23670.1|  squalene synthase                                       276   6e-87    Eleutherococcus senticosus
ref|XP_011092839.1|  PREDICTED: squalene synthase-like                  276   6e-87    Sesamum indicum [beniseed]
ref|XP_008236983.1|  PREDICTED: squalene synthase-like                  276   6e-87    Prunus mume [ume]
gb|ADG36699.1|  squalene synthase 1                                     276   9e-87    Glycyrrhiza uralensis [Chinese licorice]
gb|ADC32654.1|  squalene synthase                                       275   1e-86    Aralia elata
emb|CAJ77654.1|  squalene synthase 1                                    275   1e-86    Glycyrrhiza eurycarpa
ref|XP_007199882.1|  hypothetical protein PRUPE_ppa006420mg             275   1e-86    
dbj|BAH23428.1|  squalene synthetase                                    275   2e-86    Euphorbia tirucalli
gb|ADD54645.1|  squalene synthase                                       275   2e-86    Bruguiera gymnorhiza [Burma mangrove]
gb|KHG07441.1|  Squalene synthase                                       275   2e-86    Gossypium arboreum [tree cotton]
ref|XP_003537842.1|  PREDICTED: squalene synthase-like isoform X1       275   2e-86    Glycine max [soybeans]
gb|KJB12166.1|  hypothetical protein B456_002G004400                    275   3e-86    Gossypium raimondii
gb|ACU21003.1|  unknown                                                 275   3e-86    Glycine max [soybeans]
gb|KJB12171.1|  hypothetical protein B456_002G004400                    274   3e-86    Gossypium raimondii
gb|KHG01756.1|  Squalene synthase                                       274   3e-86    Gossypium arboreum [tree cotton]
ref|XP_004507500.1|  PREDICTED: squalene synthase-like                  274   3e-86    Cicer arietinum [garbanzo]
gb|ACV88718.1|  squalene synthase                                       274   3e-86    Panax ginseng [Asiatic ginseng]
ref|XP_010039880.1|  PREDICTED: squalene synthase-like isoform X1       275   3e-86    Eucalyptus grandis [rose gum]
ref|XP_010039888.1|  PREDICTED: squalene synthase-like isoform X2       274   4e-86    Eucalyptus grandis [rose gum]
ref|XP_006591920.1|  PREDICTED: squalene synthase isoform X2            274   4e-86    
gb|ACZ71037.1|  squalene synthase                                       274   5e-86    Panax ginseng [Asiatic ginseng]
ref|XP_010109768.1|  hypothetical protein L484_008444                   273   7e-86    Morus notabilis
gb|AFZ93644.1|  squalene synthetase                                     273   8e-86    Euphorbia lathyris
ref|XP_010263865.1|  PREDICTED: squalene synthase-like                  273   8e-86    Nelumbo nucifera [Indian lotus]
gb|AIK21786.1|  squalene synthase                                       273   8e-86    Panax notoginseng [san-qi]
gb|KDP41726.1|  hypothetical protein JCGZ_26744                         273   9e-86    Jatropha curcas
dbj|BAA24289.1|  squalene synthase                                      273   1e-85    Panax ginseng [Asiatic ginseng]
ref|XP_002512982.1|  farnesyl-diphosphate farnesyltransferase, pu...    273   1e-85    
gb|AFT92039.1|  squalene synthase                                       273   2e-85    Euphorbia pekinensis
gb|ABA29019.1|  squalene synthase                                       273   2e-85    Panax notoginseng [san-qi]
gb|AEA41712.1|  squalene synthase                                       273   2e-85    Eleutherococcus senticosus
emb|CAJ58418.1|  squalene synthase                                      273   2e-85    Panax quinquefolius
ref|NP_001236365.1|  squalene synthase                                  273   2e-85    
ref|XP_002305455.2|  hypothetical protein POPTR_0004s16830g             274   2e-85    
ref|XP_009376518.1|  PREDICTED: squalene synthase-like                  272   2e-85    Pyrus x bretschneideri [bai li]
gb|EYU37850.1|  hypothetical protein MIMGU_mgv1a007228mg                272   2e-85    Erythranthe guttata [common monkey flower]
gb|ADG36701.1|  squalene synthase 1                                     272   2e-85    Glycyrrhiza uralensis [Chinese licorice]
gb|ADV57358.1|  squalene synthase                                       272   2e-85    Astragalus membranaceus
gb|ADW27427.1|  squalene synthase                                       272   2e-85    Astragalus membranaceus
gb|ACA66014.1|  squalene synthase                                       272   3e-85    Panax ginseng [Asiatic ginseng]
gb|ADX01171.1|  putative squalene synthase                              272   3e-85    Bacopa monnieri
emb|CAD23250.1|  farnesyl-diphosphate farnesyltransferase               272   3e-85    Medicago truncatula
dbj|BAC56854.1|  squalene synthase                                      271   4e-85    Lotus japonicus
emb|CAJ58419.1|  squalene synthase                                      271   4e-85    Panax quinquefolius
gb|AGS78117.1|  squalene synthase 1                                     271   5e-85    Malus domestica [apple tree]
gb|AFK36923.1|  unknown                                                 270   1e-84    Medicago truncatula
gb|AGI19256.1|  squalene synthase                                       270   1e-84    Panax notoginseng [san-qi]
gb|ACQ90302.1|  squalene synthase                                       270   2e-84    Gynostemma pentaphyllum [jiaogulan]
gb|AEA41713.1|  squalene synthase                                       270   2e-84    Eleutherococcus senticosus
gb|ACX42423.1|  squalene synthase                                       270   2e-84    Bupleurum chinense
ref|XP_011037190.1|  PREDICTED: squalene synthase-like                  269   3e-84    Populus euphratica
gb|ADG36706.1|  squalene synthase 1                                     269   4e-84    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36711.1|  squalene synthase 1                                     269   4e-84    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_003607040.1|  Squalene synthase                                  269   5e-84    
emb|CAN81937.1|  hypothetical protein VITISV_028001                     268   1e-83    Vitis vinifera
ref|XP_006591919.1|  PREDICTED: squalene synthase isoform X1            269   1e-83    
ref|XP_009378420.1|  PREDICTED: squalene synthase-like                  268   1e-83    Pyrus x bretschneideri [bai li]
ref|XP_008461009.1|  PREDICTED: squalene synthase-like                  268   1e-83    Cucumis melo [Oriental melon]
gb|ACX42425.1|  squalene synthase                                       267   1e-83    Bupleurum chinense
ref|XP_004150142.1|  PREDICTED: squalene synthase-like                  268   2e-83    
gb|AAR20329.1|  squalene synthase                                       266   6e-83    Artemisia annua [sweet Annie]
gb|ACS66749.1|  squalene synthase                                       265   8e-83    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36717.1|  squalene synthase 2                                     265   8e-83    Glycyrrhiza uralensis [Chinese licorice]
dbj|BAA13084.1|  squalene synthase                                      265   8e-83    Glycyrrhiza glabra
gb|KDO43891.1|  hypothetical protein CISIN_1g015087mg                   258   1e-82    Citrus sinensis [apfelsine]
gb|AFI33135.3|  squalene synthase                                       265   1e-82    Eriobotrya japonica [loquat]
gb|ADG36719.1|  squalene synthase 2                                     265   1e-82    Glycyrrhiza uralensis [Chinese licorice]
gb|AAR20328.1|  squalene synthase                                       265   1e-82    Artemisia annua [sweet Annie]
ref|XP_007131767.1|  hypothetical protein PHAVU_011G040100g             265   1e-82    Phaseolus vulgaris [French bean]
gb|AAY46017.1|  squalene synthase                                       265   2e-82    Bupleurum falcatum
gb|KJB12169.1|  hypothetical protein B456_002G004400                    265   2e-82    Gossypium raimondii
gb|AHA84150.1|  squalene synthase                                       265   2e-82    Phaseolus vulgaris [French bean]
emb|CAJ77653.1|  squalene synthase 2                                    265   2e-82    Glycyrrhiza uralensis [Chinese licorice]
gb|ABQ96265.1|  squalene synthase                                       264   3e-82    Psammosilene tunicoides
emb|CDX72493.1|  BnaC07g45150D                                          264   5e-82    
ref|NP_001280921.1|  squalene synthase-like                             263   5e-82    Malus domestica [apple tree]
gb|ACX42426.1|  squalene synthase                                       263   9e-82    Bupleurum chinense
gb|AFK29284.1|  putative squalene synthase 2                            263   9e-82    Salvia miltiorrhiza [Chinese salvia]
gb|ACT52825.1|  squalene synthase 2                                     263   1e-81    Glycyrrhiza uralensis [Chinese licorice]
gb|AFK29283.1|  putative squalene synthase 1                            263   1e-81    Salvia miltiorrhiza [Chinese salvia]
ref|XP_006412201.1|  hypothetical protein EUTSA_v10025338mg             262   1e-81    Eutrema salsugineum [saltwater cress]
gb|AAV58897.1|  squalene synthase                                       262   2e-81    Centella asiatica [Asiatic pennywort]
ref|XP_006487315.1|  PREDICTED: squalene synthase isoform X2            258   2e-81    
ref|XP_006283828.1|  hypothetical protein CARUB_v10004929mg             261   3e-81    Capsella rubella
emb|CAJ77655.1|  squalene synthase 2                                    261   3e-81    Glycyrrhiza eurycarpa
ref|XP_010548076.1|  PREDICTED: squalene synthase-like isoform X2       261   4e-81    Tarenaya hassleriana [spider flower]
gb|ABG66304.1|  squalene synthase                                       261   5e-81    Polygala tenuifolia [Chinese senega-root]
gb|AEM42980.1|  squalene synthase                                       261   5e-81    Siraitia grosvenorii [arhat fruit]
emb|CDY17472.1|  BnaC03g65910D                                          261   6e-81    Brassica napus [oilseed rape]
gb|ACR57219.1|  squalene synthase                                       261   6e-81    Salvia miltiorrhiza [Chinese salvia]
emb|CDY45322.1|  BnaA03g52950D                                          260   9e-81    Brassica napus [oilseed rape]
ref|XP_009138312.1|  PREDICTED: squalene synthase-like                  260   9e-81    Brassica rapa
ref|XP_002869133.1|  hypothetical protein ARALYDRAFT_912921             260   1e-80    Arabidopsis lyrata subsp. lyrata
ref|XP_011458278.1|  PREDICTED: squalene synthase-like isoform X2       260   1e-80    Fragaria vesca subsp. vesca
ref|XP_009108714.1|  PREDICTED: squalene synthase-like isoform X1       260   1e-80    Brassica rapa
gb|AAG14896.2|AF302464_1  squalene synthase                             259   4e-80    Artemisia annua [sweet Annie]
emb|CDX69075.1|  BnaC01g03780D                                          258   4e-80    
ref|XP_010432389.1|  PREDICTED: squalene synthase                       258   4e-80    Camelina sativa [gold-of-pleasure]
gb|KFK30097.1|  hypothetical protein AALP_AA7G216600                    258   5e-80    Arabis alpina [alpine rockcress]
gb|ACX42424.1|  squalene synthase                                       258   5e-80    Bupleurum chinense
emb|CDX75450.1|  BnaA01g02520D                                          258   7e-80    
ref|XP_004290304.1|  PREDICTED: squalene synthase-like isoform X1       258   7e-80    Fragaria vesca subsp. vesca
ref|XP_006423444.1|  hypothetical protein CICLE_v10028537mg             253   8e-80    
emb|CDX76294.1|  BnaA08g11060D                                          257   1e-79    
ref|XP_006487314.1|  PREDICTED: squalene synthase isoform X1            257   1e-79    
ref|XP_009110610.1|  PREDICTED: squalene synthase                       257   2e-79    
ref|XP_010548075.1|  PREDICTED: squalene synthase-like isoform X1       256   4e-79    Tarenaya hassleriana [spider flower]
ref|XP_010437580.1|  PREDICTED: squalene synthase-like isoform X2       256   5e-79    Camelina sativa [gold-of-pleasure]
ref|XP_006423443.1|  hypothetical protein CICLE_v10028537mg             253   1e-78    
ref|XP_010447048.1|  PREDICTED: squalene synthase-like                  254   1e-78    Camelina sativa [gold-of-pleasure]
ref|NP_195190.1|  Squalene synthase 1                                   254   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619298.1|  PREDICTED: squalene synthase-like                  254   2e-78    
ref|XP_010690774.1|  PREDICTED: squalene synthase-like                  254   3e-78    Beta vulgaris subsp. vulgaris [field beet]
gb|AIX97193.1|  squalene synthase                                       253   4e-78    Matricaria chamomilla var. recutita [German chamomile]
ref|XP_010526913.1|  PREDICTED: squalene synthase-like                  253   5e-78    
ref|XP_010027379.1|  PREDICTED: squalene synthase-like                  248   6e-78    
ref|XP_006423442.1|  hypothetical protein CICLE_v10028537mg             253   7e-78    
ref|XP_006351216.1|  PREDICTED: squalene synthase-like                  251   2e-77    Solanum tuberosum [potatoes]
ref|XP_010065915.1|  PREDICTED: squalene synthase-like                  251   3e-77    Eucalyptus grandis [rose gum]
ref|XP_010690775.1|  PREDICTED: squalene synthase-like                  251   3e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004249733.1|  PREDICTED: squalene synthase-like isoform X1       248   4e-76    Solanum lycopersicum
ref|XP_009760451.1|  PREDICTED: squalene synthase-like                  248   4e-76    Nicotiana sylvestris
ref|XP_010025621.1|  PREDICTED: squalene synthase-like                  248   5e-76    Eucalyptus grandis [rose gum]
ref|XP_010437579.1|  PREDICTED: squalene synthase-like isoform X1       248   7e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010025618.1|  PREDICTED: squalene synthase-like                  246   3e-75    Eucalyptus grandis [rose gum]
ref|XP_006841632.1|  hypothetical protein AMTR_s00003p00232080          244   9e-75    Amborella trichopoda
ref|XP_009769885.1|  PREDICTED: squalene synthase-like                  243   2e-74    Nicotiana sylvestris
gb|KDO43892.1|  hypothetical protein CISIN_1g015087mg                   243   2e-74    Citrus sinensis [apfelsine]
gb|KDO43893.1|  hypothetical protein CISIN_1g015087mg                   243   2e-74    Citrus sinensis [apfelsine]
ref|XP_010312074.1|  PREDICTED: squalene synthase-like isoform X2       242   4e-74    
emb|CDX69076.1|  BnaC01g03770D                                          241   4e-73    
gb|AGN32410.1|  squalene synthase                                       240   4e-73    Dioscorea zingiberensis
ref|XP_009110500.1|  PREDICTED: squalene synthase                       239   1e-72    Brassica rapa
emb|CDX75451.1|  BnaA01g02510D                                          238   2e-72    
gb|AAB61927.1|  squalene synthase 2                                     238   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795796.1|  PREDICTED: squalene synthase-like isoform X1       236   2e-71    Phoenix dactylifera
ref|XP_008796678.1|  PREDICTED: squalene synthase-like isoform X1       236   2e-71    Phoenix dactylifera
gb|AFN61199.1|  squalene synthase                                       236   2e-71    Chlorophytum borivilianum
ref|XP_008796681.1|  PREDICTED: squalene synthase-like isoform X2       236   2e-71    Phoenix dactylifera
ref|XP_010437577.1|  PREDICTED: squalene synthase-like isoform X1       236   2e-71    Camelina sativa [gold-of-pleasure]
ref|NP_195191.2|  squalene synthase 2                                   236   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934354.1|  PREDICTED: squalene synthase-like                  234   8e-71    Elaeis guineensis
ref|XP_010447047.1|  PREDICTED: squalene synthase-like                  234   1e-70    Camelina sativa [gold-of-pleasure]
gb|AGW25489.1|  squalene synthase                                       233   2e-70    Paris polyphylla var. yunnanensis
ref|XP_010432387.1|  PREDICTED: squalene synthase-like                  233   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_002869132.1|  squalene synthase 2                                233   3e-70    
gb|KFK30098.1|  hypothetical protein AALP_AA7G216700                    233   4e-70    Arabis alpina [alpine rockcress]
gb|AHB20141.2|  squalene synthase                                       232   6e-70    Fritillaria thunbergii
gb|EAY92248.1|  hypothetical protein OsI_13969                          231   1e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_009396917.1|  PREDICTED: squalene synthase-like                  231   1e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001051625.1|  Os03g0805100                                       231   2e-69    
gb|EEE60131.1|  hypothetical protein OsJ_13016                          231   2e-69    Oryza sativa Japonica Group [Japonica rice]
gb|AFY63035.1|  squalene synthase                                       229   6e-69    Alisma plantago-aquatica subsp. orientale
dbj|BAJ99680.1|  predicted protein                                      223   2e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006412200.1|  hypothetical protein EUTSA_v10025392mg             228   3e-68    
ref|XP_010437578.1|  PREDICTED: squalene synthase-like isoform X2       226   8e-68    Camelina sativa [gold-of-pleasure]
gb|AGI56082.1|  squalene synthase                                       226   2e-67    Dendrobium officinale
gb|AFS28708.1|  putative squalene synthase                              216   8e-67    Olea europaea
dbj|BAJ87710.1|  predicted protein                                      223   2e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004981370.1|  PREDICTED: squalene synthase-like                  219   3e-66    
ref|XP_003559279.1|  PREDICTED: squalene synthase-like                  222   3e-66    Brachypodium distachyon [annual false brome]
gb|EMT03383.1|  Squalene synthetase                                     223   4e-66    
ref|XP_007042048.1|  Squalene synthase 1 isoform 2                      219   4e-66    
ref|XP_006351382.1|  PREDICTED: squalene synthase-like                  222   5e-66    
ref|NP_001104839.1|  squalene synthase1                                 222   5e-66    Zea mays [maize]
ref|XP_006651930.1|  PREDICTED: squalene synthase-like                  221   7e-66    Oryza brachyantha
ref|XP_011047507.1|  PREDICTED: squalene synthase isoform X2            216   1e-64    Populus euphratica
ref|XP_009389044.1|  PREDICTED: squalene synthase-like                  218   1e-64    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN33457.1|  unknown                                                 214   1e-64    Zea mays [maize]
gb|EYU37849.1|  hypothetical protein MIMGU_mgv1a007228mg                216   2e-64    Erythranthe guttata [common monkey flower]
emb|CDX72494.1|  BnaC07g45160D                                          216   4e-64    
ref|XP_002466259.1|  hypothetical protein SORBIDRAFT_01g004550          217   5e-64    Sorghum bicolor [broomcorn]
tpg|DAA52015.1|  TPA: hypothetical protein ZEAMMB73_299336              212   5e-64    
ref|XP_008795798.1|  PREDICTED: squalene synthase-like isoform X2       215   1e-63    
gb|AIW04729.1|  squalene synthase                                       216   1e-63    Dryopteris fragrans
ref|XP_003564211.1|  PREDICTED: squalene synthase-like                  215   1e-63    Brachypodium distachyon [annual false brome]
ref|XP_006658375.1|  PREDICTED: squalene synthase-like                  214   2e-63    
ref|NP_001130502.1|  uncharacterized protein LOC100191601               214   7e-63    
gb|AHI96421.1|  squalene synthase                                       213   9e-63    Pinus massoniana [Chinese red pine]
tpg|DAA52014.1|  TPA: hypothetical protein ZEAMMB73_299336              212   2e-62    
gb|ABK24732.1|  unknown                                                 212   3e-62    Picea sitchensis
gb|EMS67019.1|  Squalene synthase                                       211   7e-62    Triticum urartu
ref|NP_001059129.1|  Os07g0200700                                       207   2e-60    
ref|XP_006285747.1|  hypothetical protein CARUB_v10007220mg             206   7e-60    Capsella rubella
gb|ABI14439.1|  squalene synthase                                       203   7e-59    Taxus cuspidata [ichii]
gb|AEX58673.1|  squalene synthase                                       189   3e-53    Huperzia serrata [toothed club-moss]
ref|XP_009138586.1|  PREDICTED: squalene synthase-like                  177   2e-50    
ref|XP_001775898.1|  predicted protein                                  179   7e-50    
ref|XP_001773253.1|  predicted protein                                  174   1e-48    
ref|XP_002971951.1|  hypothetical protein SELMODRAFT_96714              174   8e-48    
ref|XP_008796682.1|  PREDICTED: squalene synthase-like isoform X3       173   1e-47    
gb|KDO43895.1|  hypothetical protein CISIN_1g015087mg                   167   1e-45    Citrus sinensis [apfelsine]
emb|CEF97547.1|  Squalene/phytoene synthase                             166   1e-44    Ostreococcus tauri
ref|XP_001756673.1|  predicted protein                                  161   8e-43    
gb|EEC81691.1|  hypothetical protein OsI_25282                          152   1e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_001417488.1|  predicted protein                                  155   2e-40    Ostreococcus lucimarinus CCE9901
gb|KIZ04121.1|  farnesyl-diphosphatefarnesyltransferase                 154   1e-39    Monoraphidium neglectum
ref|XP_001703447.1|  farnesyl-diphosphate farnesyltransferase           147   8e-38    Chlamydomonas reinhardtii
ref|XP_007512409.1|  squalene synthase                                  144   4e-36    Bathycoccus prasinos
ref|XP_006115891.1|  PREDICTED: squalene synthase-like                  142   5e-36    
ref|XP_002588443.1|  hypothetical protein BRAFLDRAFT_198742             139   8e-36    Branchiostoma floridae
ref|XP_629811.1|  farnesyl-diphosphate farnesyltransferase              141   2e-35    Dictyostelium discoideum AX4
