BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006I15

Length=791
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611045.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    303   2e-97   Nicotiana tomentosiformis
ref|XP_009803786.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    302   7e-97   Nicotiana sylvestris
dbj|BAK32933.1|  mid1-complementing activity 2                          302   8e-97   Nicotiana tabacum [American tobacco]
ref|XP_006343349.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    300   3e-96   Solanum tuberosum [potatoes]
ref|XP_004232512.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    300   7e-96   Solanum lycopersicum
ref|XP_006340771.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    299   1e-95   Solanum tuberosum [potatoes]
ref|XP_009801746.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    298   2e-95   Nicotiana sylvestris
ref|XP_009624357.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    295   5e-94   Nicotiana tomentosiformis
emb|CBI22120.3|  unnamed protein product                                280   1e-89   Vitis vinifera
ref|XP_002272810.2|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    281   1e-88   Vitis vinifera
ref|XP_007046628.1|  PLAC8 family protein                               279   6e-88   
emb|CDP01861.1|  unnamed protein product                                278   3e-87   Coffea canephora [robusta coffee]
gb|KJB43289.1|  hypothetical protein B456_007G192000                    275   3e-86   Gossypium raimondii
ref|XP_006383064.1|  hypothetical protein POPTR_0005s11200g             275   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_010113307.1|  hypothetical protein L484_026637                   271   5e-86   
ref|XP_011043148.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    273   2e-85   Populus euphratica
ref|XP_011099884.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    272   3e-85   
ref|XP_010266008.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    268   1e-83   Nelumbo nucifera [Indian lotus]
gb|KDP23985.1|  hypothetical protein JCGZ_25373                         266   4e-83   Jatropha curcas
gb|KJB17606.1|  hypothetical protein B456_003G007400                    266   9e-83   Gossypium raimondii
ref|XP_008393931.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    263   7e-82   
gb|KHG25004.1|  mid1-complementing activity 1 -like protein             262   2e-81   Gossypium arboreum [tree cotton]
ref|XP_007202160.1|  hypothetical protein PRUPE_ppa006351mg             262   3e-81   Prunus persica
ref|XP_008242040.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    261   6e-81   Prunus mume [ume]
ref|XP_009379353.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    259   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_008448524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    259   6e-80   Cucumis melo [Oriental melon]
ref|XP_006425392.1|  hypothetical protein CICLE_v10025703mg             258   9e-80   
ref|XP_006466999.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    258   9e-80   Citrus sinensis [apfelsine]
gb|KDO71305.1|  hypothetical protein CISIN_1g014734mg                   258   9e-80   Citrus sinensis [apfelsine]
ref|XP_009363461.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    258   1e-79   
ref|XP_004146155.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    257   2e-79   Cucumis sativus [cucumbers]
ref|XP_004159726.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...    257   3e-79   
ref|XP_008807147.1|  PREDICTED: cell number regulator 13-like           256   6e-79   Phoenix dactylifera
ref|XP_008352422.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    254   2e-78   Malus domestica [apple tree]
ref|XP_008809426.1|  PREDICTED: cell number regulator 13-like iso...    254   6e-78   
ref|XP_008809427.1|  PREDICTED: cell number regulator 13-like iso...    252   2e-77   
ref|XP_010933352.1|  PREDICTED: cell number regulator 13-like iso...    252   2e-77   Elaeis guineensis
ref|XP_010920111.1|  PREDICTED: cell number regulator 13-like           251   6e-77   Elaeis guineensis
ref|XP_010266845.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    249   2e-76   Nelumbo nucifera [Indian lotus]
ref|XP_010029652.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    248   6e-76   Eucalyptus grandis [rose gum]
ref|XP_010029651.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    248   6e-76   Eucalyptus grandis [rose gum]
ref|XP_004512157.1|  PREDICTED: cell number regulator 13-like iso...    247   2e-75   
ref|XP_010933353.1|  PREDICTED: cell number regulator 13-like iso...    245   5e-75   
ref|XP_007157885.1|  hypothetical protein PHAVU_002G106200g             245   9e-75   Phaseolus vulgaris [French bean]
ref|XP_004287784.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    245   9e-75   Fragaria vesca subsp. vesca
ref|XP_006412042.1|  hypothetical protein EUTSA_v10025310mg             245   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_010935125.1|  PREDICTED: cell number regulator 13-like           245   1e-74   Elaeis guineensis
gb|KCW53202.1|  hypothetical protein EUGRSUZ_J02474                     242   2e-74   Eucalyptus grandis [rose gum]
gb|KHN41878.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   246   3e-74   Glycine soja [wild soybean]
ref|XP_006572883.1|  PREDICTED: uncharacterized protein LOC100811...    244   3e-74   
ref|XP_008806599.1|  PREDICTED: cell number regulator 13-like iso...    244   4e-74   
ref|XP_008806598.1|  PREDICTED: cell number regulator 13-like iso...    243   4e-74   
ref|XP_003612221.1|  hypothetical protein MTR_5g022670                  243   5e-74   Medicago truncatula
gb|KHN36012.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   241   2e-73   Glycine soja [wild soybean]
ref|XP_004509394.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    240   8e-73   Cicer arietinum [garbanzo]
gb|KCW53201.1|  hypothetical protein EUGRSUZ_J02474                     237   2e-72   Eucalyptus grandis [rose gum]
ref|XP_009386555.1|  PREDICTED: cell number regulator 13-like iso...    236   5e-71   
ref|XP_009418750.1|  PREDICTED: cell number regulator 13-like           234   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408216.1|  PREDICTED: cell number regulator 13-like iso...    233   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH20129.1|  AT4G35920                                              233   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195317.2|  protein MID1-complementing activity 1                 233   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30814.1|  hypothetical protein MIMGU_mgv1a007258mg                232   1e-69   Erythranthe guttata [common monkey flower]
emb|CDX75539.1|  BnaA01g01630D                                          232   1e-69   
ref|XP_010531102.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    231   2e-69   
emb|CAA18486.1|  putative protein                                       231   3e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69186.1|  BnaC01g02670D                                          231   5e-69   
ref|XP_002867046.1|  hypothetical protein ARALYDRAFT_491044             230   5e-69   
ref|XP_010526810.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    229   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_003629262.1|  Cornifelin                                         229   2e-68   Medicago truncatula
ref|XP_009148721.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    228   3e-68   Brassica rapa
ref|XP_006282626.1|  hypothetical protein CARUB_v10004901mg             228   4e-68   Capsella rubella
ref|XP_010446852.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    227   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009138395.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    226   2e-67   Brassica rapa
ref|XP_006574663.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    226   3e-67   Glycine max [soybeans]
ref|XP_003519857.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    226   3e-67   
ref|XP_010033519.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    227   3e-67   Eucalyptus grandis [rose gum]
emb|CDY47043.1|  BnaAnng08310D                                          226   3e-67   Brassica napus [oilseed rape]
gb|KHN35538.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   226   3e-67   Glycine soja [wild soybean]
ref|XP_003548830.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    225   4e-67   Glycine max [soybeans]
ref|NP_001049013.1|  Os03g0157300                                       225   6e-67   
ref|XP_010432209.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    224   1e-66   Camelina sativa [gold-of-pleasure]
emb|CDX72565.1|  BnaC07g45870D                                          223   4e-66   
ref|XP_006649427.1|  PREDICTED: cell number regulator 13-like           222   6e-66   Oryza brachyantha
ref|XP_006846924.1|  hypothetical protein AMTR_s00152p00084120          221   2e-65   Amborella trichopoda
ref|XP_007156188.1|  hypothetical protein PHAVU_003G265800g             219   1e-64   Phaseolus vulgaris [French bean]
gb|EMS65760.1|  hypothetical protein TRIUR3_02105                       216   3e-64   Triticum urartu
ref|XP_010113309.1|  hypothetical protein L484_026640                   216   1e-63   
gb|ACN26521.1|  unknown                                                 216   2e-63   Zea mays [maize]
ref|XP_008440854.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    216   2e-63   
ref|XP_004985646.1|  PREDICTED: cell number regulator 13-like           216   2e-63   Setaria italica
ref|XP_009408218.1|  PREDICTED: cell number regulator 13-like iso...    214   5e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408217.1|  PREDICTED: cell number regulator 13-like iso...    214   6e-63   
ref|XP_002468480.1|  hypothetical protein SORBIDRAFT_01g046630          213   2e-62   Sorghum bicolor [broomcorn]
ref|XP_010680410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    213   3e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003558777.1|  PREDICTED: cell number regulator 13                212   5e-62   Brachypodium distachyon [annual false brome]
ref|NP_001182136.1|  cell number regulator 13                           212   6e-62   Zea mays [maize]
ref|XP_004135021.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    212   7e-62   Cucumis sativus [cucumbers]
gb|AAK32909.1|AF367322_1  AT4g35920/F4B14_190                           211   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006599313.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    209   1e-60   
ref|XP_011074700.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    207   4e-60   Sesamum indicum [beniseed]
ref|XP_010489410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    207   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010489415.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    207   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006297774.1|  hypothetical protein CARUB_v10013809mg             202   4e-58   Capsella rubella
ref|XP_008809428.1|  PREDICTED: cell number regulator 13-like iso...    200   2e-57   
ref|XP_008242042.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    199   2e-57   Prunus mume [ume]
gb|ABR16594.1|  unknown                                                 200   2e-57   Picea sitchensis
ref|XP_010692506.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    197   2e-56   
gb|EYU17580.1|  hypothetical protein MIMGU_mgv1a007522mg                197   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_006409246.1|  hypothetical protein EUTSA_v10023167mg             196   3e-56   
ref|XP_010413502.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   7e-56   Camelina sativa [gold-of-pleasure]
gb|KJB17609.1|  hypothetical protein B456_003G007400                    195   7e-56   Gossypium raimondii
ref|XP_010467574.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    195   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010680412.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    194   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010467573.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    194   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002886128.1|  hypothetical protein ARALYDRAFT_480672             194   3e-55   
ref|NP_001031366.1|  protein MID1-complementing activity 2              191   9e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KDO71309.1|  hypothetical protein CISIN_1g014734mg                   190   9e-54   Citrus sinensis [apfelsine]
pir||D84556  hypothetical protein At2g17780 [imported] - Arabidop...    189   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179369.2|  protein MID1-complementing activity 2                 189   3e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30346.1|  BnaA09g09310D                                          188   4e-53   Brassica napus [oilseed rape]
gb|KCW53204.1|  hypothetical protein EUGRSUZ_J02474                     186   7e-53   Eucalyptus grandis [rose gum]
ref|XP_009112457.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    187   8e-53   
ref|XP_009112455.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    187   1e-52   Brassica rapa
ref|XP_009112456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    187   1e-52   Brassica rapa
gb|KCW56602.1|  hypothetical protein EUGRSUZ_I02323                     188   2e-52   Eucalyptus grandis [rose gum]
ref|XP_011083456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    182   1e-50   Sesamum indicum [beniseed]
emb|CDY26830.1|  BnaC09g09570D                                          181   2e-50   Brassica napus [oilseed rape]
ref|NP_001031367.1|  protein MID1-complementing activity 2              181   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004512162.1|  PREDICTED: cell number regulator 13-like iso...    177   4e-49   
ref|XP_009386557.1|  PREDICTED: cell number regulator 13-like iso...    171   1e-46   
gb|EPS70744.1|  mid1-complementing activity 2                           169   3e-46   Genlisea aurea
gb|AFK40961.1|  unknown                                                 166   8e-45   Lotus japonicus
ref|XP_006574667.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    165   1e-44   
gb|EEE65313.1|  hypothetical protein OsJ_20556                          166   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|KDP44714.1|  hypothetical protein JCGZ_01214                         154   3e-40   Jatropha curcas
ref|XP_010087526.1|  hypothetical protein L484_006931                   150   8e-39   Morus notabilis
ref|XP_010067558.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    145   6e-37   
ref|XP_009386556.1|  PREDICTED: cell number regulator 13-like iso...    144   2e-36   
ref|XP_009369211.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    138   2e-35   
ref|NP_001242304.1|  uncharacterized protein LOC100811369               140   5e-35   
ref|XP_006435802.1|  hypothetical protein CICLE_v10031760mg             138   2e-34   
gb|KHN38534.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   135   2e-33   Glycine soja [wild soybean]
ref|XP_006575552.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    135   3e-33   Glycine max [soybeans]
ref|XP_007008883.1|  PLAC8 family protein                               135   4e-33   
gb|KHG10652.1|  mid1-complementing activity 1 -like protein             133   9e-33   Gossypium arboreum [tree cotton]
ref|XP_008234071.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    132   3e-32   
ref|XP_008363765.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...    132   4e-32   
ref|XP_007219349.1|  hypothetical protein PRUPE_ppa019431mg             127   3e-30   
gb|ACF79860.1|  unknown                                                 118   8e-30   Zea mays [maize]