ref|XP_005651444.1|  farnesyl-diphosphate farnesyltransferase           140   2e-35    Coccomyxa subellipsoidea C-169
ref|XP_010200276.1|  PREDICTED: squalene synthase                       139   3e-35    Colius striatus
ref|XP_008943984.1|  PREDICTED: squalene synthase                       138   6e-35    Merops nubicus
ref|XP_010706473.1|  PREDICTED: squalene synthase                       138   6e-35    Meleagris gallopavo [common turkey]
ref|XP_007429053.1|  PREDICTED: squalene synthase isoform X1            139   8e-35    Python bivittatus
ref|XP_006008978.1|  PREDICTED: squalene synthase                       139   1e-34    
gb|KFQ22809.1|  Squalene synthase                                       138   1e-34    Merops nubicus
gb|KFP31735.1|  Squalene synthase                                       138   1e-34    Colius striatus
ref|XP_003283681.1|  farnesyl-diphosphate farnesyltransferase           139   1e-34    Dictyostelium purpureum
ref|XP_010072080.1|  PREDICTED: squalene synthase                       136   2e-34    Pterocles gutturalis
ref|XP_009094381.1|  PREDICTED: squalene synthase-like                  136   3e-34    
ref|XP_009465636.1|  PREDICTED: squalene synthase                       136   4e-34    Nipponia nippon
ref|XP_009579009.1|  PREDICTED: squalene synthase                       135   4e-34    Fulmarus glacialis
ref|XP_009819304.1|  PREDICTED: squalene synthase                       135   4e-34    Gavia stellata
ref|XP_003058046.1|  predicted protein                                  138   5e-34    Micromonas pusilla CCMP1545
ref|XP_009699274.1|  PREDICTED: squalene synthase                       132   5e-34    Cariama cristata
gb|KFQ99234.1|  Squalene synthase                                       136   6e-34    Nipponia nippon
ref|XP_010286029.1|  PREDICTED: squalene synthase                       135   6e-34    Phaethon lepturus
ref|XP_010021685.1|  PREDICTED: squalene synthase                       135   7e-34    Nestor notabilis
ref|XP_009940610.1|  PREDICTED: squalene synthase                       135   7e-34    Opisthocomus hoazin [hoatzin]
ref|XP_010119923.1|  PREDICTED: squalene synthase                       135   8e-34    Chlamydotis macqueenii
ref|NP_001034383.1|  squalene synthase                                  137   8e-34    Gallus gallus [bantam]
gb|ADR66128.1|  squalene synthase                                       131   1e-33    Hieracium porrifolium
gb|KFQ67434.1|  Squalene synthase                                       135   1e-33    Phaethon lepturus
gb|ADR66127.1|  squalene synthase                                       131   1e-33    Hieracium umbellatum
ref|XP_009317975.1|  PREDICTED: squalene synthase                       135   1e-33    
gb|KFQ43993.1|  Squalene synthase                                       135   1e-33    
ref|XP_009486915.1|  PREDICTED: squalene synthase                       131   1e-33    
gb|KFR16753.1|  Squalene synthase                                       135   1e-33    
gb|KFP42539.1|  Squalene synthase                                       135   2e-33    
ref|XP_010186209.1|  PREDICTED: squalene synthase                       134   2e-33    
ref|XP_010581427.1|  PREDICTED: squalene synthase isoform X1            135   2e-33    
ref|XP_009287225.1|  PREDICTED: squalene synthase                       135   2e-33    
ref|XP_008917712.1|  PREDICTED: squalene synthase                       134   2e-33    
ref|XP_009886241.1|  PREDICTED: squalene synthase                       134   2e-33    
gb|KFM13981.1|  Squalene synthase                                       135   2e-33    
ref|XP_005146462.1|  PREDICTED: squalene synthase                       135   2e-33    
ref|XP_010146008.1|  PREDICTED: squalene synthase                       134   2e-33    
ref|XP_005028302.1|  PREDICTED: squalene synthase                       135   2e-33    
gb|KFW64115.1|  Squalene synthase                                       134   2e-33    
ref|XP_009638212.1|  PREDICTED: squalene synthase                       134   2e-33    
gb|EOA95205.1|  Squalene synthetase                                     134   3e-33    
ref|XP_004358616.1|  farnesyl-diphosphate farnesyltransferase           138   3e-33    
ref|XP_007429056.1|  PREDICTED: squalene synthase isoform X4            134   3e-33    
gb|KFQ38302.1|  Squalene synthase                                       134   3e-33    
gb|KGL95687.1|  Squalene synthase                                       134   3e-33    
gb|KFQ73762.1|  Squalene synthase                                       134   4e-33    
ref|XP_009957016.1|  PREDICTED: squalene synthase                       134   4e-33    
ref|XP_010000497.1|  PREDICTED: squalene synthase                       134   4e-33    
gb|ADR66122.1|  squalene synthase                                       129   4e-33    
ref|XP_008170096.1|  PREDICTED: squalene synthase                       135   4e-33    
ref|XP_010211000.1|  PREDICTED: squalene synthase                       133   5e-33    
gb|KFP16881.1|  Squalene synthase                                       134   5e-33    
ref|XP_010409682.1|  PREDICTED: squalene synthase                       133   5e-33    
ref|XP_010305165.1|  PREDICTED: squalene synthase                       133   5e-33    
gb|EFA80770.1|  farnesyl-diphosphate farnesyltransferase                134   5e-33    
ref|XP_009078811.1|  PREDICTED: squalene synthase                       133   5e-33    
ref|XP_009986797.1|  PREDICTED: squalene synthase                       133   6e-33    
gb|KFW01543.1|  Squalene synthase                                       134   7e-33    
gb|KFW77295.1|  Squalene synthase                                       134   7e-33    
gb|KFU93067.1|  Squalene synthase                                       133   7e-33    
gb|KFQ15889.1|  Squalene synthase                                       133   8e-33    
ref|XP_008490611.1|  PREDICTED: squalene synthase                       132   8e-33    
ref|XP_005443614.1|  PREDICTED: squalene synthase                       134   8e-33    
ref|XP_002501456.1|  predicted protein                                  134   8e-33    
gb|KGL75930.1|  Squalene synthase                                       133   8e-33    
sp|Q9SDW9.1|BSS_BOTBR  RecName: Full=Squalene synthase                  134   8e-33    
ref|XP_006172265.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl-dip...    134   8e-33    
gb|KFP86331.1|  Squalene synthase                                       133   8e-33    
gb|KFO13053.1|  Squalene synthase                                       133   1e-32    
gb|KFV19358.1|  Squalene synthase                                       132   1e-32    
ref|XP_010165413.1|  PREDICTED: squalene synthase                       132   1e-32    
gb|AAF71269.1|  squalene synthase                                       127   1e-32    
ref|XP_004614762.1|  PREDICTED: squalene synthase                       133   2e-32    
ref|XP_002946755.1|  hypothetical protein VOLCADRAFT_79344              133   2e-32    
ref|XP_009921323.1|  PREDICTED: squalene synthase                       131   2e-32    
ref|XP_009906050.1|  PREDICTED: squalene synthase isoform X2            132   2e-32    
ref|XP_006033877.1|  PREDICTED: squalene synthase-like                  132   2e-32    
ref|XP_005513697.1|  PREDICTED: squalene synthase                       132   2e-32    
gb|KFZ57398.1|  Squalene synthase                                       132   2e-32    
gb|KFO99755.1|  Squalene synthase                                       132   3e-32    
ref|XP_008629248.1|  PREDICTED: squalene synthase                       132   3e-32    
ref|XP_005236741.1|  PREDICTED: squalene synthase                       132   3e-32    
ref|XP_007517289.1|  PREDICTED: squalene synthase isoform X2            132   3e-32    
gb|ELV14227.1|  Squalene synthase                                       131   4e-32    
ref|XP_005528843.1|  PREDICTED: squalene synthase                       132   4e-32    
ref|XP_002114185.1|  hypothetical protein TRIADDRAFT_27912              132   4e-32    
ref|XP_004449107.1|  PREDICTED: squalene synthase                       131   5e-32    
ref|XP_006518610.1|  PREDICTED: squalene synthase isoform X3            129   5e-32    
ref|XP_006263357.1|  PREDICTED: squalene synthase-like                  132   5e-32    
ref|XP_003225597.2|  PREDICTED: squalene synthase                       132   5e-32    
ref|XP_007068988.1|  PREDICTED: squalene synthase-like                  132   5e-32    
ref|XP_008977275.1|  PREDICTED: squalene synthase isoform X3            130   6e-32    
ref|XP_003479432.1|  PREDICTED: squalene synthase isoform X1            131   6e-32    
gb|KFV73970.1|  Squalene synthase                                       131   6e-32    
ref|XP_009665209.1|  PREDICTED: squalene synthase                       130   7e-32    
ref|XP_009560858.1|  PREDICTED: squalene synthase isoform X2            131   7e-32    
ref|XP_009906049.1|  PREDICTED: squalene synthase isoform X1            131   7e-32    
ref|XP_007517287.1|  PREDICTED: squalene synthase isoform X1            131   7e-32    
gb|KFO77427.1|  Squalene synthase                                       131   7e-32    
ref|XP_007068989.1|  PREDICTED: squalene synthase-like                  130   8e-32    
gb|KFV76998.1|  Squalene synthase                                       130   8e-32    
ref|NP_001189454.1|  squalene synthase                                  131   8e-32    
ref|XP_005709250.1|  farnesyl-diphosphate farnesyltransferase           127   8e-32    
ref|XP_005044492.1|  PREDICTED: squalene synthase                       131   8e-32    
ref|XP_009560856.1|  PREDICTED: squalene synthase isoform X1            131   9e-32    
ref|XP_007097199.1|  PREDICTED: squalene synthase isoform X1            130   9e-32    
gb|ACI14294.1|  squalene synthase                                       128   9e-32    
ref|NP_001274685.1|  squalene synthase isoform 5                        127   1e-31    
ref|XP_008968069.1|  PREDICTED: squalene synthase isoform X2            127   1e-31    
ref|XP_005008182.1|  PREDICTED: squalene synthase isoform X2            131   1e-31    
ref|XP_003984893.2|  PREDICTED: squalene synthase                       130   2e-31    
ref|XP_005290732.1|  PREDICTED: squalene synthase-like                  130   2e-31    
ref|XP_010590633.1|  PREDICTED: squalene synthase                       129   2e-31    
gb|EMP27211.1|  Squalene synthase                                       131   2e-31    
ref|XP_002749744.1|  PREDICTED: squalene synthase-like isoform X1       130   2e-31    
ref|XP_006884953.1|  PREDICTED: squalene synthase isoform X3            129   2e-31    
ref|XP_002756812.1|  PREDICTED: squalene synthase isoform X1            130   2e-31    
gb|ACN60238.1|  Squalene synthetase                                     127   2e-31    
ref|XP_008977276.1|  PREDICTED: squalene synthase isoform X4            130   3e-31    
ref|XP_010330374.1|  PREDICTED: squalene synthase isoform X3            128   3e-31    
gb|EMP27212.1|  Squalene synthase                                       130   3e-31    
sp|G0Y288.1|BOCS_BOTBR  RecName: Full=Botryococcene synthase; Alt...    129   3e-31    
ref|XP_003757973.1|  PREDICTED: squalene synthase                       130   4e-31    
ref|XP_006884952.1|  PREDICTED: squalene synthase isoform X2            129   4e-31    
ref|XP_008703290.1|  PREDICTED: squalene synthase                       128   4e-31    
ref|XP_001915483.1|  PREDICTED: squalene synthase                       129   4e-31    
ref|XP_008070645.1|  PREDICTED: squalene synthase isoform X2            127   4e-31    
ref|XP_008148989.1|  PREDICTED: squalene synthase isoform X3            129   4e-31    
ref|XP_005425026.1|  PREDICTED: squalene synthase                       130   5e-31    
ref|XP_008574545.1|  PREDICTED: squalene synthase isoform X2            129   5e-31    
ref|XP_008574544.1|  PREDICTED: squalene synthase isoform X1            129   5e-31    
ref|XP_008529254.1|  PREDICTED: squalene synthase isoform X2            129   6e-31    
dbj|BAE36836.1|  unnamed protein product                                129   6e-31    
ref|XP_008768968.1|  PREDICTED: squalene synthase isoform X1            129   6e-31    
gb|AAF00038.1|  squalene synthase                                       128   7e-31    
ref|XP_011243253.1|  PREDICTED: squalene synthase isoform X2            129   7e-31    
ref|XP_003793969.1|  PREDICTED: squalene synthase isoform 3             128   7e-31    
ref|XP_006774849.1|  PREDICTED: squalene synthase isoform X2            129   7e-31    
dbj|BAG51957.1|  unnamed protein product                                127   7e-31    
ref|XP_008529253.1|  PREDICTED: squalene synthase isoform X1            129   7e-31    
ref|XP_005859689.1|  PREDICTED: squalene synthase                       128   7e-31    
dbj|BAA06102.1|  squalene synthase                                      128   8e-31    
ref|NP_062111.1|  squalene synthase                                     128   8e-31    
ref|XP_006884951.1|  PREDICTED: squalene synthase isoform X1            129   8e-31    
ref|XP_005495474.1|  PREDICTED: squalene synthase                       128   8e-31    
ref|NP_034321.2|  squalene synthase                                     128   8e-31    
ref|XP_006774848.1|  PREDICTED: squalene synthase isoform X1            129   8e-31    
ref|XP_008070644.1|  PREDICTED: squalene synthase isoform X1            127   8e-31    
gb|AAM27472.1|  squalene synthase                                       126   9e-31    
ref|XP_008148987.1|  PREDICTED: squalene synthase isoform X1            129   9e-31    
ref|XP_003793968.1|  PREDICTED: squalene synthase isoform 2             128   9e-31    
ref|XP_008148988.1|  PREDICTED: squalene synthase isoform X2            128   9e-31    
ref|XP_002186800.1|  PREDICTED: squalene synthase                       128   9e-31    
emb|CDQ56794.1|  unnamed protein product                                126   9e-31    
ref|XP_001685284.1|  putative squalene synthase                         128   1e-30    
ref|XP_004433568.1|  PREDICTED: squalene synthase isoform 2             128   1e-30    
ref|XP_003944232.1|  PREDICTED: squalene synthase isoform X2            128   1e-30    
ref|XP_011228676.1|  PREDICTED: squalene synthase isoform X1            128   1e-30    
ref|XP_009025212.1|  hypothetical protein HELRODRAFT_68312              127   1e-30    
ref|XP_002923714.1|  PREDICTED: squalene synthase isoform X2            128   1e-30    
ref|NP_001274680.1|  squalene synthase isoform 4                        127   1e-30    
dbj|GAM21817.1|  hypothetical protein SAMD00019534_049920               127   1e-30    
ref|XP_006039244.1|  PREDICTED: squalene synthase-like                  128   1e-30    
ref|XP_010330373.1|  PREDICTED: squalene synthase isoform X1            128   1e-30    
ref|XP_003793967.1|  PREDICTED: squalene synthase isoform 1             127   1e-30    
ref|XP_007882609.1|  PREDICTED: squalene synthase                       127   2e-30    
ref|XP_007959828.1|  PREDICTED: squalene synthase isoform X3            127   2e-30    
ref|XP_004046702.1|  PREDICTED: squalene synthase isoform 3             127   2e-30    
ref|XP_004046701.1|  PREDICTED: squalene synthase isoform 2             127   2e-30    
ref|XP_004433567.1|  PREDICTED: squalene synthase isoform 1             128   2e-30    
pdb|1EZF|A  Chain A, Crystal Structure Of Human Squalene Synthase       126   2e-30    
pdb|3LEE|A  Chain A, Crystal Structure Of The Human Squalene Synt...    126   2e-30    
pdb|3WEI|A  Chain A, Crystal Structure Of The Human Squalene Synt...    126   2e-30    
pdb|3VJ8|A  Chain A, Crystal Structure Of The Human Squalene Synt...    126   2e-30    
ref|XP_003271491.1|  PREDICTED: squalene synthase isoform 3             126   2e-30    
ref|XP_006864385.1|  PREDICTED: squalene synthase isoform X3            127   2e-30    
dbj|BAH14404.1|  unnamed protein product                                126   2e-30    
dbj|BAG58807.1|  unnamed protein product                                127   2e-30    
ref|NP_001274673.1|  squalene synthase isoform 2                        126   2e-30    
ref|NP_001135642.2|  farnesyl-diphosphate farnesyltransferase 1         127   2e-30    
ref|XP_007936897.1|  PREDICTED: squalene synthase isoform X3            126   2e-30    
ref|XP_011395550.1|  Squalene synthase                                  127   3e-30    
ref|XP_003271490.1|  PREDICTED: squalene synthase isoform 2             126   3e-30    
ref|XP_004382267.1|  PREDICTED: squalene synthase isoform 3             126   3e-30    
emb|CAJ76132.2|  squalene synthase                                      127   3e-30    
ref|XP_002709483.1|  PREDICTED: squalene synthase isoform X2            127   3e-30    
ref|XP_004088003.1|  PREDICTED: squalene synthase                       126   3e-30    
ref|XP_008247080.1|  PREDICTED: squalene synthase isoform X1            127   3e-30    
ref|XP_006864384.1|  PREDICTED: squalene synthase isoform X2            127   3e-30    
ref|XP_004046700.1|  PREDICTED: squalene synthase isoform 1             127   3e-30    
ref|XP_003877813.1|  putative farnesyltransferase                       126   4e-30    
ref|NP_001247653.1|  squalene synthase                                  126   4e-30    
ref|XP_006864383.1|  PREDICTED: squalene synthase isoform X1            127   4e-30    
ref|XP_005535962.1|  squalene synthase                                  127   4e-30    
emb|CAA48896.1|  farnesyl-diphosphate farnesyltransferase               126   4e-30    
ref|XP_007936894.1|  PREDICTED: squalene synthase isoform X1            127   4e-30    
ref|NP_001267081.1|  squalene synthase                                  126   4e-30    
ref|XP_010382892.1|  PREDICTED: squalene synthase isoform X2            126   4e-30    
gb|AAH09251.1|  Farnesyl-diphosphate farnesyltransferase 1              126   4e-30    
ref|NP_004453.3|  squalene synthase isoform 1                           126   4e-30    
gb|AAP36671.1|  Homo sapiens farnesyl-diphosphate farnesyltransfe...    126   4e-30    
ref|XP_003271489.1|  PREDICTED: squalene synthase isoform 1             126   4e-30    
ref|XP_005562629.1|  PREDICTED: squalene synthase isoform X1            127   4e-30    
ref|XP_007936895.1|  PREDICTED: squalene synthase isoform X2            126   5e-30    
ref|XP_009438499.1|  PREDICTED: squalene synthase isoform X1            126   5e-30    
ref|XP_009438497.1|  PREDICTED: squalene synthase isoform X2            127   5e-30    
ref|XP_009864778.1|  PREDICTED: squalene synthase                       122   5e-30    
ref|XP_004382265.1|  PREDICTED: squalene synthase isoform 1             127   5e-30    
ref|XP_007959826.1|  PREDICTED: squalene synthase isoform X1            126   5e-30    
ref|XP_004382266.1|  PREDICTED: squalene synthase isoform 2             126   5e-30    
ref|XP_010382891.1|  PREDICTED: squalene synthase isoform X1            126   5e-30    
dbj|BAG60195.1|  unnamed protein product                                126   5e-30    
ref|NP_001274679.1|  squalene synthase isoform 3                        126   5e-30    
gb|KFP74853.1|  Squalene synthase                                       122   5e-30    
ref|XP_003449965.1|  PREDICTED: squalene synthase-like                  126   5e-30    
ref|XP_005712480.1|  unnamed protein product                            126   6e-30    
ref|XP_009241805.1|  PREDICTED: squalene synthase isoform X1            126   6e-30    
gb|KDD74507.1|  squalene/phytoene synthase                              125   7e-30    
ref|XP_006797166.1|  PREDICTED: squalene synthase-like                  125   7e-30    
ref|XP_003863390.1|  farnesyltransferase, putative                      125   7e-30    
ref|XP_008396056.1|  PREDICTED: squalene synthase isoform X2            125   7e-30    
ref|XP_005075330.1|  PREDICTED: squalene synthase                       125   9e-30    
ref|XP_008396055.1|  PREDICTED: squalene synthase isoform X1            125   9e-30    
ref|XP_005977636.1|  PREDICTED: squalene synthase                       125   9e-30    
ref|XP_007552931.1|  PREDICTED: squalene synthase isoform X2            125   9e-30    
ref|XP_007192742.1|  PREDICTED: squalene synthase isoform X2            124   9e-30    
ref|XP_001567320.1|  putative farnesyltransferase                       125   1e-29    
gb|AAI68496.1|  Unknown (protein for MGC:173117)                        125   1e-29    
ref|XP_005635705.1|  PREDICTED: squalene synthase isoform X2            125   1e-29    
ref|XP_007552930.1|  PREDICTED: squalene synthase isoform X1            125   1e-29    
ref|XP_001372440.1|  PREDICTED: squalene synthase isoform X1            125   1e-29    
ref|XP_009513193.1|  PREDICTED: squalene synthase                       122   1e-29    
ref|XP_010806000.1|  PREDICTED: squalene synthase isoform X2            124   1e-29    
ref|XP_006115892.1|  PREDICTED: squalene synthase-like                  124   1e-29    
ref|XP_534557.2|  PREDICTED: squalene synthase isoformX1                125   1e-29    
ref|XP_005800260.1|  PREDICTED: squalene synthase-like                  125   1e-29    
ref|XP_010863270.1|  PREDICTED: squalene synthase                       125   1e-29    
ref|XP_006729442.1|  PREDICTED: squalene synthase isoform X1            125   1e-29    
ref|XP_004278741.1|  PREDICTED: squalene synthase                       125   2e-29    
pdb|3WEK|A  Chain A, Crystal Structure Of The Human Squalene Synt...    124   2e-29    
ref|XP_005914533.1|  PREDICTED: squalene synthase-like                  125   2e-29    
ref|NP_001161120.1|  squalene synthase                                  125   2e-29    
ref|XP_010620921.1|  PREDICTED: squalene synthase                       124   2e-29    
ref|XP_005683583.1|  PREDICTED: squalene synthase                       124   2e-29    
ref|XP_005734456.1|  PREDICTED: squalene synthase-like                  124   2e-29    