ref|XP_002520777.1|  conserved hypothetical protein                     125   1e-29   
ref|XP_010658233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   3e-29   Vitis vinifera
ref|XP_010658232.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   3e-29   Vitis vinifera
ref|XP_004235233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   4e-29   Solanum lycopersicum
ref|XP_010658231.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   4e-29   Vitis vinifera
ref|XP_003518431.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    123   5e-29   Glycine max [soybeans]
ref|XP_006356473.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   2e-27   Solanum tuberosum [potatoes]
ref|XP_002316192.2|  hypothetical protein POPTR_0010s19210g             119   2e-27   
ref|XP_006356472.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   5e-27   Solanum tuberosum [potatoes]
ref|XP_011035883.1|  PREDICTED: cell number regulator 13-like           116   1e-26   Populus euphratica
emb|CDP13977.1|  unnamed protein product                                115   4e-26   Coffea canephora [robusta coffee]
ref|XP_002970226.1|  hypothetical protein SELMODRAFT_93428              114   7e-26   
ref|XP_009386559.1|  PREDICTED: cell number regulator 13-like iso...    108   1e-23   
ref|XP_006599316.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  99.0    1e-20   
ref|XP_001785848.1|  predicted protein                                98.2    3e-20   
ref|XP_002978386.1|  hypothetical protein SELMODRAFT_418221           96.7    1e-19   
ref|XP_008440857.1|  PREDICTED: cell number regulator 13 isoform X2   95.1    3e-19   Cucumis melo [Oriental melon]
gb|KGN48940.1|  hypothetical protein Csa_6G507150                     94.7    4e-19   
ref|XP_001768983.1|  predicted protein                                95.1    5e-19   
ref|XP_010658234.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  90.1    3e-17   
ref|XP_010318233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  77.0    8e-13   
gb|AAM51833.1|AC105730_7  Unknown protein                             50.8    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006486524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  65.9    5e-09   
gb|KDO68875.1|  hypothetical protein CISIN_1g020555mg                 64.3    1e-08   Citrus sinensis [apfelsine]
gb|EMT07324.1|  hypothetical protein F775_31025                       59.7    2e-08   
ref|XP_002531154.1|  conserved hypothetical protein                   62.4    5e-08   
ref|XP_009604568.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  59.7    2e-07   Nicotiana tomentosiformis
ref|XP_010489416.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  60.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_008346854.1|  PREDICTED: uncharacterized protein LOC103409845  60.8    3e-07   Malus domestica [apple tree]
ref|XP_002964322.1|  hypothetical protein SELMODRAFT_28363            57.4    3e-07   
ref|XP_011097029.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    60.1    4e-07   Sesamum indicum [beniseed]
ref|XP_010265197.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  60.1    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010265196.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  60.1    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010045639.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  60.1    5e-07   Eucalyptus grandis [rose gum]
gb|KCW83842.1|  hypothetical protein EUGRSUZ_B00710                   60.1    5e-07   Eucalyptus grandis [rose gum]
emb|CAN71842.1|  hypothetical protein VITISV_036262                   60.1    6e-07   Vitis vinifera
ref|XP_010465946.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  57.4    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009025528.1|  hypothetical protein HELRODRAFT_189206           57.4    2e-06   Helobdella robusta
ref|XP_006485849.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  58.2    2e-06   Citrus sinensis [apfelsine]
ref|XP_009785412.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  57.0    2e-06   Nicotiana sylvestris
ref|XP_006826803.1|  hypothetical protein AMTR_s00010p00033430        56.2    2e-06   
ref|XP_009146119.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  56.2    2e-06   
gb|KJB39330.1|  hypothetical protein B456_007G006900                  58.2    2e-06   Gossypium raimondii
ref|XP_010506915.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  56.6    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006817786.1|  PREDICTED: cell number regulator 13-like         55.5    2e-06   Saccoglossus kowalevskii
ref|XP_010042703.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  55.8    2e-06   
ref|XP_007036477.1|  PLAC8 family protein                             57.0    2e-06   
ref|XP_007036475.1|  PLAC8 family protein                             57.8    3e-06   
ref|XP_010489915.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  55.5    3e-06   
ref|XP_006817787.1|  PREDICTED: cell number regulator 11-like         55.1    3e-06   Saccoglossus kowalevskii
ref|XP_008244010.1|  PREDICTED: leucine-rich repeat extensin-like...  57.8    3e-06   Prunus mume [ume]
ref|XP_002885257.1|  hypothetical protein ARALYDRAFT_479347           55.8    3e-06   
ref|XP_006826802.1|  hypothetical protein AMTR_s00010p00032660        56.6    4e-06   
ref|XP_009339371.1|  PREDICTED: proline-rich proteoglycan 2-like      57.4    4e-06   Pyrus x bretschneideri [bai li]
emb|CDX92237.1|  BnaA05g21700D                                        55.1    5e-06   
ref|XP_010527531.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 12   54.7    6e-06   Tarenaya hassleriana [spider flower]
ref|XP_009339439.1|  PREDICTED: uncharacterized protein LOC103931645  57.0    8e-06   
ref|XP_008244011.1|  PREDICTED: leucine-rich repeat extensin-like...  56.6    8e-06   Prunus mume [ume]
ref|XP_008393299.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  56.2    8e-06   
ref|XP_007036480.1|  PLAC8 family protein                             55.8    1e-05   
ref|XP_010663577.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    55.5    1e-05   Vitis vinifera
gb|EJT99228.1|  PLAC8-domain-containing protein                       54.3    1e-05   Dacryopinax primogenitus
ref|XP_002318695.2|  hypothetical protein POPTR_0012s09370g           53.5    2e-05   
ref|XP_009348105.1|  PREDICTED: proline-rich protein HaeIII subfa...  55.1    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_006826804.1|  hypothetical protein AMTR_s00010p00034340        53.5    2e-05   
ref|XP_006393318.1|  hypothetical protein EUTSA_v10011755mg           53.9    3e-05   Eutrema salsugineum [saltwater cress]
gb|KJB37241.1|  hypothetical protein B456_006G195300                  54.3    3e-05   Gossypium raimondii
ref|XP_006857399.1|  hypothetical protein AMTR_s00067p00142050        52.4    3e-05   Amborella trichopoda
ref|XP_006469221.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  52.8    3e-05   Citrus sinensis [apfelsine]
gb|KJB12064.1|  hypothetical protein B456_002G175600                  52.4    4e-05   Gossypium raimondii
ref|XP_007160407.1|  hypothetical protein PHAVU_002G319200g           52.4    4e-05   Phaseolus vulgaris [French bean]
ref|XP_007210160.1|  hypothetical protein PRUPE_ppa021734mg           54.3    4e-05   
ref|XP_004297458.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  52.8    4e-05   Fragaria vesca subsp. vesca
gb|KDO38128.1|  hypothetical protein CISIN_1g031916mg                 52.0    4e-05   Citrus sinensis [apfelsine]
ref|XP_009346952.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.6    4e-05   
emb|CDP00820.1|  unnamed protein product                              52.4    5e-05   Coffea canephora [robusta coffee]
ref|XP_008346788.1|  PREDICTED: proline-rich protein HaeIII subfa...  54.3    5e-05   Malus domestica [apple tree]
ref|XP_008244012.1|  PREDICTED: proline-rich protein 2-like           54.3    5e-05   Prunus mume [ume]
ref|XP_010066569.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2    52.4    5e-05   Eucalyptus grandis [rose gum]
ref|XP_007036476.1|  PLAC8 family protein                             53.9    5e-05   
ref|XP_011016153.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  52.4    6e-05   Populus euphratica
gb|AFM43805.1|  fruit weight 2.2-2 protein                            52.4    6e-05   Dimocarpus longan [longan]
ref|XP_006448197.1|  hypothetical protein CICLE_v10016920mg           51.6    6e-05   
ref|XP_009009567.1|  hypothetical protein HELRODRAFT_184849           51.2    6e-05   Helobdella robusta
ref|XP_001756741.1|  predicted protein                                50.8    7e-05   
ref|XP_006448196.1|  hypothetical protein CICLE_v10016920mg           52.0    7e-05   Citrus clementina [clementine]
ref|XP_007046277.1|  PLAC8 family protein, putative                   51.6    8e-05   
ref|XP_004297457.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.8    9e-05   Fragaria vesca subsp. vesca
ref|XP_006362555.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.2    9e-05   Solanum tuberosum [potatoes]
ref|NP_188474.1|  PLAC8 family protein                                51.6    9e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KCW64493.1|  hypothetical protein EUGRSUZ_G02100                   52.4    9e-05   Eucalyptus grandis [rose gum]
ref|XP_002527777.1|  conserved hypothetical protein                   51.6    1e-04   Ricinus communis
ref|XP_010068707.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.8    1e-04   
ref|XP_010265361.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  52.0    1e-04   Nelumbo nucifera [Indian lotus]
gb|KCW64542.1|  hypothetical protein EUGRSUZ_G02148                   50.8    1e-04   Eucalyptus grandis [rose gum]
ref|XP_004294816.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.2    1e-04   Fragaria vesca subsp. vesca
ref|XP_003382500.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    1e-04   Amphimedon queenslandica
ref|XP_004294815.1|  PREDICTED: cell number regulator 2-like          51.2    2e-04   Fragaria vesca subsp. vesca
ref|XP_006644037.1|  PREDICTED: cell number regulator 5-like          50.8    2e-04   Oryza brachyantha
ref|XP_006352289.1|  PREDICTED: cell number regulator 1-like          51.6    2e-04   
ref|XP_010070341.1|  PREDICTED: cell number regulator 2-like          50.4    2e-04   Eucalyptus grandis [rose gum]
ref|XP_011448416.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    2e-04   Crassostrea gigas
ref|XP_006965746.1|  predicted protein                                50.1    2e-04   Trichoderma reesei QM6a
ref|XP_004298295.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    2e-04   Fragaria vesca subsp. vesca
ref|XP_011465683.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    2e-04   Fragaria vesca subsp. vesca
ref|XP_006362573.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    2e-04   Solanum tuberosum [potatoes]
ref|XP_007047233.1|  Plant cadmium resistance 2                       51.2    2e-04   
ref|XP_002281039.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2    50.4    3e-04   Vitis vinifera
emb|CDX92238.1|  BnaA05g21690D                                        49.7    3e-04   
ref|NP_680337.2|  PLAC8 family protein                                49.7    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351523.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    3e-04   
ref|XP_011084083.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.4    3e-04   Sesamum indicum [beniseed]
ref|XP_004297456.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.4    3e-04   Fragaria vesca subsp. vesca
ref|XP_010920620.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.4    3e-04   Elaeis guineensis
ref|XP_001757562.1|  predicted protein                                48.5    4e-04   
ref|XP_003607993.1|  Placenta-specific gene 8 protein                 50.1    4e-04   
ref|XP_002310729.2|  hypothetical protein POPTR_0007s11140g           49.3    4e-04   
gb|AES90190.2|  fruit weight 2.2 protein                              50.1    4e-04   Medicago truncatula
gb|KDO70032.1|  hypothetical protein CISIN_1g041663mg                 49.3    4e-04   Citrus sinensis [apfelsine]
gb|KJB77671.1|  hypothetical protein B456_012G150200                  49.7    4e-04   Gossypium raimondii
ref|XP_010535733.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.3    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_006378441.1|  hypothetical protein POPTR_0010s11920g           50.1    4e-04   
ref|XP_009147919.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    50.4    4e-04   Brassica rapa
ref|XP_009761627.1|  PREDICTED: cell number regulator 2-like isof...  48.9    5e-04   Nicotiana sylvestris
ref|XP_010265195.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.8    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010269384.1|  PREDICTED: cell number regulator 1-like          49.3    5e-04   Nelumbo nucifera [Indian lotus]
dbj|BAK07354.1|  predicted protein                                    49.7    5e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010266903.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    5e-04   Nelumbo nucifera [Indian lotus]
gb|KJB77672.1|  hypothetical protein B456_012G150200                  50.1    5e-04   Gossypium raimondii
ref|XP_004503375.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    5e-04   Cicer arietinum [garbanzo]
ref|XP_010044215.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    5e-04   
ref|XP_002511966.1|  structural constituent of cell wall, putative    50.8    6e-04   
ref|XP_002735356.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.1    6e-04   
ref|XP_011429582.1|  PREDICTED: cell number regulator 3-like          48.1    6e-04   
ref|XP_009761628.1|  PREDICTED: cell number regulator 2-like isof...  48.5    6e-04   
emb|CDY62851.1|  BnaA06g03340D                                        48.9    6e-04   
ref|XP_004238947.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.5    6e-04   
ref|XP_010551155.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    49.7    6e-04   
ref|NP_188475.1|  PLAC8 family protein                                49.3    6e-04   
gb|AFM43804.1|  fruit weight 2.2-1 protein                            49.3    6e-04   
ref|XP_010461829.1|  PREDICTED: LOW QUALITY PROTEIN: protein PLAN...  50.1    6e-04   
ref|NP_175332.1|  PLAC8 family protein                                49.7    7e-04   
emb|CDY71552.1|  BnaCnng73400D                                        49.7    7e-04   
gb|KCW83840.1|  hypothetical protein EUGRSUZ_B00708                   48.9    7e-04   
ref|NP_001031368.1|  protein MID1-complementing activity 2            50.4    7e-04   
ref|XP_010026670.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.5    7e-04   
ref|XP_009145891.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 7    48.1    7e-04   
ref|XP_006304539.1|  hypothetical protein CARUB_v10011498mg           49.7    7e-04   
ref|XP_002523567.1|  conserved hypothetical protein                   48.5    8e-04   
ref|XP_008789391.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    8e-04   
ref|XP_010068703.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.5    8e-04   
emb|CDY62854.1|  BnaA06g03310D                                        49.7    8e-04   
ref|XP_006355072.1|  PREDICTED: cell number regulator 2-like          49.3    8e-04   
gb|AFK38344.1|  unknown                                               48.9    8e-04   
ref|XP_009766449.1|  PREDICTED: cell number regulator 7-like          48.1    0.001   
ref|XP_011010193.1|  PREDICTED: cell number regulator 1-like          48.5    0.001   
ref|XP_010544048.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 9    48.1    0.001   
ref|XP_009617949.1|  PREDICTED: cell number regulator 2-like          48.1    0.001   



>ref|XP_009611045.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009611046.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCEFIQHLLDVTEVVA  SL  KS P KP  K++  YS+ DS  ++Y +SY K++EK
Sbjct  211  DVGQCEFIQHLLDVTEVVATNSLSLKSSPTKPPKKLDESYSNVDSYTEHYVESYAKSEEK  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
              TSRN SSVSSKH+L+SSKGSHRYEEWHSDLLGCCSEPLLCIKT+ FPCGTFS++A+ A
Sbjct  271  RETSRNASSVSSKHELLSSKGSHRYEEWHSDLLGCCSEPLLCIKTVFFPCGTFSKVASVA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +RHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL+I GGF+DDFLSHLMCCCCALV
Sbjct  331  ADRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLNIMGGFVDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG  G  KTK SPP++QFMES
Sbjct  391  QEWREVEIRGAHGLEKTKVSPPTSQFMES  419



>ref|XP_009803786.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009803787.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 180/209 (86%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCEFIQHLLDVTEVVA  SL  KS P KP  K++  YS+ DS   +Y +SY KNDEK
Sbjct  211  DVGQCEFIQHLLDVTEVVATNSLSLKSSPIKPPKKLDESYSNVDSYTDHYVESYAKNDEK  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSRNTSSVSSKH+L+SSKGSHRYEEWHSDLLGCCSEPLLCIKT+ FPCGTFS++A+ A
Sbjct  271  QATSRNTSSVSSKHELLSSKGSHRYEEWHSDLLGCCSEPLLCIKTVFFPCGTFSKVASVA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +RHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL+I GGF+DDFLSHLMCCCCALV
Sbjct  331  ADRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLNIMGGFVDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG  G  KTK  PP++Q MES
Sbjct  391  QEWREVEIRGTHGLEKTKVRPPTSQLMES  419



>dbj|BAK32933.1| mid1-complementing activity 2 [Nicotiana tabacum]
Length=419

 Score =   302 bits (773),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCEFIQHLLDVTEVVA  SL  KS P KP  K++  YS+ DS   +Y +SY KNDEK
Sbjct  211  DVGQCEFIQHLLDVTEVVATNSLSLKSSPIKPPKKLDESYSNVDSYTDHYVESYAKNDEK  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSRN SSVSSKH+L+SSKGSHRYEEWHSDLLGCCSEPLLCIKT+ FPCGTFS++A+ A
Sbjct  271  QATSRNASSVSSKHELLSSKGSHRYEEWHSDLLGCCSEPLLCIKTVFFPCGTFSKVASVA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +RHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL+I GGF+DDFLSHLMCCCCALV
Sbjct  331  ADRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLNIMGGFVDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG  G  KTK  PP++Q MES
Sbjct  391  QEWREVEIRGTHGLEKTKVRPPTSQLMES  419



>ref|XP_006343349.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343350.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006343351.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Solanum tuberosum]
Length=419

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 186/209 (89%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DVNQCEFIQHLLDVTEVVAA SL +KS P +P K +EH +SDA+SDK++ D+SY K+DEK
Sbjct  211  DVNQCEFIQHLLDVTEVVAAESLSEKSSPTQPTKKLEHSHSDANSDKEHSDKSYIKSDEK  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             STSRNTSSVSS+ +L+SSKGS+RYEEWH+DLLGCCSEPLLCIKT  FPCGTFS++A+ A
Sbjct  271  HSTSRNTSSVSSQRELLSSKGSYRYEEWHTDLLGCCSEPLLCIKTFFFPCGTFSKVASFA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             NR ISSA+ACNELMAYSLILSCCCYTCCIR+KLR+KL+I GG IDDFLSHLMCCCCALV
Sbjct  331  ANRDISSADACNELMAYSLILSCCCYTCCIRKKLRQKLNITGGIIDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE RE+EIRG  GT KTKTSPP +QFME+
Sbjct  391  QELREVEIRGANGTEKTKTSPPPSQFMET  419



>ref|XP_004232512.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
 ref|XP_010316435.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
Length=418

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 182/209 (87%), Gaps = 2/209 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCEFIQHLLDVTEVVA  SL  KS PAKPLK ++  YS+ D++K  YD  Y K+DEK
Sbjct  211  DVGQCEFIQHLLDVTEVVANNSLSLKSSPAKPLKKLDQSYSNVDTEKVYYD-DYAKSDEK  269

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSRNTSSV+S+HDL+SSKGSH+YEEWHSDLLGCCSEPLLCIKTL FPCGTFSRIA+ A
Sbjct  270  QTTSRNTSSVTSRHDLLSSKGSHQYEEWHSDLLGCCSEPLLCIKTLFFPCGTFSRIASVA  329

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG +DDFLSHLMCCCCALV
Sbjct  330  ADRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNIKGGCVDDFLSHLMCCCCALV  389

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE RE++IRG  G  KTK SPP+TQFMES
Sbjct  390  QELREVKIRGTHGIEKTKISPPTTQFMES  418



>ref|XP_006340771.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006340772.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
Length=418

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 182/209 (87%), Gaps = 2/209 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCEFIQHLLDVTEVVA  SL  KS PAKPLK ++  YS+ D++K  YD  Y K+DEK
Sbjct  211  DVGQCEFIQHLLDVTEVVATNSLSLKSSPAKPLKKLDLSYSNVDNEKVYYD-DYAKSDEK  269

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             STSRNTSSV+S+HDL+SSKGSHRYEEWHSDLLGCCSEPLLCIKTL FPCGTFSR+A+ A
Sbjct  270  QSTSRNTSSVTSRHDLLSSKGSHRYEEWHSDLLGCCSEPLLCIKTLFFPCGTFSRVASVA  329

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG +DDFLSHLMCCCCALV
Sbjct  330  EDRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNIRGGCVDDFLSHLMCCCCALV  389

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE RE++IRG  G  KTK SPP+TQFMES
Sbjct  390  QELREVKIRGTHGIEKTKISPPTTQFMES  418



>ref|XP_009801746.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009801747.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 186/209 (89%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DV+ CEFIQHLL+VTEVVA+ SL +KS P KP K +EH +SD +SDK++YD+SY K+DEK
Sbjct  211  DVSHCEFIQHLLEVTEVVASESLSEKSSPTKPTKKLEHSHSDVNSDKEHYDRSYTKSDEK  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             STSRNTSSVSS+ +L+SSKGS RY+EWHSDLLGCCSEPLLCIKT  FPCGTFS++A+AA
Sbjct  271  QSTSRNTSSVSSQRELLSSKGSDRYDEWHSDLLGCCSEPLLCIKTCFFPCGTFSKVASAA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG IDDFLSHLMCCCCALV
Sbjct  331  ADRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNITGGIIDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE RE+EIRG  GT KTKTSPP +QFMES
Sbjct  391  QELREVEIRGAHGTGKTKTSPPPSQFMES  419



>ref|XP_009624357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009624358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 dbj|BAK32932.1| mid1-complementing activity 1 [Nicotiana tabacum]
Length=419