>ref|XP_009631700.1| PREDICTED: squalene synthase [Nicotiana tomentosiformis]
Length=411

 Score =   309 bits (791),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRL++ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLDVILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>sp|P53800.1|FDFT_NICBE RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Nicotiana benthamiana]
 gb|AAA87048.1| squalene synthetase [Nicotiana benthamiana]
Length=411

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+AL HVEDCLTYMSALRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALPHVEDCLTYMSALRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRT+ DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTIADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRLE+ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLEVILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>ref|XP_009802568.1| PREDICTED: squalene synthase [Nicotiana sylvestris]
Length=411

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRLE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|AAB08578.1| squalene synthase [Nicotiana tabacum]
Length=411

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRLE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|AAY22201.1| squalene synthase [Datura inoxia]
Length=387

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLEELKYEENSV AVQCLNDMVT+ALSHVEDCLTYMS LRDP+IFRFCAI
Sbjct  206  PREIWSKYVNKLEELKYEENSVKAVQCLNDMVTNALSHVEDCLTYMSNLRDPAIFRFCAI  265

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTMEDVYG FFDFSCMLKSKV++
Sbjct  266  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMEDVYGAFFDFSCMLKSKVNN  325

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            N P A+KTLK LE +LKTCRDSGTLNKRKSYI+R+E NY+P LI++ FIILAI+L +LSG
Sbjct  326  NGPNATKTLKGLEAVLKTCRDSGTLNKRKSYIIRSERNYSPVLIVIIFIILAIILAHLSG  385

Query  227  NK  222
            N+
Sbjct  386  NR  387



>gb|AAD20626.1| squalene synthase [Capsicum annuum]
Length=411

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLEELKYEENSV AVQCLNDMVT+ALSHVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PREIWSKYVNKLEELKYEENSVKAVQCLNDMVTNALSHVEDCLIYMSNLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAK IDRTRTM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKAIDRTRTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRLE ILKTCRDSGTLNKRKSY++++EP Y+P LI V FIILAI+L +LSG
Sbjct  349  NDPNATKTLKRLEAILKTCRDSGTLNKRKSYVIKSEPTYSPVLIFVIFIILAIILAHLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>dbj|BAA82093.1| squalene synthase [Solanum tuberosum]
Length=411

 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|AEX26929.1| squalene synthase 1-1 [Solanum tuberosum]
Length=411

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|ADW78251.1| squalene synthase [Withania somnifera]
 gb|ADO22708.1| squalene synthase [Withania somnifera]
Length=413

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYMS LRDP+IFRFC I
Sbjct  231  PREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMSNLRDPAIFRFCGI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTM DVYG FFDFSCMLKSKV++
Sbjct  291  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAFFDFSCMLKSKVNN  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP ++KTLK+LE ILKTCR+SG LNKRKSY++R+EPNY+P LIIV F+ILA++L  LSG
Sbjct  351  NDPNSTKTLKKLEAILKTCRNSGMLNKRKSYVIRSEPNYSPVLIIVIFVILAVILSQLSG  410

Query  227  NK  222
            N+
Sbjct  411  NR  412



>ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum]
 ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum]
Length=411

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTY+  LRDP+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYLFNLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|AEX26930.1| squalene synthase 1-2 [Solanum tuberosum]
Length=411

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMC++NI  FRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCHDNIEAFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>ref|NP_001234716.1| squalene synthase [Solanum lycopersicum]
 gb|ACY25092.1| squalene synthase [Solanum lycopersicum]
Length=411

 Score =   296 bits (759),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM  L DP+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMFNLHDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R EPNY+P
Sbjct  349  NDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRNEPNYSP  389



>gb|AGS57530.1| squalene synthase [Solanum nigrum]
Length=411

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY NKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM  LRDP+IFRFCAI
Sbjct  229  PREIWSKYANKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMYNLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CY+NI +FRGVVKMRRGLTAKVIDRTRT+ DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAICYDNIELFRGVVKMRRGLTAKVIDRTRTIADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRLE ILKTCRDSGTLNKRKSY++++EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLEAILKTCRDSGTLNKRKSYVIKSEPNYSPVLIVVIFIILAIILARLSG  408

Query  227  NK  222
            N+
Sbjct  409  NQ  410



>gb|AEX26932.1| squalene synthase [Solanum chacoense]
Length=411

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKY ENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYVENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVI RT+TM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIGRTKTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSG
Sbjct  349  NDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
 gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
Length=413

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+KVD+
Sbjct  289  PQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KTL RL++ILKTCRDSG LNKRKSYI++ + NYTP
Sbjct  349  NDPNAQKTLSRLDLILKTCRDSGVLNKRKSYIIQNQSNYTP  389



>gb|AGB05603.1| squalene synthase [Camellia oleifera]
Length=414

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK +ENSV AV+CLNDMVT+AL HVEDCLTYMSALRDPSIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKDKENSVKAVECLNDMVTNALIHVEDCLTYMSALRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKV+ 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCMLKSKVNK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A K L RLE I K CR+SGTLNKRKSYI+++EP Y   L+ V FIILAIL  YLS 
Sbjct  349  SDPNAMKALSRLEAIQKICRESGTLNKRKSYIVKSEPRYNSTLVFVLFIILAILFAYLSA  408

Query  227  NKP  219
            N+P
Sbjct  409  NRP  411



>ref|XP_009594336.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=411

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLEELK EENSV AVQCLN+MVT+ALSHVED LTYMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEELKCEENSVKAVQCLNEMVTNALSHVEDSLTYMSTLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA CYNNI VFRGVVKMRRGLTAKVIDRTR M DVYG F+DFSC+LKSKV++
Sbjct  289  PQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAKVIDRTRNMADVYGAFYDFSCILKSKVEY  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
             DP A+KTL+RLE IL+TC+DSGTLNKRKS+++++ PNY  AL++V  +I+AIL  Y SG
Sbjct  349  KDPNAAKTLRRLETILRTCKDSGTLNKRKSFVIQSRPNYNSALVVVLVVIIAILSAYQSG  408

Query  227  NKP  219
            N+P
Sbjct  409  NRP  411



>gb|ACS66750.1| squalene synthase [Glycyrrhiza uralensis]
Length=413

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>ref|XP_011088477.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011088478.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL+HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALTHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG F+DFS MLKSK D 
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTISDVYGAFYDFSRMLKSKADD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A KT + LE ILK CRDSGTLN+RKSYI++++P+Y+P LI+V FIILAILL YLS 
Sbjct  349  NDPNARKTKEFLETILKLCRDSGTLNQRKSYIIQSKPHYSPTLIVVIFIILAILLAYLSA  408

Query  227  NKP  219
             +P
Sbjct  409  ARP  411



>ref|XP_006360639.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=411

 Score =   283 bits (725),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV A+QCLN+MVT++LSHVEDCLT++S LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSVKAIQCLNEMVTNSLSHVEDCLTFLSTLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA CYNNI VFRGVVKMRRGLTA+VIDRTR M DVYG FFDFSC+LKSKV++
Sbjct  289  PQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAQVIDRTRNMADVYGAFFDFSCILKSKVEY  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
             DP  +KTLKRLE+IL+TC++SGTLNKRKS+++++ PNY    ++V  +++AILLGY SG
Sbjct  349  KDPQVAKTLKRLEVILRTCKNSGTLNKRKSFVIKSGPNYNSTFVVVLVVLVAILLGYQSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|KJB32575.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=294

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  111  PRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRFCAI  170

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+KVD 
Sbjct  171  PQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAKVDK  230

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  231  NDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  271



>gb|AAB02945.1| squalene synthase [Nicotiana tabacum]
Length=376

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  734  LEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAIPQIMAIGTLAM  555
            L+ELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRFCAIPQ+MAIGTLAM
Sbjct  205  LQELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRFCAIPQVMAIGTLAM  264

Query  554  CYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKR  375
            CY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG FFDFSCMLKSKV++NDP A+KTLKR
Sbjct  265  CYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAFFDFSCMLKSKVNNNDPNATKTLKR  324

Query  374  LEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSGNK  222
            LE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSGN+
Sbjct  325  LEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSGNR  375



>ref|XP_009759256.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=411

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LK EENSV AVQCLN+MVT+ALSHVED LTYMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKCEENSVKAVQCLNEMVTNALSHVEDSLTYMSTLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA CYNNI VFRGVVKMRRGLTAKVIDRTRTM DVYG F+DFSC+LK+KV++
Sbjct  289  PQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAFYDFSCILKAKVEY  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
             DP A+KTL+RLE IL+TC++SGTLNKRKS+++++ PNY  AL++V  +I+AIL+ YLSG
Sbjct  349  KDPNAAKTLRRLETILRTCKNSGTLNKRKSFVIQSRPNYNSALVVVLVVIIAILIAYLSG  408

Query  227  NKP  219
            N+P
Sbjct  409  NRP  411



>gb|ADG36702.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36710.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36712.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36713.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>ref|XP_004248691.1| PREDICTED: squalene synthase-like [Solanum lycopersicum]
Length=411

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV AVQCLN+MVT+ALSH+EDCLT++S LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSVKAVQCLNEMVTNALSHIEDCLTFLSTLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA CYNNI VFRGVVKMRRGLT +VIDRTR M DVYG FFDFSC+LKSKV+ 
Sbjct  289  PQVMAIGTLAKCYNNIEVFRGVVKMRRGLTTQVIDRTRNMADVYGAFFDFSCILKSKVEF  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
             DP  +KTLKRLE+IL+TC++SGTLNKRKS+++++ PNY    ++V  +++AILLGY SG
Sbjct  349  KDPHVAKTLKRLEVILRTCKNSGTLNKRKSFVIKSGPNYNSTFVVVLVVLVAILLGYQSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|ADG36707.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>emb|CDP20866.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKY+ENS  AV CLNDMVT+AL H EDCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYKENSDKAVHCLNDMVTNALMHAEDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMSDVYGAFFDFSCMLKSKVDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            ND  A KT  RLE ILK CRDSGTLNKRKSYIL +EP + P +I++F ++LAILL YLS 
Sbjct  349  NDLNAKKTKSRLEDILKICRDSGTLNKRKSYILGSEPTFNPTMILIFVVMLAILLAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|AFR77735.1| squalene synthase, partial [Camellia oleifera]
Length=413

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK +ENSV AV+CLNDMVT+AL HVEDCLTYMSALRDPSIFRFCAI
Sbjct  236  PRQIWSKYVNKLEDLKDKENSVKAVECLNDMVTNALIHVEDCLTYMSALRDPSIFRFCAI  295

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYGGFFDFSCMLKSKV+ 
Sbjct  296  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMSDVYGGFFDFSCMLKSKVNK  355

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            +DP A K L RLE I K CR+SGTLNKRKSYI+++EP Y
Sbjct  356  SDPNAMKALSRLEAIQKICRESGTLNKRKSYIIKSEPRY  394



>gb|ADG36709.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNK+E+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKIEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E  Y+  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTYSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|ACN69082.1| squalene synthase [Diospyros kaki]
Length=415

 Score =   281 bits (719),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE+NSV +VQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEKNSVKSVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVID+T+T+ DVYG FFDFSCMLKSKV+ 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDQTKTISDVYGAFFDFSCMLKSKVEK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP ++KTL R+E I KTCR+SGTL+KRKSYILR++  +   LI V FIILAIL  YLS 
Sbjct  349  NDPNSTKTLSRIEAIQKTCRESGTLSKRKSYILRSKRTHNSTLIFVLFIILAILFAYLSA  408

Query  227  NKP  219
            N+P
Sbjct  409  NRP  411



>gb|ADG36705.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   281 bits (718),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P+QIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PQQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|KJB32577.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=388

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  205  PRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRFCAI  264

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+KVD 
Sbjct  265  PQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAKVDK  324

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  325  NDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  365



>gb|KJB32578.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=406

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  223  PRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRFCAI  282

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+KVD 
Sbjct  283  PQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAKVDK  342

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  343  NDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  383



>gb|ADG36708.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNK+E+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKIEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTIADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E  Y+  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTYSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>ref|XP_002313765.1| squalene synthase family protein [Populus trichocarpa]
 gb|EEE87720.1| squalene synthase family protein [Populus trichocarpa]
Length=413

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT++L HV+DCL YMSALR+P+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVEAVQCLNDMVTNSLIHVDDCLKYMSALREPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA++  RT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQIFHRTKTMADVYGAFFDFSCMLKSKVDR  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL  LE + KTCR+SG LNKRKSYILR E  Y   LI++ FIIL+I+  YLS 
Sbjct  349  NDPNATKTLSSLEAVQKTCRESGALNKRKSYILRNELKYNSVLIVLLFIILSIIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera]
 ref|XP_010647676.1| PREDICTED: squalene synthase [Vitis vinifera]
 emb|CBI38008.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LK EENS+ AVQCLNDMVT+AL H+EDCLTYMSAL+ P+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKEEENSIKAVQCLNDMVTNALIHMEDCLTYMSALQSPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+ M DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKAMSDVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+K L RLE + K CR+SG L KRKSY++R+EP Y  ALI+ FFIIL+I+  YLS 
Sbjct  349  NDPNATKALSRLEAVQKICRESGALTKRKSYVIRSEPRYNSALIVAFFIILSIIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|KJB32574.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
 gb|KJB32576.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=412

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+KVD 
Sbjct  289  PQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  349  NDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>gb|AFJ15526.1| squalene synthase [Azadirachta indica]
Length=392

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL+HVEDCL YMSALRDP+IFRFCAI
Sbjct  208  PREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALNHVEDCLKYMSALRDPAIFRFCAI  267

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK IDRT  M DVYG F+DFSCMLK K++ 
Sbjct  268  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKAIDRTNKMADVYGAFYDFSCMLKPKINE  327

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I K C +SG LN+RKSYI++ EP Y   +II+ FIILAI+  YLS 
Sbjct  328  NDPNATKTLSRVEAIQKACMESGLLNRRKSYIIQREPKYNTTMIIMLFIILAIIFAYLSA  387

Query  227  NKPHS  213
            N+P++
Sbjct  388  NRPNN  392



>gb|ADG36704.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   279 bits (713),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|ADG36703.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   279 bits (713),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra]
Length=413

 Score =   279 bits (713),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|KJB12167.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
 gb|KJB12170.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=295

 Score =   275 bits (703),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  111  PRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRFCAI  170

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+KVD 
Sbjct  171  PQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAKVDK  230

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  231  NDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  271



>gb|ACT52826.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36700.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   278 bits (712),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>emb|CAJ77652.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|EYU42585.1| hypothetical protein MIMGU_mgv1a007225mg [Erythranthe guttata]
Length=414

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLEELKYEENSV AV+CLNDMVT++L HVEDCL YM+ALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEELKYEENSVKAVRCLNDMVTNSLIHVEDCLNYMAALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSLMLKSKVDE  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP ASKT +RLE I K CRDSGTL++RKS I++ +P      I + FI+LAI++ YLS 
Sbjct  349  NDPNASKTKERLEAIFKLCRDSGTLSQRKSCIIQNKPQLNATSIALVFIVLAIIVAYLSQ  408

Query  227  NKP  219
            ++P
Sbjct  409  SRP  411



>ref|XP_011047498.1| PREDICTED: squalene synthase isoform X1 [Populus euphratica]
Length=413

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKY+ENSV AVQCLN+MVT++L HV+DCL YMSALR+P+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYDENSVKAVQCLNEMVTNSLIHVDDCLKYMSALREPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA+VI RT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQVIHRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL  LE + KTCR+SG LNKRKSY+LR E  Y   LI++ FIIL+++  YLS 
Sbjct  349  NDPNATKTLSSLEAVQKTCRESGALNKRKSYVLRNELKYNSVLIVLLFIILSVIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|KJB12168.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=313

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  129  PRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRFCAI  188

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+KVD 
Sbjct  189  PQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAKVDK  248

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  249  NDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  289



>gb|ADC95435.1| squalene synthase [Withania somnifera]
Length=411

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM  LRDP+I R   I
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMPNLRDPAICRLRGI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+M IGTLAMCY NI VF     MRRGLTAKVIDRTRTM DVYG FFDFSCMLKSKV++
Sbjct  289  PQVMVIGTLAMCYYNIEVFSRSGSMRRGLTAKVIDRTRTMADVYGAFFDFSCMLKSKVNN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTLKRLE ILKTCR+SGTLNKRKSY++R+EPNY+P LI+V FIILA++L +LSG
Sbjct  349  NDPNATKTLKRLEAILKTCRNSGTLNKRKSYVIRSEPNYSPVLIVVIFIILAVILAHLSG  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|AED99863.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>ref|XP_010066209.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 ref|XP_010066210.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 gb|KCW64053.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64054.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64055.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64056.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
Length=413

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL+HVEDCLTYMSAL DP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALTHVEDCLTYMSALSDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFYDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  288
            NDP A+KTL R+E   K CR+SG LNKRKSYI+ ++  Y+
Sbjct  349  NDPNATKTLSRIEASQKACRNSGLLNKRKSYIIASKSRYS  388



>gb|KHN25422.1| Squalene synthase [Glycine soja]
Length=408

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCLTYM+ALRDP IFRFCAI
Sbjct  224  PRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLTYMAALRDPPIFRFCAI  283

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ KVD 
Sbjct  284  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPKVDK  343

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  YLS 
Sbjct  344  NDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAYLSA  403

Query  227  NKPHS  213
            N  +S
Sbjct  404  NHHNS  408



>gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum]
Length=412

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSAL DP+IFRFCAI
Sbjct  229  PRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALPDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+KVD 
Sbjct  289  PQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  349  NDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>gb|AER23670.1| squalene synthase [Eleutherococcus senticosus]
Length=414

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLENLKYEENSAKAVQCLNDMVTNALLHAEDCLKYMSNLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ ++  +  ALI + FIILAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESKSAHNSALIAIIFIILAILYAYLSS  408

Query  227  NKPHS  213
            N P++
Sbjct  409  NLPNN  413



>ref|XP_011092839.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011092841.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALVHVEDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFS MLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMTDVYGAFYDFSRMLKSKVDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
             DP A KT + LE ILK CRDSGTL++RKSYI++++P Y
Sbjct  349  ADPNAKKTKENLEAILKICRDSGTLSQRKSYIIQSKPQY  387



>ref|XP_008236983.1| PREDICTED: squalene synthase-like [Prunus mume]
Length=412

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YM+ALRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALIHVEDCLKYMAALRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS ++KSKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSIIKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE + KTCR SG L+KRKSYI++ EP+Y   LI+  FIILAI+  YLS 
Sbjct  349  NDPNATKTLSRLEAVQKTCRASGALSKRKSYIVKGEPSYNSTLIVALFIILAIVYAYLSA  408

Query  227  N  225
            +
Sbjct  409  S  409



>gb|ADG36699.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG  +KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLPSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|ADC32654.1| squalene synthase [Aralia elata]
Length=414

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQ WSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQSWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALLHAEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FI+LAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIMLAILYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>emb|CAJ77654.1| squalene synthase 1 [Glycyrrhiza eurycarpa]
Length=413

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408



>ref|XP_007199882.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
 gb|EMJ01081.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
Length=412

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS +LKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSILKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE + KTCR SG L+KRKSYI+R EP++   LI+  FIILAI+  YLS 
Sbjct  349  NDPNATKTLSRLEAVQKTCRASGALSKRKSYIVRGEPSHNSTLIVALFIILAIVYAYLSA  408

Query  227  N  225
            +
Sbjct  409  S  409



>dbj|BAH23428.1| squalene synthetase [Euphorbia tirucalli]
 dbj|BAH23429.1| squalene synthetase [Euphorbia tirucalli]
Length=411

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMSALRDP+IFRFC I
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPAIFRFCGI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRTRTM DVY  FFDFSCM+KSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTRTMADVYRAFFDFSCMMKSKVDR  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A KTL RLE + KTC+DSG LNKRKSYI  + P Y
Sbjct  349  NDPNAEKTLNRLEAVQKTCKDSGMLNKRKSYINGSNPIY  387



>gb|ADD54645.1| squalene synthase [Bruguiera gymnorhiza]
Length=416

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+ WSKYV+KLE+LKYEENSV AVQCLNDMVT++L HV+DCL YMSAL+DP+IFRFCAI
Sbjct  229  PRETWSKYVDKLEDLKYEENSVKAVQCLNDMVTNSLIHVDDCLKYMSALQDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLAMCYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLK+KVD 
Sbjct  289  PQIMAIGTLAMCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKAKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A+KTL RLE I KTCR SG L K KS IL +EP Y  AL  + F+ILAI+  YLS 
Sbjct  349  SDPNATKTLSRLEAIQKTCRASGFLTKSKSRILGSEPRYNSALAALGFLILAIVFVYLSA  408

Query  227  NKP  219
            N+P
Sbjct  409  NRP  411



>gb|KHG07441.1| Squalene synthase [Gossypium arboreum]
Length=412

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLNDM+T+AL HV+DCL YMSAL DP+IFRFCAI
Sbjct  229  PRQIWGKYVNKLEDLKYEENSVKAVQCLNDMITNALIHVDDCLKYMSALPDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRR LTAKVIDRT TM DVYG F+DFSCMLK+KVD 
Sbjct  289  PQVMAIGTLALCYNNIEVFRGVVKMRRSLTAKVIDRTNTMADVYGAFYDFSCMLKAKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP+A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  349  NDPSAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>ref|XP_003537842.1| PREDICTED: squalene synthase-like isoform X1 [Glycine max]
 ref|XP_006590871.1| PREDICTED: squalene synthase-like isoform X2 [Glycine max]
 gb|KHN39832.1| Squalene synthase [Glycine soja]
Length=413

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCLTYM+ALRDP IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLTYMAALRDPPIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTTTMADVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+K L RLE I KTCR+SG L+KRKSYI++ E  Y   +IIV  I+++I+  YLS 
Sbjct  349  NDPNATKALSRLEAIQKTCRESGLLSKRKSYIVKDESGYGSTMIIVLVIMVSIIFSYLSA  408

Query  227  N  225
            +
Sbjct  409  S  409



>gb|KJB12166.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=413

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+KVD 
Sbjct  289  PQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  349  NDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  389



>gb|ACU21003.1| unknown [Glycine max]
Length=413

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRFCAI
Sbjct  229  PRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDPPIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ KVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAYLSA  408

Query  227  NKPHS  213
            N  +S
Sbjct  409  NHHNS  413



>gb|KJB12171.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=412

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  228  PRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRFCAI  287

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+KVD 
Sbjct  288  PQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAKVDK  347

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  348  NDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  388



>gb|KHG01756.1| Squalene synthase [Gossypium arboreum]
Length=413

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKY+ KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYIKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFSC+LK+KVD 
Sbjct  289  PQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMADVYGAFYDFSCILKAKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  288
            NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + +YT
Sbjct  349  NDPNAQKTMSRLDSILKTCRDSGVLNKRKSYIIENQSDYT  388



>ref|XP_004507500.1| PREDICTED: squalene synthase-like [Cicer arietinum]
Length=413

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H ED L YMSALR P+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLKYMSALRHPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTIADVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L KRKSYILR E  Y   +I++  I+ +I   YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGVLTKRKSYILRNENGYGSTMIVILVILFSITYAYLSA  408

Query  227  N  225
            N
Sbjct  409  N  409



>gb|ACV88718.1| squalene synthase [Panax ginseng]
Length=415

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIM+IGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSKVD+
Sbjct  289  PQIMSIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  YLS
Sbjct  349  NDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLS  408

Query  230  GNKPHSV  210
             N P+S+
Sbjct  409  SNLPNSL  415



>ref|XP_010039880.1| PREDICTED: squalene synthase-like isoform X1 [Eucalyptus grandis]
Length=419

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK EENS  AV+CLNDMVT+AL+HVEDCLTYMSAL DPSIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKCEENSEKAVRCLNDMVTNALTHVEDCLTYMSALGDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VF+GVVK+RRGLTAKVIDRTRTM DVYG F+DFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFKGVVKIRRGLTAKVIDRTRTMADVYGAFYDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A+KTL R+EI  K CRD+G  NKRKSYIL +EP Y
Sbjct  349  NDPNATKTLSRIEITQKACRDAGLRNKRKSYILPSEPRY  387



>ref|XP_010039888.1| PREDICTED: squalene synthase-like isoform X2 [Eucalyptus grandis]
Length=414

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK EENS  AV+CLNDMVT+AL+HVEDCLTYMSAL DPSIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKCEENSEKAVRCLNDMVTNALTHVEDCLTYMSALGDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VF+GVVK+RRGLTAKVIDRTRTM DVYG F+DFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFKGVVKIRRGLTAKVIDRTRTMADVYGAFYDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A+KTL R+EI  K CRD+G  NKRKSYIL +EP Y
Sbjct  349  NDPNATKTLSRIEITQKACRDAGLRNKRKSYILPSEPRY  387



>ref|XP_006591920.1| PREDICTED: squalene synthase isoform X2 [Glycine max]
Length=413

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRFCAI
Sbjct  229  PRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDPPIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ KVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAYLSA  408

Query  227  NKPHS  213
            N  +S
Sbjct  409  NHHNS  413



>gb|ACZ71037.1| squalene synthase [Panax ginseng]
Length=415

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSKVD+
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGTFFDFSCMLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LII+ FIILAIL  YLS
Sbjct  349  NDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIIILFIILAILYAYLS  408

Query  230  GNKPHSV  210
             N P+S+
Sbjct  409  SNLPNSL  415



>ref|XP_010109768.1| hypothetical protein L484_008444 [Morus notabilis]
 gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis]
Length=411

 Score =   273 bits (699),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LK EENSV AVQCLNDMVT+AL H+EDCL YMSALR P+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKDEENSVKAVQCLNDMVTNALLHMEDCLKYMSALRHPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLKSKVD 
Sbjct  289  PQVMAIGTLAMCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKSKVDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILR  306
            NDP A KTL RLE I KTCRDSGTLNKRKSY+L+
Sbjct  349  NDPNAKKTLSRLETIQKTCRDSGTLNKRKSYVLK  382



>gb|AFZ93644.1| squalene synthetase [Euphorbia lathyris]
Length=410

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRTRTM DVY  FFDFSCM+KSKVD 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTRTMADVYRAFFDFSCMMKSKVDR  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  297
            NDP A KTL RLE + KTC++SG LNKR+SYI  ++P
Sbjct  349  NDPNAEKTLNRLEAVQKTCKESGLLNKRRSYINESKP  385



>ref|XP_010263865.1| PREDICTED: squalene synthase-like [Nelumbo nucifera]
Length=415

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKY+ENS+ AV+CLNDM+T+AL HVEDCL YMSALRDP++FRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYDENSIKAVECLNDMITNALLHVEDCLKYMSALRDPAVFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT+A+CYNNI VF+GVVKMRRGLTAKVIDRT++M DVYG FFDFSC+LK KV+ 
Sbjct  289  PQIMAIGTIALCYNNIEVFKGVVKMRRGLTAKVIDRTKSMSDVYGAFFDFSCLLKMKVEK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I KTCR+SG LNKR SY++ ++P+Y    II  FI+L+I L +LS 
Sbjct  349  NDPNATKTLSRIEAIQKTCRNSGLLNKRSSYMVESKPSYNSVAIIAVFILLSIFLAFLST  408

Query  227  NKP-HS  213
             +P HS
Sbjct  409  KQPIHS  414



>gb|AIK21786.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVRCLNDMVTNALVHAEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>gb|KDP41726.1| hypothetical protein JCGZ_26744 [Jatropha curcas]
Length=413

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS+ AV+CLNDMVT+AL HV+DCL YMSALRDP+IFRFC I
Sbjct  229  PRQIWSKYVDKLEDLKYEENSLKAVRCLNDMVTNALMHVDDCLKYMSALRDPAIFRFCVI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVI +T++M DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIYQTKSMADVYGAFFDFSCMLKSKVDM  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A KTL RLE I K C++SG LNKRKSYI R++P Y  ALI++ F+IL+I+  YLS 
Sbjct  349  SDPNAEKTLSRLEGIQKACQESGLLNKRKSYINRSKPRYNSALIVLLFVILSIVFSYLSA  408

Query  227  NKP  219
            N+P
Sbjct  409  NRP  411



>dbj|BAA24289.1| squalene synthase [Panax ginseng]
 dbj|BAD08242.1| squalene synthase [Panax ginseng]
Length=415

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS LR P+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMSDLRGPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVID+T+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
 gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
Length=412

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P QIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMSALRDPSIFRFCAI
Sbjct  229  PHQIWSKYVTKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFSCMLKSKV+ 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFYDFSCMLKSKVEM  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A KTL RLE + K+CR+SG L++R+SYI R+EP     ++++ FIIL+I+  YLS 
Sbjct  349  NDPNAEKTLSRLEALQKSCRESGLLSRRRSYI-RSEPRINSVIVVLLFIILSIIFAYLSA  407

Query  227  NKP  219
            N+P
Sbjct  408  NRP  410



>gb|AFT92039.1| squalene synthase [Euphorbia pekinensis]
Length=411

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEE+SV AVQCLNDMVT+AL H++DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEEDSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKV+DRTRTM DVY  FFDFSCM+KSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVVDRTRTMADVYRAFFDFSCMMKSKVDR  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A KTL RLE + KTC++SG LNKRKSY+  ++P Y
Sbjct  349  NDPNAEKTLNRLEAVQKTCKESGLLNKRKSYVNGSKPYY  387



>gb|ABA29019.1| squalene synthase [Panax notoginseng]
 gb|AGS79226.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVRCLNDMVTNALVHAEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT TM DVYG FFDFSCMLKSKVD+
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKLRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KTL RLE I K+C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  YLS
Sbjct  349  NDPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLS  408

Query  230  GNKPHSV  210
             + P+S+
Sbjct  409  SSLPNSL  415



>emb|CAJ58418.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI++IGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSKVD+
Sbjct  289  PQIVSIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  YLS
Sbjct  349  NDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLS  408

Query  230  GNKPHSV  210
             N P+S+
Sbjct  409  SNLPNSL  415



>ref|NP_001236365.1| squalene synthase [Glycine max]
 dbj|BAA22559.1| squalene synthase [Glycine max]
Length=413

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRFCAI
Sbjct  229  PRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHPEDCLKYMAALRDPPIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ KVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAYLSA  408

Query  227  NKPHS  213
            N  +S
Sbjct  409  NHHNS  413



>ref|XP_002305455.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
 gb|EEE85966.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
Length=476

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H++DCL Y+S LRDP+IFRFCAI
Sbjct  292  PREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYLSELRDPAIFRFCAI  351

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VI +T+TM+DVYG FFDFSCMLK KVD+
Sbjct  352  PQIMAIGTLALCYNNVNVFRGVVKMRRGLTAQVIHQTKTMDDVYGAFFDFSCMLKFKVDN  411

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A KTL RLE   K+CR+SG LNKRKSYI+R EP Y   LI++ FIIL+I+  YLS 
Sbjct  412  SDPNAIKTLSRLEAAQKSCRESGALNKRKSYIIRNEPKYNSVLIVLLFIILSIIFAYLSA  471

Query  227  NK  222
            N+
Sbjct  472  NR  473



>ref|XP_009376518.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=412

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS +LKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSILKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E + K CRDSG L+KRKSYI   E +Y+  LI+  FIILAI+  YLS 
Sbjct  349  NDPNATKTLSRVEAVQKLCRDSGALSKRKSYIANHEQSYSSTLIVALFIILAIIYAYLSA  408

Query  227  N  225
            +
Sbjct  409  S  409



>gb|EYU37850.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=414

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK+EENSV AVQCLNDMVT+AL H+EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKHEENSVKAVQCLNDMVTNALIHIEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK K+D 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSRMLKYKIDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A KT   LE +LK CRDSGTLN+RKSYI++++P     +I++FFIILAILL YLS 
Sbjct  349  SDPNARKTKDSLEAVLKICRDSGTLNQRKSYIIQSKPQINATVIVIFFIILAILLAYLSA  408

Query  227  NKPHSV  210
            ++P ++
Sbjct  409  SRPSNI  414



>gb|ADG36701.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            ND  A+KTL RLE I KTCR+SG  +KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  349  NDLNATKTLSRLEAIQKTCRESGLSSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|ADV57358.1| squalene synthase [Astragalus membranaceus]
Length=405

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLEELKYEENSV AVQCLNDM+T+AL H EDCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEELKYEENSVEAVQCLNDMITNALIHAEDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+ KVD 
Sbjct  289  PQIMAIGTLALCYNNIVVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASLLECKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A+KTL RLE I K CR+SG L+KRKSY+LR+   Y
Sbjct  349  NDPNATKTLSRLEAIQKNCRESGLLSKRKSYVLRSADTY  387



>gb|ADW27427.1| squalene synthase [Astragalus membranaceus]
Length=413

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLEELKYEENSV AVQCLNDM+T+AL H EDCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEELKYEENSVEAVQCLNDMITNALIHAEDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+ KVD 
Sbjct  289  PQIMAIGTLALCYNNIVVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASLLECKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A+KTL RLE I K CR+SG L+KRKSY+LR+   Y
Sbjct  349  NDPNATKTLSRLEAIQKNCRESGLLSKRKSYVLRSADTY  387



>gb|ACA66014.1| squalene synthase [Panax ginseng]
Length=415

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS LR P++FRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMSDLRGPAVFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVID+T+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>gb|ADX01171.1| putative squalene synthase [Bacopa monnieri]
Length=414

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDC+ YMSAL DP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHVEDCIKYMSALGDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS MLKSKV+ 
Sbjct  289  PQVMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKSMADVYGAFYDFSRMLKSKVED  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A KT  RLE ILK CR+SGTLN+RKSYI++++P      I++ FII+AILL YLS 
Sbjct  349  SDPNARKTKDRLEAILKICRESGTLNQRKSYIIQSKPQNYATSIVIIFIIIAILLAYLSA  408

Query  227  NKP  219
             +P
Sbjct  409  TRP  411



>emb|CAD23250.1| farnesyl-diphosphate farnesyltransferase [Medicago truncatula]
 gb|AES89237.2| squalene synthase [Medicago truncatula]
Length=413

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL H +DCL YMSALRD S FRFCAI
Sbjct  229  PRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHADDCLQYMSALRDSSNFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SKVD 
Sbjct  289  PQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++  I+ +I+  YLS 
Sbjct  349  NDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLLVILFSIIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>dbj|BAC56854.1| squalene synthase [Lotus japonicus]
Length=413

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS LRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMSDLRDDSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+T+ DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLAICYNNVEVFRGVVKMRRGLTAKVIDRTKTIADVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A+KTL RL  I KTCR+SG LNKRKSYILR E  Y
Sbjct  349  NDPNATKTLSRLVAIQKTCRESGLLNKRKSYILRKENGY  387



>emb|CAJ58419.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P QIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PCQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSKVD+
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  YLS
Sbjct  349  NDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLS  408

Query  230  GNKPHSV  210
             N P+S+
Sbjct  409  SNLPNSL  415



>gb|AGS78117.1| squalene synthase 1 [Malus domestica]
Length=412

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS +LKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSILKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E + K CRDSG L+KRKSYI   E +Y   LI+  FIILAI+  YLS 
Sbjct  349  NDPNATKTLSRVEAVQKLCRDSGALSKRKSYIANREQSYNSTLIVALFIILAIIYAYLSA  408

Query  227  N  225
            +
Sbjct  409  S  409



>gb|AFK36923.1| unknown [Medicago truncatula]
Length=413

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL H  DCL YMSALRD S FRFCAI
Sbjct  229  PRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHAGDCLQYMSALRDSSNFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SKVD 
Sbjct  289  PQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++  I+ +I+  YLS 
Sbjct  349  NDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLLVILFSIIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|AGI19256.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+L YEENS  AV+CLNDMVT+AL H EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLXYEENSAKAVRCLNDMVTNALVHAEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSKVD+
Sbjct  289  PQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>gb|ACQ90302.1| squalene synthase [Gynostemma pentaphyllum]
Length=417

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV AV CLNDMVT+AL HVEDCL YMS L+D SIFRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSVKAVHCLNDMVTNALIHVEDCLIYMSNLKDLSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+KV  
Sbjct  289  PQIMAIGTLAICYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSVMLKAKVKR  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A+KTL RLE I KTC+ SG LNKRK Y++R+EP Y P LI++ F +L I+L YLS 
Sbjct  349  SDPNATKTLSRLEAIQKTCQQSGLLNKRKLYVVRSEPIYNPTLIVIIFSLLCIILAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWS YV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSIYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT TM DVYG FFDFSCMLKSKVD+
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKLRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KTL RLE I K+C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  YLS
Sbjct  349  NDPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLS  408

Query  230  GNKPHSV  210
             + P+S+
Sbjct  409  SSLPNSL  415



>gb|ACX42423.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+KVDH
Sbjct  289  PQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDH  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP+A  TL RLE I +TC++SGTL KRKSYIL  E  Y   LI + FIILA    YLS 
Sbjct  349  DDPSAKITLSRLEAIQQTCKNSGTLTKRKSYILENESRYNSVLIAIIFIILAFFYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>ref|XP_011037190.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=413

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LK+E NSV AVQCLNDMVT+AL H++DCL Y+S LRDP+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKHEGNSVKAVQCLNDMVTNALIHMDDCLKYLSELRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLAMCYNN+ VFRGVVKMRRGLTA+V+ +T+TM+DVYG FFDFSCMLKSKVD+
Sbjct  289  PQIMAIGTLAMCYNNVNVFRGVVKMRRGLTAQVLHQTKTMDDVYGAFFDFSCMLKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A KTL RLE   K+CR+SG LNKRKSYI+R E  Y   LI++ F++L+I+  YLS 
Sbjct  349  SDPNAIKTLSRLEAAQKSCRESGALNKRKSYIIRNEAKYNSVLIVLLFVLLSIIFAYLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>gb|ADG36706.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE NSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYE-NSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  287

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  288  PQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  347

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  348  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  407

Query  227  NK  222
             +
Sbjct  408  KR  409



>gb|ADG36711.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE NSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYE-NSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRFCAI  287

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSKVD 
Sbjct  288  PQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSKVDK  347

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  YLS 
Sbjct  348  NDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAYLSA  407

Query  227  NK  222
             +
Sbjct  408  KR  409



>ref|XP_003607040.1| Squalene synthase [Medicago truncatula]
Length=423

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL H +DCL YMSALRD S FRFCAI
Sbjct  229  PRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHADDCLQYMSALRDSSNFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SKVD 
Sbjct  289  PQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++  I+ +I+  YLS
Sbjct  349  NDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLLVILFSIIFAYLS  407



>emb|CAN81937.1| hypothetical protein VITISV_028001 [Vitis vinifera]
Length=431

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 158/200 (79%), Gaps = 18/200 (9%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LK EENS+ AVQCLNDMVT+AL H+EDCLTYMSAL+ P+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKEEENSIKAVQCLNDMVTNALIHMEDCLTYMSALQSPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKS----  420
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+ M DVYG FFDFSCMLKS    
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKAMSDVYGAFFDFSCMLKSKXRR  348

Query  419  --------------KVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPa  282
                          KVD NDP A+K L RLE + K CR+SG L KRKSY++R+EP Y  A
Sbjct  349  LFICTIRDALASKEKVDKNDPNATKALSRLEAVQKICRESGALTKRKSYVIRSEPRYNSA  408

Query  281  liivffiilailLGYLSGNK  222
            LI+ FFIIL+I+  YLS N+
Sbjct  409  LIVAFFIILSIIFAYLSANR  428



>ref|XP_006591919.1| PREDICTED: squalene synthase isoform X1 [Glycine max]
Length=451

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRFCAI
Sbjct  229  PRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDPPIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ KVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGY  387



>ref|XP_009378420.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=410

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VF+GVVKMRRGLTAKVIDRT++M+DVYG FFDF+ ++KSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFKGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFASVIKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  288
            NDP A+KTL R+E + K CRDSG L+KRKSYI+  E N T
Sbjct  349  NDPHATKTLSRVEAVQKLCRDSGALSKRKSYIINNEQNST  388



>ref|XP_008461009.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461010.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461011.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461012.1| PREDICTED: squalene synthase-like [Cucumis melo]
Length=417

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS LRD SIFRFCAI
Sbjct  229  PREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMSNLRDLSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+KV+ 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSVMLKAKVNS  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP ASKTL R+E I +TC+ SG +NKRK Y++R+EP Y PA+I++ F +L I+L YLS 
Sbjct  349  NDPNASKTLSRIEAIQQTCQQSGLMNKRKLYVVRSEPMYNPAVIVILFSLLCIILAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|ACX42425.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+KVDH
Sbjct  289  PQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDH  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP+A  TL RLE I +TC++SGTL KR SYIL  E  Y   LI + FIILA    YLS 
Sbjct  349  DDPSAKITLSRLEAIQQTCKNSGTLTKRNSYILENESRYNSVLIAIIFIILAFFYAYLSS  408

Query  227  N  225
            N
Sbjct  409  N  409



>ref|XP_004150142.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 ref|XP_004167323.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 gb|KGN61845.1| hypothetical protein Csa_2G251460 [Cucumis sativus]
Length=417

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS LRD SIFRFCAI
Sbjct  229  PREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMSNLRDLSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+KV+ 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSVMLKAKVNS  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP ASKTL R+E I KTC+ SG LN+RK Y++R+EP + PA+I++ F +L I+L YLS 
Sbjct  349  NDPNASKTLSRIEAIQKTCKQSGILNRRKLYVVRSEPMFNPAVIVILFSLLCIILAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>gb|AAR20329.1| squalene synthase [Artemisia annua]
Length=418

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YMS L+DP+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHIEDCLKYMSQLKDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F DFS MLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAFSDFSDMLKSKVDM  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + F ILAIL  YLS 
Sbjct  349  HDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALLFTILAILYAYLSA  408

Query  227  NKPHSV  210
            N+P+ +
Sbjct  409  NRPNKI  414



>gb|ACS66749.1| squalene synthase [Glycyrrhiza uralensis]
 gb|ADG36715.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36716.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36720.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36722.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36723.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36724.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+   I+  I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFLVILFGIMFAYLSA  407

Query  227  NKPHS  213
            N+ ++
Sbjct  408  NRQNN  412



>gb|ADG36717.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36718.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+   I+  I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFLVILFGIMFAYLSA  407

Query  227  NKPHS  213
            N+ ++
Sbjct  408  NRQNN  412



>dbj|BAA13084.1| squalene synthase [Glycyrrhiza glabra]
Length=412

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMGDVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++  I+  I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILILVILFGIMFAYLSA  407

Query  227  N  225
            N
Sbjct  408  N  408



>gb|KDO43891.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=213

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRFCAI
Sbjct  29   PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRFCAI  88

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  89   PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  148

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++FFIILAI+  YLS 
Sbjct  149  NDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIFFIILAIIFSYLSS  208

Query  227  NK  222
             +
Sbjct  209  TR  210



>gb|AFI33135.3| squalene synthase [Eriobotrya japonica]
 gb|AGU36305.1| squalene synthase [Eriobotrya japonica]
Length=412

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTA+VIDRT++M+DVYG FFDFS +L SKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAEVIDRTKSMDDVYGAFFDFSSILNSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+K+L R+E + K CRDSG L+KRKSYI   E +Y   LI+  FIILAI+  Y S 
Sbjct  349  NDPNATKSLSRVEAVQKLCRDSGALSKRKSYIANREQSYNSTLIVALFIILAIIYAYFSA  408

Query  227  N  225
            +
Sbjct  409  S  409



>gb|ADG36719.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36721.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++  I+  I+  +LS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILILVILFGIMFAHLSA  407

Query  227  NKPHS  213
            N+ ++
Sbjct  408  NRQNN  412



>gb|AAR20328.1| squalene synthase [Artemisia annua]
Length=413

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YMS L+DP+IFRFCAI
Sbjct  228  PREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHIEDCLKYMSQLKDPAIFRFCAI  287

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F DFS MLKSKVD 
Sbjct  288  PQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAFSDFSDMLKSKVDM  347

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + F ILAIL  YLS 
Sbjct  348  HDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALLFTILAILYAYLSA  407

Query  227  NKP  219
            N+P
Sbjct  408  NRP  410



>ref|XP_007131767.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 ref|XP_007131768.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03761.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03762.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
Length=413

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H ED L YM+ALRD SIFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLIYMAALRDSSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RL  I K+CR+SG L+KRKS+I++ E  Y   +I++  I+++I+  YLS 
Sbjct  349  NDPNATKTLSRLVAIQKSCRESGLLSKRKSFIVKNENGYGSFMIVMLVIMVSIIFAYLSA  408

Query  227  N  225
            N
Sbjct  409  N  409



>gb|AAY46017.1| squalene synthase [Bupleurum falcatum]
Length=415

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+KVDH
Sbjct  289  PQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDH  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliivffiilailLGYLS  231
            +DP+A  TL RLE I +TC++SGTL K RKSYIL  E  Y   LI + FIILA    YLS
Sbjct  349  DDPSAKITLSRLEAIQQTCKNSGTLTKSRKSYILENESRYNSVLIAIIFIILAFFYAYLS  408

Query  230  GN  225
             N
Sbjct  409  SN  410



>gb|KJB12169.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=427

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 143/175 (82%), Gaps = 14/175 (8%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  229  PRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRR--------------GLTAKVIDRTRTMEDVYGG  450
            PQIMAIGTLA+CYNNI VFRGVVKMRR              GLTAKVIDRT++M DVYG 
Sbjct  289  PQIMAIGTLALCYNNIKVFRGVVKMRRVFQVDVHFISASFPGLTAKVIDRTKSMTDVYGA  348

Query  449  FFDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            F+DFS +LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  349  FYDFSYILKAKVDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  403



>gb|AHA84150.1| squalene synthase [Phaseolus vulgaris]
Length=413

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H ED L YMSALRD SIFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLIYMSALRDSSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RL  I K+CR+SG L+KRKS+I++ E  Y   +I++  I+++I+  YL  
Sbjct  349  NDPNATKTLSRLVAIQKSCRESGLLSKRKSFIVKNENGYGSFMIVMLVIMVSIIFAYLFA  408

Query  227  NKPHS  213
            N PH+
Sbjct  409  N-PHN  412



>emb|CAJ77653.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++  I+  I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILILVILFGIMFAYLSA  407

Query  227  N  225
            N
Sbjct  408  N  408



>gb|ABQ96265.1| squalene synthase [Psammosilene tunicoides]
Length=414

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLEELKYE+NS  AVQCLNDMVT+AL HVED LTYMSALRD +IFRFCAI
Sbjct  229  PREIWSKYVDKLEELKYEQNSEKAVQCLNDMVTNALLHVEDSLTYMSALRDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTA VI++T +M DVYG FFDF+CMLK KVD 
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAIVIEQTNSMADVYGAFFDFACMLKPKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
             DP A+KTL R+E I K CRDSGTLNKRK Y+++++P  TP
Sbjct  349  RDPNATKTLSRIEAIQKICRDSGTLNKRKLYVVKSKPGLTP  389



>emb|CDX72493.1| BnaC07g45150D [Brassica napus]
Length=426

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY  KLE+LKYE+NS NAVQCLN+MVTDAL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  240  PRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTDALTHIEDCLKYMAALRDPSIFRFCAI  299

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  300  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  359

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  360  NDPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  391



>ref|NP_001280921.1| squalene synthase-like [Malus domestica]
 ref|XP_008382334.1| PREDICTED: squalene synthase-like [Malus domestica]
 gb|AGS78118.1| squalene synthase 2 [Malus domestica]
Length=410

 Score =   263 bits (673),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++++DVYG FFDF+ ++KSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSIDDVYGAFFDFASVIKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  288
            ND  A+KTL R+E + K CRDSG L+KRKSYI+  E N T
Sbjct  349  NDLHATKTLSRVEAVQKLCRDSGALSKRKSYIINNEQNST  388



>gb|ACX42426.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+KVDH
Sbjct  289  PQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAKVDH  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliivffiilailLGYLS  231
            +DP+A  TL RLE I +TC++SGTL K R SYIL  E  Y   LI + FIILA    YLS
Sbjct  349  DDPSAKITLSRLEAIQQTCKNSGTLTKSRNSYILENESRYNSVLIAIIFIILAFFYAYLS  408

Query  230  GN  225
             N
Sbjct  409  SN  410



>gb|AFK29284.1| putative squalene synthase 2 [Salvia miltiorrhiza]
 gb|AGE45641.1| squalene synthase 2 [Salvia miltiorrhiza]
 gb|AJR21118.1| squalene synthase 2 [Salvia miltiorrhiza]
Length=414

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY NKLE+LKYEENSV AV CLNDMVT+AL HVEDCL YM ALRDP+IFRFCAI
Sbjct  229  PREIWSKYANKLEDLKYEENSVKAVHCLNDMVTNALIHVEDCLNYMLALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFS MLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFYDFSLMLKSKVDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
             DP A KT   LE +LK CRDSG L +R SYI++ +P Y
Sbjct  349  ADPNARKTKANLEKVLKLCRDSGALGQRNSYIIQRKPQY  387



>gb|ACT52825.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36714.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM  VYG FFDF+ ML+SKVD 
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMAGVYGAFFDFASMLESKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+   I+  I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFLVILFGIMFAYLSA  407

Query  227  NKPHS  213
            N+ ++
Sbjct  408  NRQNN  412



>gb|AFK29283.1| putative squalene synthase 1 [Salvia miltiorrhiza]
 gb|AFV13322.1| putative squalene synthase 1 [Salvia miltiorrhiza]
Length=413

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK +ENSV AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKSQENSVKAVQCLNDMVTNALVHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CY+NI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK KVD 
Sbjct  289  PQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSRMLKFKVDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
             DP A  T  RL+ ILK CRDSGTLN+RKSYI+ + P Y
Sbjct  349  KDPNAGTTKDRLDSILKICRDSGTLNERKSYIIESGPQY  387



>ref|XP_006412201.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 ref|XP_006412202.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53654.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53655.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
Length=409

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  AV CLNDMVT+AL H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PRKIWGKYADKLEDLKYEENSTKAVHCLNDMVTNALIHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFSCMLK KVD 
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKMRRGLTAKVIDRTKTMADVYGAFYDFSCMLKIKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP ASKTL RLE + K CRD+G L++RKSY+
Sbjct  351  NDPNASKTLNRLEAVQKVCRDTGVLHQRKSYV  382



>gb|AAV58897.1| squalene synthase [Centella asiatica]
Length=415

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW+KYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRKIWNKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT  M DVYG F+DFSCMLK+KVD+
Sbjct  289  PQIMAIGTLALCYNNLQVFRGVVKMRRGLTAKVIDRTNKMSDVYGAFYDFSCMLKTKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLN-KRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+KTL RLE I K C++SG +   RKSY+L  +  Y   LI + FIILA++  YLS
Sbjct  349  NDPNATKTLSRLEAIQKKCKESGVITPNRKSYVLENDSGYNLVLIAILFIILALVYAYLS  408

Query  230  GN  225
             N
Sbjct  409  SN  410



>ref|XP_006487315.1| PREDICTED: squalene synthase isoform X2 [Citrus sinensis]
 gb|KDO43890.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=295

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRFCAI
Sbjct  111  PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRFCAI  170

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  171  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  230

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++FFIILAI+  YLS 
Sbjct  231  NDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIFFIILAIIFSYLSS  290

Query  227  NKP  219
             + 
Sbjct  291  TRA  293



>ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
 gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
Length=414

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  +VQCLN+MVT+AL H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PREIWGKYADKLEDLKYEENSTKSVQCLNEMVTNALMHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  294
            NDP  SKTL RLE + K CRDSG LN RKSY+  + +PN
Sbjct  351  NDPNGSKTLNRLEAVQKLCRDSGVLNNRKSYVDDKGQPN  389



>emb|CAJ77655.1| squalene synthase 2 [Glycyrrhiza eurycarpa]
Length=412

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 148/181 (82%), Gaps = 1/181 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SKV  
Sbjct  289  PQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESKVVK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   + +   I+  I+  YLS 
Sbjct  349  NDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMTLFLVIVFGIMFAYLSA  407

Query  227  N  225
            N
Sbjct  408  N  408



>ref|XP_010548076.1| PREDICTED: squalene synthase-like isoform X2 [Tarenaya hassleriana]
Length=415

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL+H+EDC+ YM++LRDP+IFRFCAI
Sbjct  231  PRQIWSKYVDKLEDLKYEENSTKAVQCLNDMVTNALTHIEDCVKYMASLRDPAIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT+A+CYNNI VFRGVVKMRRGLTAKV+DRT TM DVYG F+ FS +LK+KVD 
Sbjct  291  PQIMAIGTIALCYNNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAFYSFSRLLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL +LE + K CR+SG L+KRKSY+   +P + P  + +  I+L+I+  YL  
Sbjct  351  NDPNATKTLNQLEAVQKVCRESGMLHKRKSYVDDDKPQFNPLYVAILVILLSIVFAYLKA  410

Query  227  NK  222
            N+
Sbjct  411  NQ  412



>gb|ABG66304.1| squalene synthase [Polygala tenuifolia]
Length=413

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK+EENS  AVQCLNDMVT+AL H EDCL Y+SAL+D +IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKHEENSDKAVQCLNDMVTNALMHAEDCLKYVSALKDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVI +T TM DVYG F+DFSCMLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNVQVFRGVVKMRRGLTAKVIHQTNTMADVYGAFYDFSCMLKSKVDR  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL RLE I +TC DS  +NKRKS++   +P Y+ +++I+ FI+LAI+L YL+ 
Sbjct  349  NDPNATKTLSRLESIQRTCLDSRLINKRKSFVNEGQPTYSSSMVIILFIVLAIILAYLTA  408

Query  227  NKPHS  213
            N  +S
Sbjct  409  NPLNS  413



>gb|AEM42980.1| squalene synthase [Siraitia grosvenorii]
Length=417

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS LRD SIFRFCAI
Sbjct  229  PREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMSNLRDLSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+KV+ 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTQTMADVYGAFFDFSVMLKAKVNS  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A+KTL R+E I KTC  SG LNKRK Y +++EP + P LI++ F +L I+L YLS 
Sbjct  349  SDPNATKTLSRIEAIQKTCEQSGLLNKRKLYAVKSEPMFNPTLIVILFSLLCIILAYLSA  408

Query  227  NK  222
             +
Sbjct  409  KR  410



>emb|CDY17472.1| BnaC03g65910D [Brassica napus]
Length=426

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  247  PRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLKYMAALRDPSIFRFCAI  306

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  307  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  366

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP AS TL RLE + K CRD+G L+KRKSYI
Sbjct  367  NDPNASMTLNRLEAVQKVCRDTGVLHKRKSYI  398



>gb|ACR57219.1| squalene synthase [Salvia miltiorrhiza]
Length=413

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK +ENSV AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKSQENSVKAVQCLNDMVTNALVHVEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CY+NI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK KVD 
Sbjct  289  PQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKIIDRTKTMFDVYGAFYDFSRMLKFKVDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
             DP A  T  RL+ ILK CRDSGTLN RKSYI+ + P Y
Sbjct  349  KDPNAGTTKDRLDSILKICRDSGTLNDRKSYIIESGPQY  387



>emb|CDY45322.1| BnaA03g52950D [Brassica napus]
Length=407

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY  KLE+LKYE+NS NAVQCLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  221  PRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTNALTHIEDCLKYMAALRDPSIFRFCAI  280

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  281  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  340

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            N+P ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  341  NEPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  372



>ref|XP_009138312.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138313.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138314.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=417

 Score =   260 bits (665),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY  KLE+LKYE+NS NAVQCLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTNALTHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            N+P ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  351  NEPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  382



>ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  +VQCLN+MVT+AL H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PREIWGKYADKLEDLKYEENSTKSVQCLNEMVTNALIHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD+
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDN  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  294
            NDP ASKTL RLE + K C+D+G L+ RKSY+  + +PN
Sbjct  351  NDPNASKTLNRLEAVQKLCKDTGVLHNRKSYVNDKGQPN  389



>ref|XP_011458278.1| PREDICTED: squalene synthase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT++L H+EDCL YMS LRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNSLLHIEDCLKYMSDLRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAK+ID+TRTM DVY  F+DFS ++KSKVD 
Sbjct  289  PQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDKTRTMADVYAAFYDFSSIIKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
             DP A+KTL RLE + KTCR+SG L  RKSYI+++E ++
Sbjct  349  KDPNATKTLSRLESVQKTCRESGALTNRKSYIIKSEQSF  387



>ref|XP_009108714.1| PREDICTED: squalene synthase-like isoform X1 [Brassica rapa]
 ref|XP_009108715.1| PREDICTED: squalene synthase-like isoform X2 [Brassica rapa]
Length=410

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLNYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP AS TL RL+ + K CRD+G L+KRKSYI
Sbjct  351  NDPNASMTLNRLDAVQKVCRDTGVLHKRKSYI  382



>gb|AAG14896.2|AF302464_1 squalene synthase [Artemisia annua]
 gb|AAK92539.1|AF405310_1 squalene synthase [Artemisia annua]
Length=418

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+I SKYVNKLE+LKYEE+S  AVQCLNDMVT+AL H+EDCL YMS L+DP+IFRFCAI
Sbjct  229  PREIRSKYVNKLEDLKYEEDSEKAVQCLNDMVTNALIHIEDCLKYMSQLKDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F DFS MLKSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAFSDFSDMLKSKVDM  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + F ILAIL  YLS 
Sbjct  349  HDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALLFTILAILYAYLSA  408

Query  227  NKPHSV  210
            N+P+ +
Sbjct  409  NRPNKI  414



>emb|CDX69075.1| BnaC01g03780D [Brassica napus]
Length=398

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  220  PRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMAALRDPSIFRFCAI  279

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  280  PQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  339

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP AS TL RLE + K CRD+G L KRKSY+
Sbjct  340  NDPNASNTLNRLEAMQKVCRDTGVLQKRKSYV  371



>ref|XP_010432389.1| PREDICTED: squalene synthase [Camelina sativa]
Length=410

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDR  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  294
            NDP ASKTL RLE + K C D+G LN RKSY+  + +PN
Sbjct  351  NDPNASKTLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  389



>gb|KFK30097.1| hypothetical protein AALP_AA7G216600 [Arabis alpina]
Length=412

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL H+EDCL YM ALRDPSIFRFCAI
Sbjct  231  PRKIWGKYAGKLEDLKYEENSTKAVHCLNEMVTNALMHIEDCLKYMVALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  294
            +DP ASKTL R+E + K CRD+G L KRKSY+  + +PN
Sbjct  351  DDPNASKTLNRIEAVQKICRDTGVLQKRKSYVNDKGQPN  389



>gb|ACX42424.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP  FRFCAI
Sbjct  229  PRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPGNFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
             QIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVY  FFDFSC+LK+KVDH
Sbjct  289  SQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYDAFFDFSCLLKAKVDH  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliivffiilailLGYLS  231
            +DP+A  TL RLE I +TC++SGTL K RKSYIL  E  Y   LI + FIILA    YLS
Sbjct  349  DDPSAKITLSRLEAIQQTCKNSGTLTKSRKSYILENESRYNSVLIAIIFIILAFFYAYLS  408