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 184/209 (88%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DV+ CEFIQHLL+VTEVVA+ SL +KS P KP K +EH +SD +SDK++ D+SY K+DEK
Sbjct  211  DVSHCEFIQHLLEVTEVVASESLSEKSSPTKPTKKLEHSHSDVNSDKEHNDRSYTKSDEK  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             STSR TSSVSS+ +L+SSKGS RY+EWHSDLLGCCSEPLLCIKT  FPCGTFS++A+AA
Sbjct  271  QSTSRITSSVSSQRELLSSKGSDRYDEWHSDLLGCCSEPLLCIKTCFFPCGTFSKVASAA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG IDDFLSHLMCCCCALV
Sbjct  331  ADRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNITGGIIDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE RE+EIRG  GT KTKTSPP +QFMES
Sbjct  391  QELREVEIRGAHGTGKTKTSPPPSQFMES  419



>emb|CBI22120.3| unnamed protein product [Vitis vinifera]
Length=319

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 176/210 (84%), Gaps = 2/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            DV+QCE IQHL+ VTE VAA S+P+K+LP +   K E  YSDA+SDK+ + D+SY K  +
Sbjct  110  DVDQCEVIQHLIGVTEAVAANSVPEKNLPVRSSKKAESDYSDANSDKEYSVDESYPKRSD  169

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              + SRN SSVSS HDL+S++GSHR+EEWHSDLLGCCSEP LCIKT  +PCGTFS+IA+ 
Sbjct  170  TRTASRNISSVSSGHDLLSTRGSHRHEEWHSDLLGCCSEPSLCIKTFFYPCGTFSKIASV  229

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+SSAEACNELMAYS+ILSCCCYTCCIRRKLR  L+I GG  DDFLSHLMCCCCAL
Sbjct  230  ATNRHMSSAEACNELMAYSMILSCCCYTCCIRRKLRNMLNITGGLFDDFLSHLMCCCCAL  289

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KT+TSPP +Q+MES
Sbjct  290  VQEWREVEIRGVYGPEKTRTSPPPSQYMES  319



>ref|XP_002272810.2| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Vitis vinifera]
Length=420

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 176/210 (84%), Gaps = 2/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            DV+QCE IQHL+ VTE VAA S+P+K+LP +   K E  YSDA+SDK+ + D+SY K  +
Sbjct  211  DVDQCEVIQHLIGVTEAVAANSVPEKNLPVRSSKKAESDYSDANSDKEYSVDESYPKRSD  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              + SRN SSVSS HDL+S++GSHR+EEWHSDLLGCCSEP LCIKT  +PCGTFS+IA+ 
Sbjct  271  TRTASRNISSVSSGHDLLSTRGSHRHEEWHSDLLGCCSEPSLCIKTFFYPCGTFSKIASV  330

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+SSAEACNELMAYS+ILSCCCYTCCIRRKLR  L+I GG  DDFLSHLMCCCCAL
Sbjct  331  ATNRHMSSAEACNELMAYSMILSCCCYTCCIRRKLRNMLNITGGLFDDFLSHLMCCCCAL  390

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KT+TSPP +Q+MES
Sbjct  391  VQEWREVEIRGVYGPEKTRTSPPPSQYMES  420



>ref|XP_007046628.1| PLAC8 family protein [Theobroma cacao]
 gb|EOX90785.1| PLAC8 family protein [Theobroma cacao]
Length=421

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDK-QNYDQSYGKNDE  617
            DV QCE IQHLL+VTEV AATS+PDKS   K  K VE  YSDA+S+K  +YD+S     +
Sbjct  212  DVQQCEVIQHLLEVTEVAAATSIPDKSSSMKGSKKVERNYSDANSEKDHSYDESSPNKSD  271

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              +TSRNTSSVSS HDL+S +GSHRY+EWH+DLLGCCSEP LC+KT  +PCGTFS+IAT 
Sbjct  272  TRTTSRNTSSVSSGHDLLSDRGSHRYDEWHADLLGCCSEPYLCMKTFFYPCGTFSKIATV  331

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCAL
Sbjct  332  ATNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGFIDDFLSHLMCCCCAL  391

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+E+RG+ G  KT+ SPP +QFMES
Sbjct  392  VQEWREVEMRGVYGPEKTRISPPPSQFMES  421



>emb|CDP01861.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DVNQCE IQHLL+VTE VAATS+P+K  P K  K ++H +SD ++D ++Y + Y K+ +K
Sbjct  211  DVNQCEMIQHLLEVTEAVAATSVPEKVSPKKTSKEMDHSFSDLNNDNEHYGERYTKSVDK  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
               SRNTSSVSSKHDL+ S+GSH++EEWHSDLLGCCSEPLLCIKT  FPC TFSR+AT A
Sbjct  271  HPPSRNTSSVSSKHDLLDSQGSHQHEEWHSDLLGCCSEPLLCIKTFFFPCWTFSRVATVA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            T+R +SS+EACNE+MAYSLILSCCCYTCCIR+KLRK+L+I GG  DDFLSHLMCCCCALV
Sbjct  331  TSRRVSSSEACNEMMAYSLILSCCCYTCCIRQKLRKQLNIAGGLCDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE+RE++IRGI G  KTKTSPP++Q+MES
Sbjct  391  QEYREVKIRGIHGFEKTKTSPPASQYMES  419



>gb|KJB43289.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43290.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43291.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
Length=416

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 170/209 (81%), Gaps = 5/209 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK-QNYDQSYGKNDEK  614
            DV QCE IQHLL+VTEV AATS+PDK    +  KVE  YSDA+S+K  +YD+   K    
Sbjct  212  DVQQCEVIQHLLEVTEVAAATSVPDK----RSKKVERNYSDANSEKGHSYDEISPKKPGS  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
              TS NTSSVSS  DL+S +GS RY+EWH+DLLGCCSEP LCIKT   PCGT S+IAT A
Sbjct  268  RITSINTSSVSSGRDLLSDRGSDRYDEWHADLLGCCSEPYLCIKTFFCPCGTLSKIATVA  327

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCALV
Sbjct  328  TNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGFIDDFLSHLMCCCCALV  387

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG  G+ KTKTSPP +QFMES
Sbjct  388  QEWREVEIRGFNGSEKTKTSPPPSQFMES  416



>ref|XP_006383064.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
 gb|ERP60861.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
Length=419

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 176/209 (84%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DVNQCE IQHL++VTEV AA+SLP+KS   K  K +E  YSDA  +K ++D SY    + 
Sbjct  211  DVNQCEVIQHLIEVTEVAAASSLPEKSSSTKSSKKLEPAYSDASENKHSFDDSYSTKSDS  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
              TSRNTSSVSS+ DL+SS+GSH+ EEWH+DLLGCCSEP LCIKTL +PCGTF++IAT A
Sbjct  271  HKTSRNTSSVSSRDDLLSSRGSHQQEEWHADLLGCCSEPYLCIKTLFYPCGTFAKIATVA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             NRHISSAEACNELMAYS++LSCCCYTCC+RR+LRK L+I GGFIDDFLSHLMCCCCALV
Sbjct  331  KNRHISSAEACNELMAYSMMLSCCCYTCCVRRELRKTLNITGGFIDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG+ G  KTKTSPP +QFMES
Sbjct  391  QEWREVEIRGVYGPEKTKTSPPPSQFMES  419



>ref|XP_010113307.1| hypothetical protein L484_026637 [Morus notabilis]
 gb|EXC35314.1| hypothetical protein L484_026637 [Morus notabilis]
Length=320

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 172/210 (82%), Gaps = 2/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQNY-DQSYGKNDE  617
            DVNQCE IQ L+DVTE VA  ++PDKS P K   K+E  YSD +S+K++  D+ Y K  +
Sbjct  111  DVNQCEVIQRLIDVTETVAENTVPDKSSPEKSHKKMERNYSDDNSEKEDSSDEKYSKRGD  170

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
               TSRNTSSVSS HDL+S++ SHR+EEW +DLLGCCSEP LCIKT  +PCGTFS+IAT 
Sbjct  171  SRVTSRNTSSVSSGHDLLSTRWSHRHEEWSNDLLGCCSEPSLCIKTFFYPCGTFSKIATV  230

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A NRH+S AEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCAL
Sbjct  231  AKNRHMSPAEACNELMAYSLILSCCCYTCCIRRKLRKTLNITGGFIDDFLSHFMCCCCAL  290

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  291  VQEWREVEIRGVYGPEKTKTSPPPSQYMES  320



>ref|XP_011043148.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
 ref|XP_011043149.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
Length=419

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 175/209 (84%), Gaps = 1/209 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DVNQCE IQHL++VTEV AATSLP+KS   K  K +E  YSD   +K ++D +Y    + 
Sbjct  211  DVNQCEVIQHLIEVTEVAAATSLPEKSSSTKSSKKLEPTYSDVSENKHSFDDNYSTKSDS  270

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
              TSRNTSSVSS+ DL+SS+GSH +EEWH+DLLGCCSEP LCIKTL +PCGTF++IAT A
Sbjct  271  HKTSRNTSSVSSRDDLLSSRGSHHHEEWHADLLGCCSEPYLCIKTLFYPCGTFAKIATVA  330

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             NRHISSAEACNELMAYS++LSCCCYTCC+RR+LRK L+I GGFIDDFLSHLMCCCCALV
Sbjct  331  KNRHISSAEACNELMAYSMMLSCCCYTCCVRRELRKTLNITGGFIDDFLSHLMCCCCALV  390

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG+ G  KTKTSPP +QFMES
Sbjct  391  QEWREVEIRGVYGPEKTKTSPPPSQFMES  419



>ref|XP_011099884.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099885.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099886.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099887.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
Length=416

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV QCE IQHLL+VTE VAA SLP+K+   K  KVE  Y D  S+K++YD++Y +N EK 
Sbjct  211  DVGQCEVIQHLLEVTEAVAANSLPEKTSFTKESKVEQVYVDVSSEKEHYDKNYSRNSEKQ  270

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
              S NTSSVSS+ DL+S KG+   +EWHSDLLGCCSEPLLC+KT+LFPCGTFSRIA+ AT
Sbjct  271  EASGNTSSVSSRRDLLSFKGAQ--DEWHSDLLGCCSEPLLCLKTMLFPCGTFSRIASVAT  328

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NRHIS AEACN+LMAYSLILSCCCYTCCIR+KLR  L+I GG  DDFLSHLMCCCCALVQ
Sbjct  329  NRHISPAEACNDLMAYSLILSCCCYTCCIRKKLRGMLNIKGGLFDDFLSHLMCCCCALVQ  388

Query  250  EWreieirgieGTHKTKTSPPSTQFME  170
            EWRE+EIR ++G  KT T PP+ Q++E
Sbjct  389  EWREVEIRQVKGHQKTTTCPPTIQYIE  415



>ref|XP_010266008.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266009.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266010.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=420

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 172/210 (82%), Gaps = 3/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDK-QNYDQSYGKNDE  617
            DV QCE IQ LL+VTEV AA+SLPDK  P K   KVE  YSDA +DK  ++D+ Y   ++
Sbjct  212  DVGQCEVIQRLLEVTEV-AASSLPDKDSPDKSSKKVEPKYSDAHNDKLHSFDERYHGEND  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
             +  SR TS VSS HDL+S++GSHR+EEWHSDLLGCCSEP LC++T  +PCGTFS+IAT 
Sbjct  271  TYVPSRTTSLVSSGHDLLSTRGSHRHEEWHSDLLGCCSEPYLCMRTFFYPCGTFSKIATV  330

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+S AEACNELMAYSLILSCCCYTCCIRRKLRK L+I GG  DDFLSHL+CCCCAL
Sbjct  331  ATNRHMSPAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGLCDDFLSHLICCCCAL  390

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KTKTSPP +Q+ME+
Sbjct  391  VQEWREVEIRGVYGPGKTKTSPPPSQYMEA  420



>gb|KDP23985.1| hypothetical protein JCGZ_25373 [Jatropha curcas]
Length=415

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 164/209 (78%), Gaps = 5/209 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQNYDQSYGKNDEK  614
            DVNQCE IQHL++VTE   A S+P KS P K   K+E  YSD      +YD++Y K +  
Sbjct  211  DVNQCEVIQHLIEVTEAAVANSVPQKSSPVKASKKLEPSYSDVSEKNHSYDEAYPKKNN-  269

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
               SR TS  +S  DL+S KGS+R EEWH+DLLGCCSEP LC++T  +PCGT S+IAT A
Sbjct  270  ---SRTTSRNTSGDDLLSRKGSYRDEEWHTDLLGCCSEPSLCMRTFFYPCGTISKIATVA  326

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNRH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+DDFLSHLMCCCCALV
Sbjct  327  TNRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGFVDDFLSHLMCCCCALV  386

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE+RE+EIRG+ G  KTK SPP +QFMES
Sbjct  387  QEYREVEIRGVYGPEKTKISPPPSQFMES  415



>gb|KJB17606.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17607.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17608.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=418

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 172/210 (82%), Gaps = 4/210 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDK-QNYDQSYGKNDE  617
            DV QCE IQHLLDVTEV  A S+PDKS   K  K  E  YSD D++   +Y+ +  K  +
Sbjct  211  DVKQCEVIQHLLDVTEV--AASIPDKSSSPKVSKKVERNYSDVDNENGHSYNDNSPKKPD  268

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
               TSRNTSSVSS HDL+S +GSHRYEEW++DLLGCCSEP LCIKT  +PCGTFS+IAT 
Sbjct  269  SRMTSRNTSSVSSGHDLLSDRGSHRYEEWNADLLGCCSEPSLCIKTFFYPCGTFSKIATV  328

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGF+DDFLSHLMCCCCAL
Sbjct  329  ATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGFVDDFLSHLMCCCCAL  388

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRGI G  KTKTSPP +QFMES
Sbjct  389  VQEWREVEIRGIYGPEKTKTSPPPSQFMES  418



>ref|XP_008393931.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393938.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393943.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393951.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393959.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
Length=408

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 173/210 (82%), Gaps = 11/210 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQ-NYDQSYGKNDEK  614
            DV+QCE IQ LL+VTE VAA S P+K++     KV+  +SDA+++K+ + ++SY KN+ +
Sbjct  208  DVSQCEVIQRLLEVTETVAAESSPEKNIE----KVDRSHSDANNEKEHSSNESYKKNESR  263

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
                  TS  +S+HDL+S++GSHR EEW++DLLGCCSEP LCIKT  +PCGTFS+IA+AA
Sbjct  264  -----KTSRNTSRHDLLSTRGSHRNEEWNTDLLGCCSEPALCIKTFFYPCGTFSKIASAA  318

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNR +SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCALV
Sbjct  319  TNRPMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKXLNISGGFIDDFLSHFMCCCCALV  378

Query  253  QEWreieirgi-eGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG+  G  KTK SPP++Q+ME+
Sbjct  379  QEWREVEIRGVHYGAEKTKVSPPASQYMET  408



>gb|KHG25004.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=418

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 172/210 (82%), Gaps = 4/210 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDK-QNYDQSYGKNDE  617
            DV QCE IQHLLDVTEV  A S+PDKS   K  K  E  YSD D++K  +Y+ +  K  +
Sbjct  211  DVKQCEVIQHLLDVTEV--AASIPDKSSSPKVSKKVERNYSDVDNEKGHSYNDNSPKKPD  268

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
               TSRNTSSVSS HDL+S +GSHRYEEW++DLLGC SEP LCIKT  +PCGTFS+IAT 
Sbjct  269  SRMTSRNTSSVSSGHDLLSDRGSHRYEEWNADLLGCFSEPSLCIKTFFYPCGTFSKIATV  328

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATN+H+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGF+DDFLSHLMCCCCAL
Sbjct  329  ATNKHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGFVDDFLSHLMCCCCAL  388

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRGI G  KTKTSPP +QFMES
Sbjct  389  VQEWREVEIRGIYGPEKTKTSPPPSQFMES  418



>ref|XP_007202160.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
 gb|EMJ03359.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
Length=416

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 176/210 (84%), Gaps = 7/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQ-NYDQSYGKNDEK  614
            DV+QCE IQ LL+VTE VA+ S P+K+      K+E  YSDA+S+K+ + ++SY K++ +
Sbjct  212  DVSQCEVIQRLLEVTETVASKSSPEKNNK----KIERNYSDANSEKEPSSNESYQKSESR  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
               SRNTSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT  +PCGTFS+IA+ A
Sbjct  268  -KMSRNTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPSLCIKTFFYPCGTFSKIASVA  326

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNRH+SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCALV
Sbjct  327  TNRHMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNISGGFIDDFLSHFMCCCCALV  386

Query  253  QEWreieirgi-eGTHKTKTSPPSTQFMES  167
            QEWRE+E+RGI  G  KTK SPP +Q+ME+
Sbjct  387  QEWREVELRGIPYGAEKTKISPPPSQYMET  416



>ref|XP_008242040.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
 ref|XP_008242041.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
Length=416

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 175/210 (83%), Gaps = 7/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQ-NYDQSYGKNDEK  614
            DV+QCE IQ LL+VTE VA+ S P+K+      K E  YSDA+S+K+ + ++SY K++ +
Sbjct  212  DVSQCEVIQRLLEVTETVASKSSPEKNNK----KTERNYSDANSEKEPSSNESYQKSESR  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
               SRNTSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT  +PCGTFS+IA+ A
Sbjct  268  -KMSRNTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPSLCIKTFFYPCGTFSKIASVA  326

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNRH+SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCALV
Sbjct  327  TNRHMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNISGGFIDDFLSHFMCCCCALV  386

Query  253  QEWreieirgi-eGTHKTKTSPPSTQFMES  167
            QEWRE+E+RGI  G  KTK SPP +Q+ME+
Sbjct  387  QEWREVELRGIPYGAEKTKISPPPSQYMET  416



>ref|XP_009379353.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379354.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379355.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379356.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379359.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
Length=412

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 173/209 (83%), Gaps = 5/209 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV+QCE IQ LL+VTE VAA S P+K++     KV+  +SDA+++K++  +   K  E  
Sbjct  208  DVSQCEVIQRLLEVTETVAAESSPEKNIE----KVDRSHSDANNEKEHSSKESYKKSESR  263

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
             TSRNTSSVSS+HDL+S++GSHR+EEW +DLLGCCSEP LCIKT  +PCGTFS+IA+AAT
Sbjct  264  KTSRNTSSVSSRHDLLSTRGSHRHEEWKTDLLGCCSEPALCIKTFFYPCGTFSKIASAAT  323

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NR +SS+EACNELMAYSL+LSCCCYT CIRRKLRK L+I GGFIDDFLSH MCCCCALVQ
Sbjct  324  NRPMSSSEACNELMAYSLVLSCCCYTSCIRRKLRKTLNISGGFIDDFLSHFMCCCCALVQ  383

Query  250  EWreieirgi-eGTHKTKTSPPSTQFMES  167
            EWRE+EIRG+  G  KTK SPP++Q+ME+
Sbjct  384  EWREVEIRGVHYGAEKTKVSPPASQYMET  412



>ref|XP_008448524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Cucumis melo]
Length=418

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDKQNYDQSYGKNDEK  614
            +V +CE IQ LLDVTE VAATSLP+K+ P K  KV E  Y DA++   + D+ + KN + 
Sbjct  211  NVGECEVIQRLLDVTESVAATSLPEKNSPEKSHKVVEKTYVDANNGDSS-DEHFYKNTDA  269

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSR +SSVSS HDL+S++GS RY EWH+DLL CCSEP LC+KT  +PCGT SRIAT A
Sbjct  270  RTTSRKSSSVSSGHDLLSTRGSDRYGEWHTDLLDCCSEPSLCLKTFFYPCGTLSRIATVA  329

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            T+RH S AEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GGF+DDFLSHLMCCCCALV
Sbjct  330  TSRHTSPAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGFVDDFLSHLMCCCCALV  389

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  390  QEWREVEIRGVYGPEKTKTSPPPSQYMES  418



>ref|XP_006425392.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425393.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425394.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425395.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425396.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38632.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38633.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38634.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38635.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38636.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
Length=419

 Score =   258 bits (660),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+ K  ++++   K D 
Sbjct  211  DVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDNGKNHSFNEKANKCDA  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+KT  +PCGTFS+IAT 
Sbjct  271  RTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMKTFFYPCGTFSKIATV  329

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+DDFLSH MCCCCAL
Sbjct  330  ATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNIAGGFVDDFLSHFMCCCCAL  389

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRGI G  KTKTSPP +Q MES
Sbjct  390  VQEWREVEIRGIYGPEKTKTSPPPSQIMES  419



>ref|XP_006466999.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467000.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Citrus sinensis]
Length=419

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+ K  ++++   K D 
Sbjct  211  DVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDNGKNHSFNEKSNKCDA  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+KT  +PCGTFS+IAT 
Sbjct  271  RTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMKTFFYPCGTFSKIATV  329

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+DDFLSH MCCCCAL
Sbjct  330  ATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNIAGGFVDDFLSHFMCCCCAL  389

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRGI G  KTKTSPP +Q MES
Sbjct  390  VQEWREVEIRGIYGPEKTKTSPPPSQIMES  419



>gb|KDO71305.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71306.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71307.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71308.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=419

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+ K  ++++   K D 
Sbjct  211  DVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDNGKNHSFNEKSNKCDA  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+KT  +PCGTFS+IAT 
Sbjct  271  RTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMKTFFYPCGTFSKIATV  329

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+DDFLSH MCCCCAL
Sbjct  330  ATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNIAGGFVDDFLSHFMCCCCAL  389

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRGI G  KTKTSPP +Q MES
Sbjct  390  VQEWREVEIRGIYGPEKTKTSPPPSQIMES  419



>ref|XP_009363461.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Pyrus x bretschneideri]
Length=415

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 169/209 (81%), Gaps = 5/209 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV+QCE IQ LL+VTE VAA S P+KS      KVE   SDA+++K +      +  E  
Sbjct  211  DVDQCEVIQRLLEVTETVAANSSPEKS----SKKVERSQSDANNEKDHSSNESYQKSESR  266

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
             TSR+TSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT  +PCGTFS+IA+ AT
Sbjct  267  KTSRSTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPFLCIKTFFYPCGTFSKIASVAT  326

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NR ISSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCALVQ
Sbjct  327  NRPISSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNISGGFIDDFLSHFMCCCCALVQ  386

Query  250  EWreieirgi-eGTHKTKTSPPSTQFMES  167
            EWRE+EIRG+  G  KTK SPP++Q+ME+
Sbjct  387  EWREVEIRGVHYGAEKTKISPPTSQYMET  415



>ref|XP_004146155.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 gb|KGN55644.1| hypothetical protein Csa_3G002640 [Cucumis sativus]
Length=418