Query  230  GN  225
             N
Sbjct  409  SN  410



>emb|CDX75450.1| BnaA01g02520D [Brassica napus]
Length=398

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  220  PRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMAALRDPSIFRFCAI  279

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  280  PQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  339

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP AS TL RLE + K C+D+G L KRKSY+
Sbjct  340  NDPNASNTLNRLEAVEKVCKDTGVLQKRKSYV  371



>ref|XP_004290304.1| PREDICTED: squalene synthase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   258 bits (659),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT++L H+EDCL YMS LRDP+IF+FCAI
Sbjct  229  PRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNSLLHIEDCLKYMSDLRDPAIFKFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAK+ID+TRTM DVY  F+DFS ++KSKVD 
Sbjct  289  PQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDKTRTMADVYAAFYDFSSIIKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNY  291
             DP A+KTL RLE + KTCR+SG L N RKSYI+++E ++
Sbjct  349  KDPNATKTLSRLESVQKTCRESGALTNSRKSYIIKSEQSF  388



>ref|XP_006423444.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36684.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=267

 Score =   253 bits (646),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRD +IFRFCAI
Sbjct  83   PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSVLRDHAIFRFCAI  142

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  143  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  202

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++FFIILAI+  YLS 
Sbjct  203  NDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIFFIILAIIFSYLSS  262

Query  227  NK  222
             +
Sbjct  263  TR  264



>emb|CDX76294.1| BnaA08g11060D [Brassica napus]
Length=400

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  220  PRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLNYMAALRDPSIFRFCAI  279

Query  587  PQ-IMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVD  411
            PQ IMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD
Sbjct  280  PQQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVD  339

Query  410  HNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
             NDP AS TL RLE + K CRD+G L+KRKSYI
Sbjct  340  KNDPNASMTLNRLEAVQKVCRDTGVLHKRKSYI  372



>ref|XP_006487314.1| PREDICTED: squalene synthase isoform X1 [Citrus sinensis]
 gb|KDO43888.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43889.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=413

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++FFIILAI+  YLS 
Sbjct  349  NDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIFFIILAIIFSYLSS  408

Query  227  NK  222
             +
Sbjct  409  TR  410



>ref|XP_009110610.1| PREDICTED: squalene synthase [Brassica rapa]
 ref|XP_009110680.1| PREDICTED: squalene synthase [Brassica rapa]
Length=409

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP AS TL RLE + K C+D+G L KRKSY+
Sbjct  351  NDPNASNTLNRLEAVEKVCKDTGVLQKRKSYV  382



>ref|XP_010548075.1| PREDICTED: squalene synthase-like isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 152/184 (83%), Gaps = 2/184 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLE--ELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFC  594
            PRQIWSKYV+KLE  +LKYEENS  AVQCLNDMVT+AL+H+EDC+ YM++LRDP+IFRFC
Sbjct  231  PRQIWSKYVDKLEVHDLKYEENSTKAVQCLNDMVTNALTHIEDCVKYMASLRDPAIFRFC  290

Query  593  AIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKV  414
            AIPQIMAIGT+A+CYNNI VFRGVVKMRRGLTAKV+DRT TM DVYG F+ FS +LK+KV
Sbjct  291  AIPQIMAIGTIALCYNNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAFYSFSRLLKTKV  350

Query  413  DHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYL  234
            D NDP A+KTL +LE + K CR+SG L+KRKSY+   +P + P  + +  I+L+I+  YL
Sbjct  351  DKNDPNATKTLNQLEAVQKVCRESGMLHKRKSYVDDDKPQFNPLYVAILVILLSIVFAYL  410

Query  233  SGNK  222
              N+
Sbjct  411  KANQ  414



>ref|XP_010437580.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=410

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  294
            NDP AS TL RLE + K C D+G LN RKSY+  + +PN
Sbjct  351  NDPNASITLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  389



>ref|XP_006423443.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36683.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=356

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRD +IFRFCAI
Sbjct  172  PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSVLRDHAIFRFCAI  231

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  232  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  291

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++FFIILAI+  YLS 
Sbjct  292  NDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIFFIILAIIFSYLSS  351

Query  227  NK  222
             +
Sbjct  352  TR  353



>ref|XP_010447048.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=410

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR++W KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PREVWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP AS TL RLE + K C D+G LN RKSY+
Sbjct  351  NDPNASMTLNRLEAVQKLCIDTGVLNNRKSYV  382



>ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana]
 sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Arabidopsis thaliana]
 emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana]
 gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana]
 emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAD00296.1| squalene synthase [Arabidopsis thaliana]
 emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana]
Length=410

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEEN+  +VQCLN+MVT+AL H+EDCL YM +LRDPSIFRFCAI
Sbjct  231  PREIWGKYADKLEDLKYEENTNKSVQCLNEMVTNALMHIEDCLKYMVSLRDPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN  VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIMAIGTLALCYNNEQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  294
            NDP ASKTL RLE + K CRD+G L  RKSY+  + +PN
Sbjct  351  NDPNASKTLNRLEAVQKLCRDAGVLQNRKSYVNDKGQPN  389



>ref|XP_009619298.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=405

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 154/184 (84%), Gaps = 7/184 (4%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK+EENSV AVQCLNDM+T+ALSHVEDCL  +S LRDP+I R CAI
Sbjct  228  PRQIWSKYVNKLEDLKFEENSVKAVQCLNDMITNALSHVEDCLVCLSTLRDPAILRSCAI  287

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMA+GTL MCYNN  VFRG VKMRRGL+AKV D+TRTMEDVYG FF FS +LKSKVD+
Sbjct  288  PQIMAVGTLTMCYNNAEVFRGAVKMRRGLSAKVFDQTRTMEDVYGAFFHFSSILKSKVDN  347

Query  407  NDPTASKTLKRLEIILKTCRD-SGTLNKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+ TLKR+E I+KTCRD SGTL+KR       +PNY P LII+FFI++AILL YLS
Sbjct  348  NDPNATNTLKRIESIMKTCRDYSGTLSKRN------KPNYIPTLIIIFFIVVAILLAYLS  401

Query  230  GNKP  219
              +P
Sbjct  402  AKRP  405



>ref|XP_010690774.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLN+MVT++L HVEDCL YMSAL+D +IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSEKAVQCLNEMVTNSLLHVEDCLKYMSALKDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIM+IGTLA+CYNNI VFRGVVKMRRGLTA VID+T TM DVYG F+DF+CM+K KVD 
Sbjct  289  PQIMSIGTLALCYNNIQVFRGVVKMRRGLTAIVIDQTNTMPDVYGAFYDFACMMKPKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
             DP A KTL R+E I K CRDSGTLN+RK Y+ R +  YTP
Sbjct  349  KDPNAIKTLNRIEAIQKICRDSGTLNQRKLYV-RNKSTYTP  388



>gb|AIX97193.1| squalene synthase [Matricaria chamomilla var. recutita]
Length=409

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWS YVNKLE+LKYEENS  A+QCLN+MVT+AL H+EDCL YMS L+DP+IFRFCAI
Sbjct  229  PREIWSTYVNKLEDLKYEENSEMALQCLNNMVTNALIHIEDCLKYMSQLKDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRTRTM DVY  F DFS M+KSKVD 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTRTMADVYQAFSDFSDMIKSKVDM  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +DP+A  T+ RLE   K C+DS TL+ RKSYI + E  Y PAL+ + FIILAIL  YLS 
Sbjct  349  HDPSAQTTITRLEAAQKICKDSSTLSNRKSYIFKRESGYCPALLALLFIILAILYAYLSA  408

Query  227  N  225
            N
Sbjct  409  N  409



>ref|XP_010526913.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526914.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526915.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
Length=413

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 153/182 (84%), Gaps = 2/182 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL+H+EDCL YM++LRDP+IFRFCAI
Sbjct  231  PRQIWSKYVDKLEDLKYEENSNKAVQCLNDMVTNALTHIEDCLKYMASLRDPAIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKV+DRT TM DVYG F+DFS MLK+KVD 
Sbjct  291  PQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAFYDFSPMLKTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP ASKTL R+E + K C DSG  +KRKS+I   E  + P  I++  +ILAI+L YL+ 
Sbjct  351  NDPNASKTLSRIEAVQKICIDSGA-HKRKSFI-TDESRFNPLTIVMLIVILAIVLAYLNP  408

Query  227  NK  222
            N+
Sbjct  409  NQ  410



>ref|XP_010027379.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=274

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P QIW KYVNKLE+LKYEENSV AVQCLN+MVTDAL+HVED LTYMSALRDP+IFRF AI
Sbjct  90   PHQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTDALTHVEDSLTYMSALRDPAIFRFWAI  149

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
             QIMAIG LA+ YNNI VFRG VK+R GL AK+ D TRTM DVYG F+DFSCMLKSKVD 
Sbjct  150  FQIMAIGNLALSYNNIEVFRGEVKIRPGLAAKLRDHTRTMADVYGVFYDFSCMLKSKVDK  209

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  297
            NDP A+KTL  +E + K CRDSG LNKRKSYIL  EP
Sbjct  210  NDPNATKTLSIIEGMQKACRDSGLLNKRKSYILATEP  246



>ref|XP_006423442.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36682.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=413

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRD +IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSVLRDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++FFIILAI+  YLS 
Sbjct  349  NDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIFFIILAIIFSYLSS  408

Query  227  NK  222
             +
Sbjct  409  TR  410



>ref|XP_006351216.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=412

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS+LRDP+IF+FCAI
Sbjct  232  PRQIWSKYVNKLEDFKYEENSVKAVQCLNEMVTNALLYVEDCLTSMSSLRDPAIFQFCAI  291

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVY  F+DF C+++SKVD 
Sbjct  292  PQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYRAFYDFCCIMESKVDR  351

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            +DP A+ TLKRLE ILKTCRDSGTLN+RKSY    +PNY
Sbjct  352  DDPNATSTLKRLEAILKTCRDSGTLNQRKSYTFSHQPNY  390



>ref|XP_010065915.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLN+MVT+AL+HVED LTYMSALRDP+IFRF AI
Sbjct  229  PRQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTNALTHVEDSLTYMSALRDPAIFRFWAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
             QIMAIG L++ YNNI VFRG VK+R GL AKV DRTRTM DVYG F+DFSCM+KSKVD 
Sbjct  289  FQIMAIGNLSLSYNNIEVFRGEVKIRPGLAAKVRDRTRTMADVYGAFYDFSCMIKSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            +D  A+KTL  +E I K CRDSG LNKRKSYIL  EP Y+  L+    +IL I++ +LS 
Sbjct  349  DDSNATKTLSIIEGIQKACRDSGLLNKRKSYILATEPTYSSILVAFLLMILVIVVAHLSA  408

Query  227  NK  222
            ++
Sbjct  409  SQ  410



>ref|XP_010690775.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LK EENS  AVQCLN+M+T+AL HVEDC  YMSAL+D +IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKDEENSEKAVQCLNEMLTNALLHVEDCFKYMSALQDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIM+IGT A+CYNN+ VFRGVVKMRRGLTA VID+T TM DVYG F+DF+CM+K KVD 
Sbjct  289  PQIMSIGTYALCYNNVQVFRGVVKMRRGLTAVVIDQTNTMPDVYGAFYDFACMMKLKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
             DP A+KTL R+E I K CRDSGTLNKRK +I+  +  YTP +++V  II+AI+   LS 
Sbjct  349  RDPNATKTLSRIEAIQKICRDSGTLNKRKLHIVHTKSAYTPIMMMVLLIIVAIIFARLSA  408

Query  227  NK  222
            N+
Sbjct  409  NR  410



>ref|XP_004249733.1| PREDICTED: squalene synthase-like isoform X1 [Solanum lycopersicum]
Length=412

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS+LR+P+IF FCAI
Sbjct  232  PRQIWSKYVNKLEDFKYEENSVMAVQCLNEMVTNALLYVEDCLTGMSSLRNPAIFHFCAI  291

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG F+DF C+++SKVD 
Sbjct  292  PQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAFYDFCCIMESKVDR  351

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            +DP A+ TLKRLE ILKTCRDSGTLN+RKS+    +PNY
Sbjct  352  DDPNATITLKRLEAILKTCRDSGTLNQRKSHTFSHQPNY  390



>ref|XP_009760451.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
 ref|XP_009760452.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=406

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 151/184 (82%), Gaps = 7/184 (4%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK  ENSV AVQCLNDMVT+ALSH EDCL  +S L DP+IFR CAI
Sbjct  229  PRQIWSKYVNKLEDLKCGENSVKAVQCLNDMVTNALSHGEDCLVCLSTLHDPAIFRSCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTL MCYNN+ VFRGVVKMRRGL+AKV D+TRTMEDVYG FF FS +LKSKVD+
Sbjct  289  PQIMAIGTLTMCYNNVEVFRGVVKMRRGLSAKVFDQTRTMEDVYGAFFHFSSILKSKVDN  348

Query  407  NDPTASKTLKRLEIILKTCRD-SGTLNKRKSYILRAEPNYTPaliivffiilailLGYLS  231
            NDP A+ TLKR+E I+KTCRD S TL+KR       +PNY P LIIVFF ++AILL YLS
Sbjct  349  NDPNATNTLKRIESIMKTCRDYSETLSKRN------KPNYIPTLIIVFFFVVAILLAYLS  402

Query  230  GNKP  219
              +P
Sbjct  403  AKRP  406



>ref|XP_010025621.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P QIW KYVNKLE+LKYEENSV AVQCLN+MVTDAL+HVED LTYMSALRDP+IFRF AI
Sbjct  229  PHQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTDALTHVEDSLTYMSALRDPAIFRFWAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
             QIMAIG LA+ YNNI VFRG VK+R GL AK+ D TRTM DVYG F+DFSCMLK KVD 
Sbjct  289  FQIMAIGNLALSYNNIEVFRGEVKIRPGLAAKLRDHTRTMADVYGSFYDFSCMLKPKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  297
            NDP A+KTL  +E I K CRDSG LNKRKSYIL  EP
Sbjct  349  NDPNATKTLSIIEGIQKACRDSGLLNKRKSYILATEP  385



>ref|XP_010437579.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=419

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 137/168 (82%), Gaps = 10/168 (6%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRFCAI
Sbjct  231  PREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRFCAI  290

Query  587  PQ---------IMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFS  435
            PQ         IMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFS
Sbjct  291  PQVGEGNIIILIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFS  350

Query  434  CMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  294
            CMLK+KVD NDP AS TL RLE + K C D+G LN RKSY+  + +PN
Sbjct  351  CMLKTKVDKNDPNASITLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  398



>ref|XP_010025618.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=407

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW KYVNKLE+LKYEENSV AVQCLN+MVT+AL+HVED LTYMS+LRDP+IFRF AI
Sbjct  223  PRQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTNALTHVEDSLTYMSSLRDPTIFRFWAI  282

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
             QIMAIG L + YNNI VF+G VK+R GL AKV DRTRTM DVYG F+DFSCMLKSKVD 
Sbjct  283  FQIMAIGNLVLSYNNIQVFKGEVKIRPGLAAKVRDRTRTMADVYGAFYDFSCMLKSKVDK  342

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  297
            NDP A+KTL  +E I K CRDS  LNKRKSYIL  +P
Sbjct  343  NDPNATKTLSIIEGIQKACRDSSLLNKRKSYILATKP  379



>ref|XP_006841632.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
 gb|ERN03307.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
Length=407

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW+KY  KLE+ KYEENS  AV+CLN+MVT+AL HVEDCL YMSALRDP+IFRFCAI
Sbjct  229  PREIWNKYALKLEDFKYEENSSEAVRCLNEMVTNALFHVEDCLKYMSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ +FRGVV+MRRGL A+V+D TR+M DVYG FFDFSCML SKVD 
Sbjct  289  PQIMAIGTLALCYNNVELFRGVVRMRRGLVARVMDETRSMADVYGAFFDFSCMLSSKVDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSY  315
             DP A+KTL R+E I K CR SG+L+KR+SY
Sbjct  349  GDPNATKTLDRVEAIQKACRASGSLDKRRSY  379



>ref|XP_009769885.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=398

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+ KYEENSV A QCLN+MVT+ALSH EDCLTYMS LRDP IF FCAI
Sbjct  217  PRQIWSKYVNKLEDFKYEENSVKAGQCLNEMVTNALSHAEDCLTYMSNLRDPVIFHFCAI  276

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+ +G L M YNNI VF+GVV+MRRGL AKVI +TRTM DVY  FFDF  +L+SKVDH
Sbjct  277  PQIINMGNLTMYYNNIEVFKGVVEMRRGLCAKVIGQTRTMTDVYRAFFDFCRILESKVDH  336

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP A+ TLKRLE I KTCRDSGTLN+RKS I   + NY
Sbjct  337  NDPNATITLKRLEAISKTCRDSGTLNQRKSCIFSRQRNY  375



>gb|KDO43892.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=384

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKR  324
            NDP A+KTL R+E I K C DSG LNKR
Sbjct  349  NDPNATKTLSRVEAIQKACMDSGVLNKR  376



>gb|KDO43893.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43894.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=386

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K++ 
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKR  324
            NDP A+KTL R+E I K C DSG LNKR
Sbjct  349  NDPNATKTLSRVEAIQKACMDSGVLNKR  376



>ref|XP_010312074.1| PREDICTED: squalene synthase-like isoform X2 [Solanum lycopersicum]
Length=384

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS+LR+P+IF FCAI
Sbjct  232  PRQIWSKYVNKLEDFKYEENSVMAVQCLNEMVTNALLYVEDCLTGMSSLRNPAIFHFCAI  291

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG F+DF C+++SKVD 
Sbjct  292  PQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAFYDFCCIMESKVDR  351

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            +DP A+ TLKRLE ILKTCRDSGTLN+RK+YI
Sbjct  352  DDPNATITLKRLEAILKTCRDSGTLNQRKNYI  383



>emb|CDX69076.1| BnaC01g03770D [Brassica napus]
Length=428

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+LK EENS  AVQCLN+MVT+AL HVE CL  M+ LRDP+IF+ C+I
Sbjct  232  PREIWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEVCLKSMAGLRDPAIFKSCSI  291

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+A+GTLA+CYNN+ VFRGVVK+RRGL AKVIDRT+TM+DVYG F+DFSCMLK+KVD 
Sbjct  292  PQIVAMGTLALCYNNVQVFRGVVKLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLKTKVDK  351

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTLKRLE I K CR++G L+KRKSY+
Sbjct  352  NDPNAIKTLKRLEAIEKVCRENGDLHKRKSYV  383



>gb|AGN32410.1| squalene synthase [Dioscorea zingiberensis]
Length=409

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKY +KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMSAL+D +IFRFCAI
Sbjct  229  PRQIWSKYADKLEDLKYEENSAKAVECLNDMVTNALMHAEDCLVYMSALKDIAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TRTM DVYG F+DFS +LK+KV+ 
Sbjct  289  PQVMAIGTLALCYNNLEVFRGVVKMRRGLTARVIDQTRTMADVYGAFYDFSSLLKAKVND  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
             DP A  T KR+E I K C  SG LNKR   +   +P + P
Sbjct  349  KDPNAELTKKRVEAIQKACISSGLLNKRGLQVCDTKPTFNP  389



>ref|XP_009110500.1| PREDICTED: squalene synthase [Brassica rapa]
Length=418

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+LK EE S  AVQCLN+MVT+AL HVEDCL  M+ LRDP+IF+ CAI
Sbjct  232  PREIWGKYVDKLEDLKNEEKSTKAVQCLNEMVTNALIHVEDCLKSMAGLRDPAIFKSCAI  291

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+A+GTLA+CYNN+ VFRG VK+RRGL AKVIDRT+TM DVYG F+DFSCMLK+KVD 
Sbjct  292  PQIVAMGTLALCYNNVQVFRGAVKLRRGLIAKVIDRTKTMGDVYGAFYDFSCMLKTKVDK  351

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTL+RLE I K CR++G L+KRKSY+
Sbjct  352  NDPNAMKTLQRLETIEKVCRENGDLHKRKSYV  383



>emb|CDX75451.1| BnaA01g02510D [Brassica napus]
Length=413

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+LK EE S  AVQCLN+MVT+AL HVEDCL  M+ LRDP+IF+ CAI
Sbjct  232  PREIWGKYVDKLEDLKNEEKSTKAVQCLNEMVTNALIHVEDCLKSMAGLRDPAIFKSCAI  291

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+A+GTLA+CYNN+ VFRG VK+RRGL AKVIDRT+TM+DVYG F+DFSCMLK+KVD 
Sbjct  292  PQIVAMGTLALCYNNVQVFRGAVKLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLKTKVDK  351