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDKQNYDQSYGKNDEK  614
            +V +CE IQ L+DVTE VAATSLP+K+ P K  KV E  Y DA++   + D+ + KN + 
Sbjct  211  NVGECEVIQRLIDVTESVAATSLPEKNSPEKSHKVVEKTYVDANNGDSS-DEHFYKNTDA  269

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSR +SSVSS HDL+S++GS RY EWH+DLL CCSEP LC+KT  +PCGT SRIAT A
Sbjct  270  RTTSRKSSSVSSGHDLLSTRGSDRYGEWHTDLLDCCSEPSLCLKTFFYPCGTLSRIATVA  329

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            T+RH S AEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GGF+DDFLSHLMCCCCALV
Sbjct  330  TSRHTSPAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGFVDDFLSHLMCCCCALV  389

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG+ G  KTKTSPP +Q+ME+
Sbjct  390  QEWREVEIRGVYGPEKTKTSPPPSQYMET  418



>ref|XP_004159726.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Cucumis sativus]
Length=418

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDKQNYDQSYGKNDEK  614
            +V +CE IQ L+DVTE VAATSLP+K+ P K  KV E  Y DA++   + D+ + KN + 
Sbjct  211  NVGECEVIQRLIDVTESVAATSLPEKNSPEKSHKVVEKTYVDANNGDSS-DEHFYKNTDA  269

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSR +SSVSS HDL+S++GS RY EWH+DLL CCSEP LC+KT  +PCGT SRIAT A
Sbjct  270  RTTSRKSSSVSSGHDLLSTRGSDRYGEWHTDLLDCCSEPSLCLKTFFYPCGTLSRIATVA  329

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            T+RH S AEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GGF+DDFLSHLMCCCCALV
Sbjct  330  TSRHTSPAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGFVDDFLSHLMCCCCALV  389

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG+ G  KTKTSPP +Q+ME+
Sbjct  390  QEWREVEIRGVYGPEKTKTSPPPSQYMET  418



>ref|XP_008807147.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
 ref|XP_008807148.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
Length=421

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 169/211 (80%), Gaps = 4/211 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKS-LPAKPLKVEHGYSDADSD-KQNYDQSY-GKND  620
            D++QCE I  LL VTE VA  SLP+KS  P  P+KVE  YSD + D + ++D  Y  +  
Sbjct  212  DISQCEIILRLLGVTENVAC-SLPEKSEKPKDPMKVESNYSDTNIDTRHSFDGDYCSQQK  270

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            + +  SR+ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KTL +PCGTFS+IAT
Sbjct  271  DTYMASRSVSPVSSGHDLISNRGSHRHEDWHSDLLGCCSEPYLCMKTLFYPCGTFSKIAT  330

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
               NRH+SSAEACN+L+AYSLILSCCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCA
Sbjct  331  VTQNRHVSSAEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITGGLCDDFLSHLMCCCCA  390

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+EIRG++ T K KTSPP +Q+M+S
Sbjct  391  LVQEWREVEIRGVQCTGKKKTSPPPSQYMQS  421



>ref|XP_008352422.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
 ref|XP_008352423.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
Length=415

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 167/209 (80%), Gaps = 5/209 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV QCE IQ LL+VTE VAA S P+KS      KVE   SDA+++K +      +  E  
Sbjct  211  DVGQCEVIQRLLEVTETVAANSSPEKS----SKKVERSQSDANNEKDHSSNESYQKSESR  266

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
             TSR+TSSVSS HDL+S++GSH +EEW++DLLGCCSEP LCIKT  +PCGTFS+IA+ AT
Sbjct  267  KTSRSTSSVSSGHDLLSTRGSHLHEEWNTDLLGCCSEPFLCIKTFFYPCGTFSKIASVAT  326

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NR ISSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCALVQ
Sbjct  327  NRPISSAEACNELMAYSLVLSCCCYTCCIRRKLRKMLNISGGFIDDFLSHFMCCCCALVQ  386

Query  250  EWreieirgi-eGTHKTKTSPPSTQFMES  167
            EWRE+EIRG+  G  KTK SPP++QFME+
Sbjct  387  EWREVEIRGVHYGAVKTKISPPTSQFMET  415



>ref|XP_008809426.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=421

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 171/211 (81%), Gaps = 4/211 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSDKQ-NYDQSY-GKND  620
            D++QCE IQ LL VTE +A  S P+KS   K   KVE  YSD +++K+ ++D  Y  + +
Sbjct  212  DISQCEVIQRLLAVTENIAC-SPPEKSEKLKDSKKVESDYSDTNTEKRYSFDGDYCSQQN  270

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            + +  S++ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KT L+PCGTFS+IAT
Sbjct  271  DSYMASKSVSQVSSGHDLISNRGSHRHEDWHSDLLGCCSEPNLCMKTFLYPCGTFSKIAT  330

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCA
Sbjct  331  VAKNRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGLCDDFLSHLMCCCCA  390

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+EIRG+ GT +TKTS P +Q+MES
Sbjct  391  LVQEWREVEIRGVYGTEETKTSSPPSQYMES  421



>ref|XP_008809427.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=420

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 166/210 (79%), Gaps = 3/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            D++QCE IQ LL VTE +A  S P+KS   K   KVE  YSD +++K+ ++D  Y     
Sbjct  212  DISQCEVIQRLLAVTENIAC-SPPEKSEKLKDSKKVESDYSDTNTEKRYSFDGDYCSQQN  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                + N S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KT L+PCGTFS+IAT 
Sbjct  271  DSYMASNVSQVSSGHDLISNRGSHRHEDWHSDLLGCCSEPNLCMKTFLYPCGTFSKIATV  330

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCAL
Sbjct  331  AKNRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGLCDDFLSHLMCCCCAL  390

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ GT +TKTS P +Q+MES
Sbjct  391  VQEWREVEIRGVYGTEETKTSSPPSQYMES  420



>ref|XP_010933352.1| PREDICTED: cell number regulator 13-like isoform X1 [Elaeis guineensis]
Length=421

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 168/211 (80%), Gaps = 4/211 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSDKQ-NYDQSYG-KND  620
            D+ QCE IQ LL VTE +A  S P+KS   K   KVE  YSD ++DK+ ++D  Y  + +
Sbjct  212  DIGQCEVIQRLLGVTENIAC-SQPEKSEKLKDSRKVESDYSDTNTDKRYSFDGDYCCQQN  270

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            + +  S++ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KT L+PCGTFS+IAT
Sbjct  271  DTYMASKSVSPVSSGHDLISTRGSHRHEDWHSDLLGCCSEPYLCMKTFLYPCGTFSKIAT  330

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
               NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCA
Sbjct  331  VTENRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGLCDDFLSHLMCCCCA  390

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+EIRG+ GT KTKT+ P  Q+MES
Sbjct  391  LVQEWREVEIRGVYGTEKTKTTSPPFQYMES  421



>ref|XP_010920111.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010920112.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=414

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 163/209 (78%), Gaps = 7/209 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            D+ QCE IQ LL VTE VA  SLP+KS   K  K VE  YSD      N D  +  +   
Sbjct  212  DIGQCEIIQRLLGVTENVAY-SLPEKSEKLKDCKNVESNYSDI-----NMDARHSFDGID  265

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
            +  SRN S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KTL +PCGTFS+IAT  
Sbjct  266  YMASRNVSPVSSGHDLISNRGSHRHEDWHSDLLGCCSEPYLCMKTLFYPCGTFSKIATVT  325

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             NRH+SSAEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCALV
Sbjct  326  KNRHVSSAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGLCDDFLSHLMCCCCALV  385

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG++GT K KTSPP +Q+MES
Sbjct  386  QEWREVEIRGVQGTEKKKTSPPPSQYMES  414



>ref|XP_010266845.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=409

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 161/208 (77%), Gaps = 12/208 (6%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK-QNYDQSYGKNDEK  614
            DV QCE IQHLL+VTEV A    P KS           YSDA +DK  ++D  + +  + 
Sbjct  212  DVGQCEVIQHLLEVTEVAAKNDSPSKS-----------YSDASNDKAHSFDDRHNEESDT  260

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
              TSR TSSVSS HDL+S++GSHR EEWHSDLLGCCSEP LC+KT  +PCGTFS+IA+ A
Sbjct  261  RVTSRTTSSVSSGHDLLSTRGSHRLEEWHSDLLGCCSEPSLCMKTFFYPCGTFSKIASVA  320

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNRH+S AEACNELMAYSLILSCCCYTCC+RRKLR+ L+I GG  DDFLSHLMCCCCALV
Sbjct  321  TNRHMSPAEACNELMAYSLILSCCCYTCCVRRKLRRMLNITGGSCDDFLSHLMCCCCALV  380

Query  253  QEWreieirgieGTHKTKTSPPSTQFME  170
            QEWRE+EIRG+ G  KTK SPP +Q+ME
Sbjct  381  QEWREVEIRGVYGPEKTKMSPPPSQYME  408



>ref|XP_010029652.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Eucalyptus grandis]
Length=417

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 163/210 (78%), Gaps = 5/210 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY-SDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LL+VTE VA+ SLPD   P K  K +  Y SDADSD+ Q+  ++Y  N  
Sbjct  211  DMNQCEVIQRLLEVTETVASNSLPDYGSPVKGSKKKEKYTSDADSDREQSTGETYPNNST  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                  +++SVS  +DL+ SKGS+ + EWH+DLLGCCSEPLLCIKT   PC TFS+IAT 
Sbjct  271  S---KTSSTSVSLDNDLLPSKGSYGHYEWHTDLLGCCSEPLLCIKTFFCPCDTFSKIATV  327

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+S  EACN+L+AYSLILSCCCYTCC+RRKLRK L+I GG+ DDFLSH MCCCCAL
Sbjct  328  ATNRHMSPGEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITGGWFDDFLSHFMCCCCAL  387

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  388  VQEWREVEIRGLSGHEKTKTSPPPSQYMES  417



>ref|XP_010029651.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Eucalyptus grandis]
Length=418

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 163/210 (78%), Gaps = 4/210 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY-SDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LL+VTE VA+ SLPD   P K  K +  Y SDADSD+ Q+  ++Y  N  
Sbjct  211  DMNQCEVIQRLLEVTETVASNSLPDYGSPVKGSKKKEKYTSDADSDREQSTGETYPNNST  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                +  ++SVS  +DL+ SKGS+ + EWH+DLLGCCSEPLLCIKT   PC TFS+IAT 
Sbjct  271  S--KTSRSTSVSLDNDLLPSKGSYGHYEWHTDLLGCCSEPLLCIKTFFCPCDTFSKIATV  328

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+S  EACN+L+AYSLILSCCCYTCC+RRKLRK L+I GG+ DDFLSH MCCCCAL
Sbjct  329  ATNRHMSPGEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITGGWFDDFLSHFMCCCCAL  388

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  389  VQEWREVEIRGLSGHEKTKTSPPPSQYMES  418



>ref|XP_004512157.1| PREDICTED: cell number regulator 13-like isoform X1 [Cicer arietinum]
 ref|XP_004512158.1| PREDICTED: cell number regulator 13-like isoform X2 [Cicer arietinum]
 ref|XP_004512159.1| PREDICTED: cell number regulator 13-like isoform X3 [Cicer arietinum]
 ref|XP_004512160.1| PREDICTED: cell number regulator 13-like isoform X4 [Cicer arietinum]
 ref|XP_004512161.1| PREDICTED: cell number regulator 13-like isoform X5 [Cicer arietinum]
Length=417

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 161/211 (76%), Gaps = 7/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVE-HGYSDADSDK--QNYDQSYGKND  620
            D+NQCE IQ LLDVT+V A  SLPD   P K  K E + YS+A+ DK   + ++ Y K D
Sbjct  211  DMNQCEVIQRLLDVTKV-AEYSLPDNCSPEKSHKKEKYSYSNANDDKGLSSDEKYYAKTD  269

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
               ST   +    S+ DL+S+ GS++  EWH+DLL CCSEP LC+KT  +PCGTFS+IAT
Sbjct  270  ---STVSTSRFSVSQKDLMSTGGSYQQAEWHTDLLACCSEPSLCLKTFFYPCGTFSKIAT  326

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR +SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+DDFLSHLMCCCCA
Sbjct  327  VAKNRPMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGFVDDFLSHLMCCCCA  386

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+EIRG+    KTKTSPP +Q+MES
Sbjct  387  LVQEWREVEIRGLSAHEKTKTSPPPSQYMES  417



>ref|XP_010933353.1| PREDICTED: cell number regulator 13-like isoform X2 [Elaeis guineensis]
Length=402

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 158/209 (76%), Gaps = 19/209 (9%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            D+ QCE IQ LL VTE +A  S P+KS   K   KVE  YSD ++DK++           
Sbjct  212  DIGQCEVIQRLLGVTENIAC-SQPEKSEKLKDSRKVESDYSDTNTDKRSV----------  260

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
                   S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KT L+PCGTFS+IAT  
Sbjct  261  -------SPVSSGHDLISTRGSHRHEDWHSDLLGCCSEPYLCMKTFLYPCGTFSKIATVT  313

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCALV
Sbjct  314  ENRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGLCDDFLSHLMCCCCALV  373

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+EIRG+ GT KTKT+ P  Q+MES
Sbjct  374  QEWREVEIRGVYGTEKTKTTSPPFQYMES  402



>ref|XP_007157885.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157886.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157887.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157888.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29879.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29880.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29881.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29882.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
Length=416

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 162/210 (77%), Gaps = 6/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            D+NQC+ IQ LLDVTEV AA S+P+K  P K   K E+ YS  +SDK+ + D+ Y    +
Sbjct  211  DMNQCQVIQRLLDVTEV-AAYSVPEKCSPEKNHKKEEYNYSKDNSDKEHSSDERYHAKVD  269

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K      +    ++ D++S+ GS++ E+WH+DLL CCSEP LC+KT  +PCGTFS+IA+ 
Sbjct  270  K---HSPSRYSVARKDIVSAGGSYQEEDWHTDLLACCSEPSLCMKTFFYPCGTFSKIASI  326

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A NR ISSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCAL
Sbjct  327  ARNRPISSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGFIDDFLSHLMCCCCAL  386

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRGI    KTKTSPP +Q+MES
Sbjct  387  VQEWREVEIRGISAPEKTKTSPPPSQYMES  416



>ref|XP_004287784.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 167/211 (79%), Gaps = 9/211 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK--QNYDQSYGKNDE  617
            DV+QCE IQ L++VTE VAA S P+K+      K+E  +SD +S+    + ++SY K++ 
Sbjct  211  DVSQCEVIQRLIEVTEAVAANSSPEKNQK----KIERDHSDVNSESVHSSDEKSYKKSES  266

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                SRNTSSVSS HDL+S++GSH + EW++DLLGCCSEP LC KT  +PCGTFS+IAT 
Sbjct  267  H--ISRNTSSVSSGHDLLSNRGSHHHGEWNTDLLGCCSEPSLCFKTFFYPCGTFSKIATV  324

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+SS EACNELMAYSLILSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCAL
Sbjct  325  ATNRHMSSGEACNELMAYSLILSCCCYTCCIRRKLRKTLNISGGFIDDFLSHFMCCCCAL  384

Query  256  VQEWreieirgieGT-HKTKTSPPSTQFMES  167
            VQEWRE+EIRG+     KTK SPP +Q+ME+
Sbjct  385  VQEWREVEIRGMTYGPEKTKISPPPSQYMEA  415



>ref|XP_006412042.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412043.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412044.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412045.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53495.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53496.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53497.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53498.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
Length=418

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 159/207 (77%), Gaps = 1/207 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV QCE IQ L+ VT+  AA    +K L  K  K ++  S ++  + +YD+   K     
Sbjct  212  DVAQCEVIQRLIGVTQTAAAVDDSEKQLSKKASK-KNERSSSNKTEYSYDEDSPKKSSSR  270

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
            + SR+TSSV+S HDL+S + S  +EEWH+DLL CCSEP LC+KT  FPCGT ++IATAAT
Sbjct  271  APSRSTSSVTSGHDLLSRRASQHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAKIATAAT  330

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCALVQ
Sbjct  331  NRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHLMCCCCALVQ  390

Query  250  EWreieirgieGTHKTKTSPPSTQFME  170
            E RE+EIRG  GT KT+ SPPS+QFME
Sbjct  391  ELREVEIRGAYGTEKTRVSPPSSQFME  417



>ref|XP_010935125.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010935126.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=420

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 162/211 (77%), Gaps = 4/211 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQN-YDQSYGKN--D  620
            D+ QCE IQHL+ VT+ VA T     +    P  V+  YSDA++DK+N +DQSY K   D
Sbjct  211  DLGQCEVIQHLIGVTQTVACTLQEKNTQLKNPNNVDPDYSDANNDKENAFDQSYHKEYID  270

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
             K +TSR+ S VS  HD I+ KGS+ + EWHSDLLGCCSEP LC++T   PCGT ++IAT
Sbjct  271  TK-TTSRSASPVSRSHDYIAGKGSYSHNEWHSDLLGCCSEPYLCLETFFCPCGTLAKIAT  329

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NRHISSAEACN+LMAY+L+LSCCCYTCCIRRKLR   +I GGF DDFLSHLMCCCCA
Sbjct  330  VAKNRHISSAEACNDLMAYTLLLSCCCYTCCIRRKLRNMFNIEGGFCDDFLSHLMCCCCA  389

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  390  LVQEWREVEIRGMHGPEKTKTSPPPSQYMES  420



>gb|KCW53202.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
 gb|KCW53203.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
Length=347

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 164/210 (78%), Gaps = 2/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQN-YDQSYGKNDE  617
            D++QCE IQHL+DVTE V    + +   P K  K V +  SDA+++K +  D+S  K  +
Sbjct  138  DMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANNEKNHPSDESRSKKSD  197

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+KTLLFPCGTFSR+AT 
Sbjct  198  CSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVKTLLFPCGTFSRVATV  257

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I GG+ DDFLSH +CCCCAL
Sbjct  258  ASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQGGWFDDFLSHFLCCCCAL  317

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG++G  KT+TS PS Q+M+S
Sbjct  318  VQEWREVEIRGVKGPMKTETSAPSLQYMQS  347



>gb|KHN41878.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=497

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 161/210 (77%), Gaps = 6/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSD +SD+  + D+ Y    +
Sbjct  292  DMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDVNSDQDHSSDEKYHAKID  350

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K      +    ++ DL S+ GS++ E+WH+DLL CCSEP LC+KT  +PCGTFS+IA+ 
Sbjct  351  K---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSEPSLCMKTFFYPCGTFSKIASV  407

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A NR ISS EACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCAL
Sbjct  408  ARNRPISSGEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGFIDDFLSHLMCCCCAL  467

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G+ KTKTSPP +Q+MES
Sbjct  468  VQEWREVEIRGLTGSEKTKTSPPPSQYMES  497



>ref|XP_006572883.1| PREDICTED: uncharacterized protein LOC100811369 isoform X1 [Glycine 
max]
Length=415

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 162/210 (77%), Gaps = 7/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSDA+SDK  + D+ Y    +
Sbjct  211  DMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDANSDKDHSSDEKYHAKID  269

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K      +    ++ DL S+ GS++ E+WH+DLL CCSEP LC+KT  +PCGTFS+IA+ 
Sbjct  270  K---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSEPSLCMKTFFYPCGTFSKIASV  326

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A NR ISS EACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCAL
Sbjct  327  ARNRPISSGEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGFIDDFLSHLMCCCCAL  386

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G+ KTKTSPP +Q+MES
Sbjct  387  VQEWREVEIRGLSGS-KTKTSPPPSQYMES  415



>ref|XP_008806599.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=418

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 167/211 (79%), Gaps = 4/211 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQN-YDQSYGKND-  620
            D+ QCE IQHL+ VT+ VA+T L +KS   K  + VE  +SD+++DK++ +D+SY K   
Sbjct  209  DLGQCEVIQHLIGVTQTVAST-LQEKSTQLKNSRNVEPDFSDSNNDKEHAFDRSYHKEHI  267

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            +  ++SR  S VS  HD I+ KGS+  EEWHSDLLGCCSEP LC++T  +PCGT ++IAT
Sbjct  268  DTKTSSRTASPVSLSHDYIAGKGSYSDEEWHSDLLGCCSEPYLCLETFFYPCGTLAKIAT  327

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NRHISSAEACN+LMAY+L+LSCCCYTCCIRRKLRK  +I GGF DDFLSHLMCCCCA
Sbjct  328  VAKNRHISSAEACNDLMAYTLLLSCCCYTCCIRRKLRKMFNIEGGFCDDFLSHLMCCCCA  387

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+E+RG+ G  KTKTSPP +Q+MES
Sbjct  388  LVQEWREVELRGVHGPEKTKTSPPPSQYMES  418



>ref|XP_008806598.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=420

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 167/211 (79%), Gaps = 4/211 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQN-YDQSYGKND-  620
            D+ QCE IQHL+ VT+ VA+T L +KS   K  + VE  +SD+++DK++ +D+SY K   
Sbjct  211  DLGQCEVIQHLIGVTQTVAST-LQEKSTQLKNSRNVEPDFSDSNNDKEHAFDRSYHKEHI  269

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            +  ++SR  S VS  HD I+ KGS+  EEWHSDLLGCCSEP LC++T  +PCGT ++IAT
Sbjct  270  DTKTSSRTASPVSLSHDYIAGKGSYSDEEWHSDLLGCCSEPYLCLETFFYPCGTLAKIAT  329

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NRHISSAEACN+LMAY+L+LSCCCYTCCIRRKLRK  +I GGF DDFLSHLMCCCCA
Sbjct  330  VAKNRHISSAEACNDLMAYTLLLSCCCYTCCIRRKLRKMFNIEGGFCDDFLSHLMCCCCA  389

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+E+RG+ G  KTKTSPP +Q+MES
Sbjct  390  LVQEWREVELRGVHGPEKTKTSPPPSQYMES  420



>ref|XP_003612221.1| hypothetical protein MTR_5g022670 [Medicago truncatula]
 gb|AES95179.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=416

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 160/210 (76%), Gaps = 6/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVE-HGYSDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LL+VT+V A  SLPDK  P K  K E + YSD++ DK  + D+ Y     
Sbjct  211  DMNQCEVIQRLLEVTKV-AEYSLPDKCSPEKSHKKENYSYSDSNDDKVHSSDEKYHT---  266

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K  T   +    S+ D++S+ GS++ E+WH+DLL CCSEP LC+KT  +PCGTFS+IAT 
Sbjct  267  KVDTLSQSRYSVSQKDVMSTGGSYQQEDWHTDLLACCSEPSLCMKTFFYPCGTFSKIATV  326