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
             DP A KTL+RLE I K CR++G L+KRKSY+
Sbjct  352  KDPNAMKTLQRLETIEKVCRENGDLHKRKSYV  383



>gb|AAB61927.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+ K EE +  AVQCLN+MVT+AL+HVEDCL  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDFKNEEKATKAVQCLNEMVTNALNHVEDCLKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTL +CYNN+ VFRGVV+MRRGL AKVIDRT+TM+DVYG F+DFSCML++KVD+
Sbjct  291  PQIVAIGTLTLCYNNVQVFRGVVRMRRGLIAKVIDRTKTMDDVYGAFYDFSCMLQTKVDN  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTL RLE I K CR++G L+KRKSY+
Sbjct  351  NDPNAMKTLNRLETIKKVCRENGVLHKRKSYV  382



>ref|XP_008795796.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=408

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+L+YEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRFC I
Sbjct  229  PREIWSKYASKLEDLQYEENSTKAVQCLNDMVTNALVHAEDCLQYMSALKDLAIFRFCVI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK+D 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSKIDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAE  300
            NDP AS T  R+E I K C  SG LNKR  ++  ++
Sbjct  349  NDPNASLTRHRVEAIHKACISSGLLNKRGRHMYESK  384



>ref|XP_008796678.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796679.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=409

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+LKYEENS  AVQCLNDMVT+AL H EDCL Y+ AL+D +IF+FCAI
Sbjct  229  PREIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLQYLFALKDLAIFQFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK+D 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSKIDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  349  NDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  387



>gb|AFN61199.1| squalene synthase [Chlorophytum borivilianum]
Length=410

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIW+KY +KLE+ KYEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRFCAI
Sbjct  229  PRQIWNKYADKLEDFKYEENSEKAVQCLNDMVTNALDHAEDCLQYMSALKDIAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MAIGTLA+CYNN+ VFRGVVKMRRGLTAKVID+TRTM DVYG FF+FS ++K+KV+ 
Sbjct  289  PQVMAIGTLALCYNNVKVFRGVVKMRRGLTAKVIDQTRTMSDVYGAFFEFSSLMKTKVND  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
             DP A+ TLKR+E I K+C  SG L+KR   + +++  +
Sbjct  349  LDPNAALTLKRIEAIQKSCISSGNLDKRGCSLYKSQTQH  387



>ref|XP_008796681.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+LKYEENS  AVQCLNDMVT+AL H EDCL Y+ AL+D +IF+FCAI
Sbjct  229  PREIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLQYLFALKDLAIFQFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK+D 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSKIDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  349  NDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  387



>ref|XP_010437577.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=410

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+ K EENS  AVQCLN+MVT+AL HVEDCL  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDFKKEENSTKAVQCLNEMVTNALIHVEDCLKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNN+ VF GVV++RRGL AK+IDRT+TM+DVYG F+DFSCML+SKVD 
Sbjct  291  PQIVAIGTLALCYNNVQVFGGVVRLRRGLIAKIIDRTKTMDDVYGVFYDFSCMLQSKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTL RLE I K CR++G L+KRK+Y+
Sbjct  351  NDPNAMKTLNRLETIKKVCRENGVLHKRKTYV  382



>ref|NP_195191.2| squalene synthase 2 [Arabidopsis thaliana]
 emb|CAA18844.2| putative squalene synthase [Arabidopsis thaliana]
 emb|CAB80182.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86404.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+ K EE +  AVQCLN+MVT+AL+HVEDCL  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDFKNEEKATKAVQCLNEMVTNALNHVEDCLKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNN+ VFRGVV++RRGL AKVIDRT+TM+DVYG F+DFSCML++KVD+
Sbjct  291  PQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLQTKVDN  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTL RLE I K C+++G L+KRKSY+
Sbjct  351  NDPNAMKTLNRLETIKKFCKENGGLHKRKSYV  382



>ref|XP_010934354.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
 ref|XP_010910886.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
Length=408

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P +IWSKY +KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRFCAI
Sbjct  229  PWEIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLHYMSALKDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +L+SK+D 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLESKIDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAE  300
            NDP AS T  R+E I K C  SG LNKR  ++  ++
Sbjct  349  NDPNASLTRHRVEAIHKACISSGFLNKRGRHMYESK  384



>ref|XP_010447047.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+ K EEN+  AVQCLN+MVT+AL HVEDCL  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDFKNEENATKAVQCLNEMVTNALIHVEDCLKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNN+ VFRGVV++RRGL AK+IDRT+TM+DVYG F DFSCML+SKVD 
Sbjct  291  PQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKIIDRTKTMDDVYGVFCDFSCMLQSKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A  TL RLE I K CRD+G L+KRK+Y+
Sbjct  351  NDPNAVITLNRLETIKKVCRDNGVLHKRKTYV  382



>gb|AGW25489.1| squalene synthase [Paris polyphylla var. yunnanensis]
Length=403

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY NKLE+ KYEENS NA+ CLNDMVT+AL H EDCL YMSAL++ SIFRFCAI
Sbjct  229  PREIWSKYANKLEDFKYEENSTNALHCLNDMVTNALMHAEDCLQYMSALKNLSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN  +FRGVVKMRRGL A+VID+T+TM D YG F++FS +LKSK+D 
Sbjct  289  PQIMAIGTLALCYNNQELFRGVVKMRRGLVARVIDQTKTMSDTYGAFYEFSSLLKSKIDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
             DP A+ T +R+E I K+C  SG LNKR+  +  ++P Y
Sbjct  349  KDPNATLTWERIEAIQKSCISSGLLNKRRCRMYESKPAY  387



>ref|XP_010432387.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE L+YEENS  AV+CLN+MVT+AL HVEDCL  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEVLQYEENSTKAVKCLNEMVTNALIHVEDCLKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNNI VFRGVV++RRGL AK+IDRT+ M+DVYG F+DFSCML+SKVD 
Sbjct  291  PQIVAIGTLALCYNNIQVFRGVVRLRRGLIAKIIDRTKNMDDVYGLFYDFSCMLQSKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            +DP A KTL RLE I K  RD+G L+KRK+Y+
Sbjct  351  SDPDAMKTLNRLETIKKVSRDNGVLHKRKTYV  382



>ref|XP_002869132.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45391.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+LK EE S  AVQCLN+MVT+AL+HVEDCL  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDLKNEEKSTQAVQCLNEMVTNALTHVEDCLKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTL +CYNN+ VFRG V++RRGL AKVID T+TM+DVYG F+DFSCML++KVD 
Sbjct  291  PQIVAIGTLTLCYNNVQVFRGAVRLRRGLIAKVIDLTKTMDDVYGAFYDFSCMLQTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTL RLE I K C+++G ++KRKSY+
Sbjct  351  NDPNAMKTLNRLETIKKVCKENGVIHKRKSYV  382



>gb|KFK30098.1| hypothetical protein AALP_AA7G216700 [Arabis alpina]
Length=413

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR++W KYV+KLE+LK EENS  AVQCLN+MVT+AL HVEDCL  +++LR+P I   CAI
Sbjct  232  PREMWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEDCLKCLASLRNPEILLSCAI  291

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNN+ VFRGVVK+RRGL AKVIDRT+TM+DVYG F+DFSCML++KVD 
Sbjct  292  PQIVAIGTLALCYNNVQVFRGVVKLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLQTKVDK  351

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTL RLE I K CR++G  +KRKSY+
Sbjct  352  NDPNAMKTLNRLETIKKVCRENGAFHKRKSYV  383



>gb|AHB20141.2| squalene synthase [Fritillaria thunbergii]
Length=409

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR IWSKYV+KLE+LKY+ENS  AVQCLNDMVT+AL H +DCL Y+S L+D S FRFCAI
Sbjct  229  PRAIWSKYVDKLEDLKYKENSTQAVQCLNDMVTNALLHAQDCLKYLSDLKDLSNFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMA+GTLA+CYNN+ +FRGVVKMRRG+ A+V+D+TRTM DVYG FF+FS +LKSK+D+
Sbjct  289  PQIMAMGTLALCYNNVEIFRGVVKMRRGVVARVMDQTRTMSDVYGAFFEFSSLLKSKIDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP AS T  R+E I  +C  SG LNKR  ++ R+ P Y
Sbjct  349  NDPNASLTRMRIEAIQNSCVKSGMLNKRGCHMYRSSPAY  387



>gb|EAY92248.1| hypothetical protein OsI_13969 [Oryza sativa Indica Group]
Length=397

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMSAL+D +IFRFCAI
Sbjct  219  PREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDHAIFRFCAI  278

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F++FS +++SK+D+
Sbjct  279  PQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEFSSLIESKIDN  338

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILR  306
            NDP AS T KR++ I +TC+ S +L KR+ Y L 
Sbjct  339  NDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDLE  371



>ref|XP_009396917.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396918.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P QIWSKY NKLE+ KY ENS  AVQCLND+VT+AL H EDCL YMS L+D SIFRF AI
Sbjct  229  PHQIWSKYANKLEDFKYVENSTKAVQCLNDLVTNALIHAEDCLQYMSGLKDLSIFRFAAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVID+T +M DVYG F++FS +LKSK+D+
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDQTYSMSDVYGAFYEFSSLLKSKIDN  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  288
            NDP AS T +R++ I KTC  SG L+KR  ++  ++ +Y 
Sbjct  349  NDPNASLTHQRVDAIQKTCISSGLLSKRSLHVYESKFHYV  388



>ref|NP_001051625.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAA22557.1| squalene synthase [Oryza sativa Japonica Group]
 gb|AAS07223.1| squalene synthase [Oryza sativa Japonica Group]
 gb|ABF99429.1| Squalene synthetase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13539.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAH01306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMSAL+D +IFRFCAI
Sbjct  225  PREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDHAIFRFCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F++FS +++SK+D+
Sbjct  285  PQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEFSSLIESKIDN  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL  309
            NDP AS T KR++ I +TC+ S +L KR+ Y L
Sbjct  345  NDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDL  376



>gb|EEE60131.1| hypothetical protein OsJ_13016 [Oryza sativa Japonica Group]
Length=413

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMSAL+D +IFRFCAI
Sbjct  235  PREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDHAIFRFCAI  294

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F++FS +++SK+D+
Sbjct  295  PQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEFSSLIESKIDN  354

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL  309
            NDP AS T KR++ I +TC+ S +L KR+ Y L
Sbjct  355  NDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDL  386



>gb|AFY63035.1| squalene synthase [Alisma plantago-aquatica subsp. orientale]
Length=409

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+LKYEE+S  AV+CLNDMVTDAL H EDCL YMS L+D SIFRFCAI
Sbjct  229  PREIWSKYADKLEDLKYEESSDKAVECLNDMVTDALRHAEDCLQYMSDLQDISIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+C+NNI VF+GVVKMRRGL AK+ID+T+TM DVY  F+ FS +LKSK+++
Sbjct  289  PQIMAIGTLALCFNNIEVFQGVVKMRRGLAAKIIDQTKTMTDVYNAFYGFSHLLKSKINY  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRK  321
             DP AS TLKRL++I K C DSG L+KR+
Sbjct  349  KDPNASLTLKRLDVIQKVCLDSGLLDKRQ  377



>dbj|BAJ99680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H  DCL YMSAL+D S FRFCAI
Sbjct  83   PREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAHDCLQYMSALKDNSNFRFCAI  142

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T+++ DVY  F++FS +L+SK+D 
Sbjct  143  PQIMAIGTCAICYNNVKVFRGVVKMRRGLTARIIDETKSISDVYSAFYEFSSLLESKIDD  202

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+ T KR++ I KTC+ SG L KR+ Y L       P LI++  ++ AI+LG L G
Sbjct  203  NDPNAALTRKRVDAIKKTCKSSGLL-KRRGYDLEKSKYRMPMLIMIVLLLAAIILGVLYG  261



>ref|XP_006412200.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
 gb|ESQ53653.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
Length=396

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+LK EENS  AVQCLN+MVT+AL HVED L  +++LR+P+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEDSLKTIASLRNPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNN+ VFRGVV++RRGL AKV DRT+TM+DVYG F+DFSCMLK+KVD 
Sbjct  291  PQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKVYDRTKTMDDVYGAFYDFSCMLKAKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  297
            NDP A KTL RLE I + CR++G  +KR+   L   P
Sbjct  351  NDPNAIKTLNRLETIKRVCRENGVFHKRQGSFLLLVP  387



>ref|XP_010437578.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=407

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+ K EENS  AVQCLN+MVT+AL HVEDCL  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDFKKEENSTKAVQCLNEMVTNALIHVEDCLKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNN+ VF GVV++RR   AK+IDRT+TM+DVYG F+DFSCML+SKVD 
Sbjct  291  PQIVAIGTLALCYNNVQVFGGVVRLRR---AKIIDRTKTMDDVYGVFYDFSCMLQSKVDK  347

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            NDP A KTL RLE I K CR++G L+KRK+Y+
Sbjct  348  NDPNAMKTLNRLETIKKVCRENGVLHKRKTYV  379



>gb|AGI56082.1| squalene synthase [Dendrobium catenatum]
Length=410

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P QIW+KY NKLE+LKYEENSV AVQCLNDMVT+AL H EDCL Y+S L+  SIFRFCAI
Sbjct  229  PWQIWNKYANKLEDLKYEENSVKAVQCLNDMVTNALVHAEDCLKYLSNLKTHSIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CY N  VFRGVVKMRRGLTA++ D+TR+M DVYG F+DFS +L++K+D 
Sbjct  289  PQIMAIGTLALCYGNEEVFRGVVKMRRGLTARISDQTRSMADVYGAFYDFSSLLETKIDE  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  288
             DP A  T KR++ I K C  +G LNKR  Y++R    Y+
Sbjct  349  KDPNAILTRKRVDAIKKACVSTGLLNKRGLYVVRKRAMYS  388



>gb|AFS28708.1| putative squalene synthase, partial [Olea europaea]
Length=171

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMSALRDP+IFRFCAI
Sbjct  58   PRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVEDCLKYMSALRDPAIFRFCAI  117

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCML  426
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFS ML
Sbjct  118  PQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGDFYDFSRML  171



>dbj|BAJ87710.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H  DCL YMSAL+D S FRFCAI
Sbjct  225  PREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAHDCLQYMSALKDNSNFRFCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T+++ DVY  F++FS +L+SK+D 
Sbjct  285  PQIMAIGTCAICYNNVKVFRGVVKMRRGLTARIIDETKSISDVYSAFYEFSSLLESKIDD  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+ T KR++ I KTC+ SG L KR+ Y L       P LI++  ++ AI+LG L G
Sbjct  345  NDPNAALTRKRVDAIKKTCKSSGLL-KRRGYDLEKSKYRMPMLIMIVLLLAAIILGVLYG  403



>ref|XP_004981370.1| PREDICTED: squalene synthase-like [Setaria italica]
Length=289

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR IWSKY +KLE+ KYEENS   VQCLNDMVT+AL H EDCL YMSAL+D +IFRFCAI
Sbjct  111  PRDIWSKYADKLEDFKYEENSEKGVQCLNDMVTNALIHAEDCLQYMSALKDHTIFRFCAI  170

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A CYNN+ VFRGVVKMRRGLTA+VI  T +M DVY  F++FS +L+SK+D 
Sbjct  171  PQIMAIGTCAFCYNNVNVFRGVVKMRRGLTARVIYETDSMSDVYTAFYEFSLLLESKIDD  230

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A+ T KR++ I +TC+ SG L KR+ Y L   P Y P
Sbjct  231  NDPNAALTRKRVDSIKQTCKSSGLL-KRRGYHLDKSP-YKP  269



>ref|XP_003559279.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=403

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 130/161 (81%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV KLE+LKY+ENS  AVQCLNDMVT+AL H +DCL YMSAL+D ++FR CAI
Sbjct  225  PREIWSKYVEKLEDLKYKENSEKAVQCLNDMVTNALIHAKDCLQYMSALKDDTVFRLCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMA+G  A+CYNN+ VFRG+VKMR GLTA+VID T++M DVY  F++FS +L+SK+D 
Sbjct  285  PQIMAMGNFAICYNNVNVFRGLVKMRHGLTARVIDETKSMSDVYTAFYEFSSLLESKIDD  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP+A+ T KR++ I KTC+ SG L KR+ Y L  +P Y P
Sbjct  345  NDPSAALTRKRVDAIKKTCKSSGLL-KRRGYDLE-KPKYMP  383



>gb|EMT03383.1| Squalene synthetase [Aegilops tauschii]
Length=450

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H +DCL YMSAL+D S FRFCAI
Sbjct  271  PREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAQDCLQYMSALKDNSNFRFCAI  330

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T+++ DVY  F++FS +L+SK+D 
Sbjct  331  PQIMAIGTCAICYNNVKVFRGVVKMRRGLTARVIDETKSISDVYSAFYEFSSLLESKIDD  390

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSG  228
            NDP A+ T +R++ I KTC+ SG L KR+ Y L       P LI++  +++AI+LG L G
Sbjct  391  NDPNAALTRRRVDAIKKTCKSSGLL-KRRGYDLEKSMYRMPMLIMIALLLVAIILGVLYG  449



>ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
Length=305

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRFCAI
Sbjct  187  PRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRFCAI  246

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  417
            PQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK++
Sbjct  247  PQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAR  303



>ref|XP_006351382.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=400

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 125/160 (78%), Gaps = 11/160 (7%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+ KYEENSV AVQCLN          EDCL YMS LRDPSIF+FCAI
Sbjct  229  PRQIWSKYVNKLEDFKYEENSVKAVQCLN----------EDCLVYMSNLRDPSIFQFCAI  278

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            P ++ +G L M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG FFDF C+++SKVD 
Sbjct  279  PLVINMGNLMMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAFFDFCCIMESKVDR  338

Query  407  NDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNY  291
            +DP A+ TLKRLE I K CR+SGTL N+RKSY    +PNY
Sbjct  339  DDPNATSTLKRLEEISKNCRNSGTLINQRKSYTFSHQPNY  378



>ref|NP_001104839.1| squalene synthase1 [Zea mays]
 dbj|BAA22558.1| squalene synthase [Zea mays]
 gb|ACN34757.1| unknown [Zea mays]
 gb|AFW67298.1| Squalene synthase isoform 1 [Zea mays]
 gb|AFW67299.1| Squalene synthase isoform 2 [Zea mays]
Length=401

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 130/161 (81%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+ KYEENS  AVQCLN+MVTDAL H E+CL YMSAL+DP+IFRFCAI
Sbjct  225  PREIWSKYADKLEDFKYEENSKKAVQCLNNMVTDALIHAEECLQYMSALKDPAIFRFCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK+D 
Sbjct  285  PQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMTDVYTAFYEFSSLIESKIDD  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            +DP A+ T +R++ I +TC+ SG L K++ Y L   P Y P
Sbjct  345  SDPNAALTQRRVDSIKQTCKSSG-LVKQRGYHLEKSP-YRP  383



>ref|XP_006651930.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=403

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY NKLE+ KYEENS  AVQCLND+VT+AL H EDCL YMSAL+D +IFRFCAI
Sbjct  225  PREIWSKYANKLEDFKYEENSEKAVQCLNDLVTNALYHAEDCLKYMSALKDHAIFRFCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T +M DVY  F++FS +++SK+D+
Sbjct  285  PQIMAIGTCAVCYNNVNVFRGVVKMRRGLTARVIDETNSMSDVYTAFYEFSSLIESKIDN  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  288
            NDP AS T KR++ I +TC  S +L +R   + +++ N T
Sbjct  345  NDPNASLTRKRVDAIKRTCMSSCSLKRRGYDLEKSKYNTT  384



>ref|XP_011047507.1| PREDICTED: squalene synthase isoform X2 [Populus euphratica]
Length=346

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT++L HV+DCL YMSAL +P+IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSVEAVQCLNEMVTNSLIHVDDCLKYMSALPEPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKV  414
            PQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA+VI RT+TM DVYG FFDFSCMLKSKV
Sbjct  289  PQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQVIHRTKTMADVYGAFFDFSCMLKSKV  346



>ref|XP_009389044.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=408

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKY +KLE  K   NS  AV+CLND+VT+AL H EDCL YMSAL+D +IFRFCAI
Sbjct  229  PRQIWSKYADKLEGFKNAGNSTKAVECLNDLVTNALIHAEDCLQYMSALKDLAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAK+ID+T +M DVYG F++FS +LKSK+D 
Sbjct  289  PQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKIIDQTNSMSDVYGAFYEFSSLLKSKIDD  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKR  324
            NDP A  T K +E I K C  SG L+ R
Sbjct  349  NDPNAKLTRKHVEAIQKACGSSGLLDTR  376



>gb|ACN33457.1| unknown [Zea mays]
Length=275

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IFRFCAI
Sbjct  111  PREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFRFCAI  170

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK+D 
Sbjct  171  PQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESKIDD  230

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  231  NDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  269



>gb|EYU37849.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=346

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PRQIWSKYVNKLE+LK+EENSV AVQCLNDMVT+AL H+EDCL YMS LRDP+IFRFCAI
Sbjct  229  PRQIWSKYVNKLEDLKHEENSVKAVQCLNDMVTNALIHIEDCLKYMSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKV  414
            PQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK KV
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSRMLKYKV  346



>emb|CDX72494.1| BnaC07g45160D [Brassica napus]
Length=395

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+LK E+ S  AVQCLNDM+T+AL HVEDCL  M+ALRDP+I   C+I
Sbjct  231  PREIWGKYVDKLEDLKDEDKSTKAVQCLNDMITNALIHVEDCLKSMAALRDPAILHSCSI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            P I+AIGTLA+CYNNI VFRG +K+RRGL AKV DRT+TM+DV G F+DFSCML++KVD 
Sbjct  291  PLIVAIGTLALCYNNIQVFRGSLKLRRGLIAKVFDRTKTMDDVCGAFYDFSCMLETKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRD-SGTLNKRKSYI  312
             DP A KTL RLE I K CR+  G +++RKSY+
Sbjct  351  KDPNAMKTLNRLETIKKVCREYGGDIHQRKSYV  383



>ref|XP_002466259.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
 gb|EER93257.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
Length=403

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+ KYEENS  AVQCLND+VT+AL H E+CL YMSAL+  +IFRFCAI
Sbjct  225  PREIWSKYADKLEDFKYEENSEKAVQCLNDLVTNALIHAEECLQYMSALKGHAIFRFCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK+D 
Sbjct  285  PQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMADVYTSFYEFSSLIESKIDD  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A+ T +R++ I +TC+ SG L KR+ Y L   P Y P
Sbjct  345  NDPNAALTRRRVDSIKQTCKSSG-LVKRRGYHLDKSP-YRP  383



>tpg|DAA52015.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=261

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IF FCAI
Sbjct  83   PREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFHFCAI  142

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK+D 
Sbjct  143  PQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESKIDD  202

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  203  NDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  241



>ref|XP_008795798.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=373

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -3

Query  734  LEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAIPQIMAIGTLAM  555
            L++L+YEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRFC IPQIMAIGTLA+
Sbjct  205  LQDLQYEENSTKAVQCLNDMVTNALVHAEDCLQYMSALKDLAIFRFCVIPQIMAIGTLAL  264

Query  554  CYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKR  375
            CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK+D NDP AS T  R
Sbjct  265  CYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSKIDDNDPNASLTRHR  324

Query  374  LEIILKTCRDSGTLNKRKSYILRAE  300
            +E I K C  SG LNKR  ++  ++
Sbjct  325  VEAIHKACISSGLLNKRGRHMYESK  349



>gb|AIW04729.1| squalene synthase [Dryopteris fragrans]
Length=412

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR IW KY +KLE+ K EENS  AV+CLND++T+ALSH  DCLTYM+AL+D ++FRFCAI
Sbjct  230  PRDIWGKYASKLEDFKEEENSEAAVECLNDLITNALSHALDCLTYMAALKDHAVFRFCAI  289

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAK++D+T TM DVYG F+DF  ML  K++ 
Sbjct  290  PQIMAIGTLAVCYNNVHVFRGVVKIRRGLTAKIMDQTHTMADVYGAFYDFCSMLSVKINK  349

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSY  315
             DP++ +TL  +E I   CR SGTL+KR+ +
Sbjct  350  KDPSSQRTLNCVEAIQHACRSSGTLSKRRVF  380



>ref|XP_003564211.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=402

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 129/161 (80%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY ++LE+LKYEENS  AVQCLNDMVT+AL H EDCL YMSAL+D + FRFCAI
Sbjct  225  PREIWSKYADELEDLKYEENSERAVQCLNDMVTNALIHAEDCLQYMSALKDNANFRFCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A CYNN+ VFR VVKMRRGLTA+++D T++M DVY  F++FS +L+SK+D 
Sbjct  285  PQIMAIGTCAQCYNNVQVFRRVVKMRRGLTARIMDETKSMSDVYTAFYEFSSLLESKIDD  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP+A+ T +R++ I K CR SG L KR+ Y L+ +  Y P
Sbjct  345  NDPSAAITRERVDAIKKRCRSSGLL-KRRGYDLQ-KSQYRP  383



>ref|XP_006658375.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=363

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLE+LKYEENSVNAV+CLN+MVT+ L H EDCL YMSAL+D +I RFCAI
Sbjct  184  PREIWSKYVDKLEDLKYEENSVNAVKCLNEMVTNGLIHTEDCLRYMSALKDIAILRFCAI  243

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MA+ T A+CYNN+ VFRGVVKMRRGLTA++I+ T +M DVY  F++FS +L+ K+D 
Sbjct  244  PQVMALATYALCYNNVNVFRGVVKMRRGLTARIINETNSMSDVYTAFYEFSSLLEEKIDE  303

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKR  324
            NDP AS T K +  I ++C+ SG L KR
Sbjct  304  NDPNASLTWKYVNAIKESCKSSGMLKKR  331



>ref|NP_001130502.1| uncharacterized protein LOC100191601 [Zea mays]
 gb|ACF78747.1| unknown [Zea mays]
Length=403

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IFRFCA+
Sbjct  225  PREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFRFCAV  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK+D 
Sbjct  285  PQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESKIDD  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  345  NDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  383



>gb|AHI96421.1| squalene synthase [Pinus massoniana]
Length=409

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW+KYV++LE+LK EE S  AVQCLN+MVT+AL H  DCL Y+SALRDP+IFRFCAI
Sbjct  229  PREIWAKYVSRLEDLKEEERSKEAVQCLNEMVTNALKHANDCLKYLSALRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTL  CYNNI VF+GVVK+RRGLTAK+++RT TM DVYG FFDFS  L SKV  
Sbjct  289  PQIMAIGTLERCYNNIEVFKGVVKIRRGLTAKIMERTNTMADVYGAFFDFSRSLASKVPK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSY  315
            +DP A +TL  ++ I +TC+ SG L +R+++
Sbjct  349  DDPNARETLNCIDDIQRTCKASGLLARRRTF  379



>tpg|DAA52014.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=403

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IF FCAI
Sbjct  225  PREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFHFCAI  284

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK+D 
Sbjct  285  PQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESKIDD  344

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
            NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  345  NDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  383



>gb|ABK24732.1| unknown [Picea sitchensis]
Length=409

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW+KYV+KLE+LK EE S  AVQCLN+MVT+AL H  DCL Y+S LRDP+IFRFCAI
Sbjct  229  PREIWAKYVSKLEDLKEEEWSKEAVQCLNEMVTNALKHANDCLKYLSDLRDPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTL  CYNNI VFRGVVK+RRGLTAK+++RT TM DVYG FFDFS  L SKV  
Sbjct  289  PQIMAIGTLERCYNNIEVFRGVVKIRRGLTAKIMERTNTMADVYGAFFDFSRSLASKVPE  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSY  315
            +DP A +TL  ++ I +TC+ SG L +R ++
Sbjct  349  DDPNAKETLNCIDEIQRTCKASGLLARRTTF  379



>gb|EMS67019.1| Squalene synthase [Triticum urartu]
Length=384

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 125/165 (76%), Gaps = 17/165 (10%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H +DCL YMSAL+D S FRFCAI
Sbjct  188  PREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAQDCLQYMSALKDNSNFRFCAI  247

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK---  417
            PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T+++ DVY  F++FS +L+SK   
Sbjct  248  PQIMAIGTCAICYNNVKVFRGVVKMRRGLTARVIDETKSISDVYSAFYEFSSLLESKLFS  307

Query  416  --------------VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  324
                          +D NDP A+ T +R++ I KTC+ SG L +R
Sbjct  308  SCDFIHNMFGRHAQIDDNDPNAALTRRRVDAIKKTCKSSGLLKRR  352



>ref|NP_001059129.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAC84212.1| putative squalene synthase [Oryza sativa Japonica Group]
 dbj|BAF21043.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAG88654.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66758.1| hypothetical protein OsJ_23470 [Oryza sativa Japonica Group]
Length=410

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLE+LKYE NSV AV+CLN+MVT+ L H EDCL YMSAL+D +I RFCAI
Sbjct  231  PREIWSKYVDKLEDLKYENNSVKAVKCLNEMVTNGLIHTEDCLRYMSALKDITILRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ+MA+ T A+CYNN+ VFRGVVK+RRGLTA++I+ T +M DVY  F++FS +L  K+D 
Sbjct  291  PQVMALATYALCYNNVNVFRGVVKLRRGLTARIINETNSMADVYTAFYEFSSLLAEKIDD  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKR  324
            NDP AS T KR+  I +TC+ SG L  R
Sbjct  351  NDPNASLTRKRVNAIKETCKSSGLLKIR  378



>ref|XP_006285747.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
 gb|EOA18645.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
Length=413

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IW KYV+KLE+ K EE S  AVQCLN+MVT+AL HVEDC+  +++LRDP+IF+ CAI
Sbjct  231  PREIWGKYVDKLEDFKNEETSTKAVQCLNEMVTNALIHVEDCMKSLASLRDPAIFQSCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQI+AIGTLA+CYNN+ VFRGVV++RRGL AKVIDRT+TM+DVYG F+DFSCML++KVD 
Sbjct  291  PQIVAIGTLALCYNNVQVFRGVVRVRRGLIAKVIDRTKTMDDVYGVFYDFSCMLQTKVDK  350

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            ND  A KT  RLE I K CR++G L KRKSY+
Sbjct  351  NDANAMKTFNRLETIKKVCRENGVLEKRKSYV  382



>gb|ABI14439.1| squalene synthase [Taxus cuspidata]
Length=409

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P +IWSKYV  LE+LK EE S  AVQCLN+M+T+AL H  DCL YM+AL++P+IFRFCAI
Sbjct  229  PHEIWSKYVPNLEDLKEEECSKEAVQCLNEMITNALKHANDCLKYMAALKNPAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMA+ TL +CYNN+ VFR VVK+RRGLTAK++DRT++M DVY  FFDFS  L SKV  
Sbjct  289  PQIMALATLEICYNNLQVFRRVVKIRRGLTAKIMDRTKSMADVYEAFFDFSGSLASKVPK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            +DP A+ TLK ++ I +TC  SG + KR+S+ + ++  +
Sbjct  349  DDPNATVTLKYIDEIQRTCNASGLMAKRRSFTIDSKKGH  387



>gb|AEX58673.1| squalene synthase [Huperzia serrata]
Length=420

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P +IW KY  +L + K E+ S  ++ CLNDM+T+AL H  D L YMSALRD +IFRFCAI
Sbjct  229  PHEIWGKYSARLADFKEEKKSDVSLACLNDMITNALEHAIDSLQYMSALRDGAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAI TLA CYNNI VFRGVVK+RRGL AK++  T +M+DVY  F+DFS ML +K+D 
Sbjct  289  PQIMAIATLAACYNNIQVFRGVVKIRRGLAAKIVLETSSMKDVYSTFYDFSNMLTAKIDK  348

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSY  315
             DP++S T+K +E IL TCR SG  + R  +
Sbjct  349  QDPSSSTTMKHVENILSTCRASGIPHNRSLF  379



>ref|XP_009138586.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=270

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+ W KYV+KLE+LK E+ S  AVQCLNDM+T+AL HVEDCL  M+AL DP+I + C+I
Sbjct  140  PRETWGKYVDKLEDLKDEDKSTKAVQCLNDMITNALIHVEDCLKSMAALHDPAILQSCSI  199

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKV  414
            P I+AIGTLA+CYNN+ VFRG +K+RRGL AKV DRT+TM+DV G F+DFSCML++KV
Sbjct  200  PLIVAIGTLALCYNNVQVFRGSLKLRRGLIAKVFDRTKTMDDVCGAFYDFSCMLETKV  257



>ref|XP_001775898.1| predicted protein [Physcomitrella patens]
 gb|EDQ59263.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P ++W KY  KLE+ K+E+NS NA++CLN ++T+AL+H  DCL YM  +      RFCAI
Sbjct  229  PHEVWGKYATKLEDFKHEDNSQNALRCLNALITNALAHATDCLKYMEDINQEDNLRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAI TLA CYNNI VFRGVVK+RRG+TAK++ +TRTM DVYG FFDFS  + +K+D 
Sbjct  289  PQIMAIATLAECYNNINVFRGVVKIRRGITAKIM-QTRTMGDVYGTFFDFSKKIAAKIDD  347

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  312
            ND +AS T K +E I + C +S  L   KSYI
Sbjct  348  NDDSASVTRKHIEDIQEYC-ESHLLEPEKSYI  378



>ref|XP_001773253.1| predicted protein [Physcomitrella patens]
 gb|EDQ61943.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P +IW K+  +LE+ K EENS NAV+CLN M+T+AL+H  DCL Y+ A +D S  RFCAI
Sbjct  176  PHEIWGKFGTRLEDFKLEENSENAVRCLNAMITNALTHATDCLKYIEANKDESNLRFCAI  235

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMAIGTLA CYNNI VFRGVVK+RRG+TAKV+ +T+T+ DVYG FFDFS  +  K+  
Sbjct  236  PQIMAIGTLAECYNNINVFRGVVKIRRGITAKVM-QTKTISDVYGTFFDFSRKIAEKIGE  294

Query  407  NDPTASKTLKRLEIILKTC  351
            ND +AS T K +E I + C
Sbjct  295  NDDSASATRKHIEDIQEYC  313



>ref|XP_002971951.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
 gb|EFJ26868.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
Length=392

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 2/150 (1%)
 Frame = -3

Query  767  PRQIWSKYV--NKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFC  594
            PR+IW KY   + L + + E N   AV+CLNDM+TD L H  +CL YMS L++PS+FRFC
Sbjct  243  PREIWGKYAPTSLLSDFRDESNEKEAVECLNDMITDCLRHAPECLFYMSKLKNPSVFRFC  302

Query  593  AIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKV  414
            A+PQ+MAI T A+CYNN  VFRGVVK+RRG TAK+I  T  M DV G F+DF+ +L SK+
Sbjct  303  AVPQVMAIATAAVCYNNPQVFRGVVKIRRGTTAKIIVTTNNMADVCGAFYDFASILASKI  362

Query  413  DHNDPTASKTLKRLEIILKTCRDSGTLNKR  324
            + NDP+A    +R+E I K CR  G  + R
Sbjct  363  NKNDPSALIAAERVENIFKACRQYGLSSSR  392



>ref|XP_008796682.1| PREDICTED: squalene synthase-like isoform X3 [Phoenix dactylifera]
Length=378

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 103/159 (65%), Gaps = 31/159 (19%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKY +KLE+LKYEENS  AVQCLNDM                             
Sbjct  229  PREIWSKYASKLEDLKYEENSTKAVQCLNDM-----------------------------  259

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
              IMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK+D 
Sbjct  260  --IMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSKIDD  317

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  291
            NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  318  NDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  356



>gb|KDO43895.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=340

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRFCAI
Sbjct  229  PREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRFCAI  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGL  501
            PQIMAIGTLA+CYNNI VFRGVVKMRRG+
Sbjct  289  PQIMAIGTLALCYNNIEVFRGVVKMRRGM  317



>emb|CEF97547.1| Squalene/phytoene synthase, partial [Ostreococcus tauri]
Length=397

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 108/162 (67%), Gaps = 1/162 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR +WSKY  +L+EL++EEN   AVQC+N+++T+ALSH  DCL YM  +++PSIFRFCAI
Sbjct  231  PRSVWSKYAKELDELQHEENHEKAVQCMNELITNALSHTTDCLKYMGRIKEPSIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVD-  411
            PQ+MAI TLA CY N+ VF+GVVK+RRGL+A+++     M +   GF  F+  L  KVD 
Sbjct  291  PQVMAIATLAECYGNVNVFKGVVKIRRGLSARIMLNCNNMYEFAKGFKHFASELVHKVDP  350

Query  410  HNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  285
             NDP   +T++R+E + + C         +  + R E +  P
Sbjct  351  RNDPNGEETMQRIEALEEACDKIIAEESERMQLSRIEDDTIP  392



>ref|XP_001756673.1| predicted protein [Physcomitrella patens]
 gb|EDQ78627.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 1/140 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            P+++WSKY +K E    E N    + CLN+MVTDALSH  DCL YM+AL+D    RFCA 
Sbjct  229  PKEVWSKYADKPEAFMDETNYKQGLHCLNEMVTDALSHGLDCLHYMAALQDQPNLRFCAT  288

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
             QI A+GTLAMCYNN+ VFRG V+MRRGLTAK++D  + M DVYG F+DF+ ++ +K+D 
Sbjct  289  FQITALGTLAMCYNNVEVFRGSVRMRRGLTAKILD-VKNMVDVYGAFYDFTRLIAAKIDK  347

Query  407  NDPTASKTLKRLEIILKTCR  348
             DP+A  T K ++ I   CR
Sbjct  348  TDPSAVTTHKFVDDIRSICR  367



>gb|EEC81691.1| hypothetical protein OsI_25282 [Oryza sativa Indica Group]
Length=273

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 98/148 (66%), Gaps = 19/148 (13%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR+IWSKYV+KLE+LKYE NSV AV+CLN+MVT+ L H EDCL YMSAL+D +I RFCAI
Sbjct  113  PREIWSKYVDKLEDLKYENNSVKAVKCLNEMVTNGLIHTEDCLRYMSALKDITILRFCAI  172

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQ     TL                  GLTA++I+ T +M DVY  F++FS +L  K+D 
Sbjct  173  PQHSC--TLI-----------------GLTARIINETNSMADVYTAFYEFSSLLAEKIDD  213

Query  407  NDPTASKTLKRLEIILKTCRDSGTLNKR  324
            NDP AS T KR+  I +TC+ SG L  R
Sbjct  214  NDPNASLTRKRVNAIKETCKSSGLLKIR  241



>ref|XP_001417488.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95781.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR +WSKY  +L++L++EEN   AVQC+N+++T+ALSH  DCL YMS +++ SIFRFCAI
Sbjct  231  PRSVWSKYAEELDDLQHEENREKAVQCMNELITNALSHSLDCLKYMSRVKEISIFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVD-  411
            PQ+MAI TLA CY N  VF+GVVK+RRGL+A+++ +   M ++  GF  F+  L  KVD 
Sbjct  291  PQVMAIATLAECYGNENVFKGVVKIRRGLSARIMLKCNNMLELASGFKHFANELVHKVDP  350

Query  410  HNDPTASKTLKRLEIILKTC  351
             +DP   +T+ R+E + + C
Sbjct  351  KSDPNGEETMARIEALEEAC  370



>gb|KIZ04121.1| farnesyl-diphosphatefarnesyltransferase [Monoraphidium neglectum]
Length=493

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR++W +Y + L+E K   N   A+ CLND+VTDAL HV  C+ ++  LRDP +FRFCAI
Sbjct  240  PREVWGRYASSLDEFKDPANRTAAIHCLNDLVTDALRHVPHCVAFLQQLRDPDVFRFCAI  299

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK---  417
            PQIMA GTL++CYNN GVF G VK+RRG TA+V D  RTM DV+  F  +  +L+ K   
Sbjct  300  PQIMAAGTLSLCYNNGGVFEGAVKLRRGETARVFDELRTMADVHAWFGRYLRLLRRKALS  359

Query  416  VDHNDPTASKTLKRLEIILKTCRDSGT  336
            V  +DPTA +    ++  LK   D G+
Sbjct  360  VASHDPTAKEARAAVDSCLKIV-DEGS  385



>ref|XP_001703447.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06129.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
Length=378

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = -3

Query  767  PRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAI  588
            PR IW KY   L + K   N   AV+CLNDM+TDAL H+  CL YM  LR   +FRFCAI
Sbjct  231  PRDIWGKYAPALADFKEPANRGAAVRCLNDMITDALRHLPYCLAYMEQLRHVMVFRFCAI  290

Query  587  PQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDH  408
            PQIMA GTLA CYNN  VF GVVKMRRG TA++ +    + D+Y  F  F   +++KVD 
Sbjct  291  PQIMAAGTLAACYNNGRVFEGVVKMRRGETARIFETCNDLGDLYTWFLQFLAAMEAKVDP  350

Query  407  NDPTASKTLKRLEIILKTC  351
             DP+   T +R+    K C
Sbjct  351  TDPSLPLTRQRIAEARKAC  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100