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
              NR +SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+DDFLSHLMCCCCAL
Sbjct  327  VKNRPMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGFVDDFLSHLMCCCCAL  386

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KTKTSPP  Q+MES
Sbjct  387  VQEWREVEIRGVSGADKTKTSPPPIQYMES  416



>gb|KHN36012.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=409

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 161/210 (77%), Gaps = 7/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSDA+SDK  + D+ Y    +
Sbjct  205  DMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDANSDKDHSSDEKYHAKID  263

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K      +    ++ DL S+ GS++ E+WH+DLL CCSE  LC+KT  +PCGTFS+IA+ 
Sbjct  264  K---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSESSLCMKTFFYPCGTFSKIASV  320

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A NR ISS EACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCAL
Sbjct  321  ARNRSISSGEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGFIDDFLSHLMCCCCAL  380

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G+ KTKTSPP +Q+MES
Sbjct  381  VQEWREVEIRGLSGS-KTKTSPPPSQYMES  409



>ref|XP_004509394.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004509396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Cicer arietinum]
Length=424

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 159/216 (74%), Gaps = 15/216 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGK----N  623
            D+NQCEFIQ LLDVTEV AA SLP+   P      EH +   +  K +Y  + G+    +
Sbjct  216  DLNQCEFIQRLLDVTEV-AAYSLPENLSP------EHSHKKVEYSKDSYSDANGRKGHSS  268

Query  622  DEKWstsr----ntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTF  455
            DEK          + S  S+ +L+S+K SH  E+WH+DLL CCSEP LC+KTL FPCGT 
Sbjct  269  DEKHRNKSDPLSESKSSVSEKNLLSTKTSHHQEDWHTDLLACCSEPYLCVKTLFFPCGTL  328

Query  454  SRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLM  275
            S+IAT A+NR ISSAEACNELMAYS++LSCCCYTCCIRRKLRK ++I GG++DDFLSHLM
Sbjct  329  SKIATVASNRPISSAEACNELMAYSMVLSCCCYTCCIRRKLRKMMNIKGGYVDDFLSHLM  388

Query  274  CCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  167
            CCCC+LVQEWRE+EIR + G  KT TSPP+ Q+MES
Sbjct  389  CCCCSLVQEWREVEIRVLYGLEKTNTSPPTPQYMES  424



>gb|KCW53201.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
Length=348

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQN-YDQSYGKNDE  617
            D++QCE IQHL+DVTE V    + +   P K  K V +  SDA+++K +  D+S  K  +
Sbjct  138  DMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANNEKNHPSDESRSKKSD  197

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+KTLLFPCGTFSR+AT 
Sbjct  198  CSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVKTLLFPCGTFSRVATV  257

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I GG+ DDFLSH +CCCCAL
Sbjct  258  ASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQGGWFDDFLSHFLCCCCAL  317

Query  256  VQEWreieirgieGTHKTKTSPPSTQF  176
            VQEWRE+EIRG++G  KT+TS PS Q 
Sbjct  318  VQEWREVEIRGVKGPMKTETSAPSLQL  344



>ref|XP_009386555.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 159/214 (74%), Gaps = 8/214 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYG-----  629
            DV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   DK++Y  SYG     
Sbjct  212  DVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLDDKEDYS-SYGNYYSQ  269

Query  628  KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSR  449
            ++D   ++SR +S  SS HDL+S+K S RYEEWHSDLLGCCSEP LCIKT  FPCGTFS+
Sbjct  270  QDDTCKASSRISSIASSGHDLLSNKASSRYEEWHSDLLGCCSEPFLCIKTCCFPCGTFSK  329

Query  448  IATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCC  269
            IA+ A NRH+SSAEACN+ MAY+L+LSCCCYTCCIRRKLRK L+I GG  DDFLSHLMCC
Sbjct  330  IASVAKNRHVSSAEACNDFMAYALVLSCCCYTCCIRRKLRKMLNITGGLCDDFLSHLMCC  389

Query  268  CCALVQEWreieirgieGTHKTKTSPPSTQFMES  167
            CCA VQEWRE+E RG     KTKT+PP++Q+MES
Sbjct  390  CCAFVQEWREVEFRGTNVVDKTKTNPPASQYMES  423



>ref|XP_009418750.1| PREDICTED: cell number regulator 13-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 163/209 (78%), Gaps = 4/209 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSDKQN-YDQSYGKNDE  617
            D+ QCE IQHL+ VT  VA T+L +KS   K P KVE  YS  +S K++ +D++Y +   
Sbjct  211  DIGQCEVIQHLIGVTHNVA-TTLEEKSTHLKSPKKVELSYSGDNSYKEHTFDENYHEQVT  269

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K ST R  S  SS HD+IS +G H +EEWHSDLLGCCSEP LC KT  +PCGTFS+IA+ 
Sbjct  270  K-STYRTGSPHSSGHDMISHRGLHGHEEWHSDLLGCCSEPSLCFKTFFYPCGTFSQIASV  328

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A NR +SSAEACN+LMAYSL+LSCCCYTCC+RRKLR   +I GG  DDFLSHL+CCCCAL
Sbjct  329  AKNRPVSSAEACNDLMAYSLVLSCCCYTCCVRRKLRNMFNITGGLCDDFLSHLLCCCCAL  388

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            VQEWRE+EIRG++GT KT+T+PP++Q+ME
Sbjct  389  VQEWREVEIRGVKGTWKTQTNPPASQYME  417



>ref|XP_009408216.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 155/211 (73%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D+ QCE IQHL+ VT+ VA+T     +    P KVE  YSD ++ K+   +++GKN  + 
Sbjct  208  DIGQCEMIQHLIGVTQNVASTIEERSTQLKSPNKVELNYSDENNYKE---KTFGKNSHEQ  264

Query  610  stsrntssvsSK---HDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
             T     + SS    HD+   +  H +EEWHSDLLGCCSEP LC+KT  +PCGTFS+IAT
Sbjct  265  DTKATFRTTSSDSLGHDMSLHREHHGHEEWHSDLLGCCSEPSLCMKTFFYPCGTFSQIAT  324

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR ++SAEACN+LMAYSLILSCCCYTCCIRRKLRK   I GG  DDFLSHL+CCCCA
Sbjct  325  VAKNRPVTSAEACNDLMAYSLILSCCCYTCCIRRKLRKMFDITGGLCDDFLSHLLCCCCA  384

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+EIRG++   KTKTSPP++Q+ME+
Sbjct  385  LVQEWREVEIRGVKEPWKTKTSPPASQYMEA  415



>dbj|BAH20129.1| AT4G35920 [Arabidopsis thaliana]
Length=421

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 156/211 (74%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   ++  +YD+   K   
Sbjct  212  DVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMKTE-YSYDEDSPKKSS  269

Query  616  KWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC KT  FPCGT ++IA
Sbjct  270  TRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLCFKTFFFPCGTLAKIA  329

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSH+MCCCC
Sbjct  330  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHVMCCCC  389

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  390  ALVQELREVEIRGAYGTEKTKISPPSSQFME  420



>ref|NP_195317.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849503.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849504.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 sp|Q8L7E9.1|MCAC1_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 1 [Arabidopsis 
thaliana]
 gb|AAM96959.1| putative protein [Arabidopsis thaliana]
 gb|AAO30093.1| putative protein [Arabidopsis thaliana]
 dbj|BAF46389.1| Mca1 [Arabidopsis thaliana]
 dbj|BAH19557.1| AT4G35920 [Arabidopsis thaliana]
 gb|AEE86589.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86590.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86591.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
Length=421

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 156/211 (74%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   ++  +YD+   K   
Sbjct  212  DVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMKTE-YSYDEDSPKKSS  269

Query  616  KWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC KT  FPCGT ++IA
Sbjct  270  TRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLCFKTFFFPCGTLAKIA  329

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSH+MCCCC
Sbjct  330  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHVMCCCC  389

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  390  ALVQELREVEIRGAYGTEKTKISPPSSQFME  420



>gb|EYU30814.1| hypothetical protein MIMGU_mgv1a007258mg [Erythranthe guttata]
Length=413

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCE IQHLL+VTE VA+ S   +     K  KVEH Y D  ++ +++D++Y KN +K
Sbjct  208  DVRQCEVIQHLLEVTEAVASNSSLSEKSSHVKESKVEHLYVDVKTENRDFDKNYTKNSQK  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             + SR+TSSVSS+ DL++S  S   +EWHSDLLGCC+EPLLCIKT  FPCGTFSRIA+AA
Sbjct  268  HAASRSTSSVSSRRDLLASDVSE--DEWHSDLLGCCAEPLLCIKTSFFPCGTFSRIASAA  325

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             +R IS AE+CN+LMAYSLILSCCCYTCCIR KLRK L+I GG  DDFLSHLMCCCCALV
Sbjct  326  NSRDISPAESCNDLMAYSLILSCCCYTCCIRTKLRKMLNIKGGLFDDFLSHLMCCCCALV  385

Query  253  QEWreieirgieGTHKTKTSPPSTQFME  170
            QEWRE+EIR ++G  K  T+PP+ Q++E
Sbjct  386  QEWREVEIRQVKGGLKI-TTPPTIQYIE  412



>emb|CDX75539.1| BnaA01g01630D [Brassica napus]
Length=419

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV QCE IQ L+ VT+ VA      +   +K    +   S +   + +Y++         
Sbjct  212  DVAQCEVIQRLIGVTQTVAEVDGGSEKELSKKASKKADRSVSHKTEYSYEEDPPMKSTSR  271

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
            + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP LC+KT  FPCGT ++IATAAT
Sbjct  272  AASRSTSSVTSGHDMLSRRASQHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAKIATAAT  331

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCALVQ
Sbjct  332  NRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHLMCCCCALVQ  391

Query  250  EWreieirgieGTHKTKTSPPSTQFME  170
            E RE+EIRG  GT KTK SPPS+QFME
Sbjct  392  ELREVEIRGAYGTEKTKISPPSSQFME  418



>ref|XP_010531102.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531103.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531104.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531105.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531106.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=416

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 156/211 (74%), Gaps = 11/211 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK-  614
            DVNQCE IQHL++VTE  AAT  PD     +    +      +S+K+ Y  SYG++  K 
Sbjct  212  DVNQCEVIQHLIEVTEA-AATVEPD----PEKDSSKKSSHKENSNKEEY--SYGEDSPKK  264

Query  613  ---WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
                S SR TSSVSS HDL+S++ S   EEW +DLL CCSEP LC+KT  FPCGT ++I 
Sbjct  265  ISSRSASRTTSSVSSGHDLLSTRSSKHREEWETDLLDCCSEPSLCLKTFFFPCGTLAKIV  324

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            T ATNRH SSAE CNELMAYSLILSCCCYTCCIR KLRK+L+I GGFIDDFLSHLMCCCC
Sbjct  325  TVATNRHTSSAETCNELMAYSLILSCCCYTCCIRGKLRKRLNITGGFIDDFLSHLMCCCC  384

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQEWRE++IRG     KTK SPP++QFME
Sbjct  385  ALVQEWREVDIRGAYAQEKTKISPPTSQFME  415



>emb|CAA18486.1| putative protein [Arabidopsis thaliana]
 emb|CAA21478.1| putative protein [Arabidopsis thaliana]
 emb|CAB81501.1| putative protein [Arabidopsis thaliana]
Length=447

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 156/211 (74%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   ++  +YD+   K   
Sbjct  238  DVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMKTE-YSYDEDSPKKSS  295

Query  616  KWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC KT  FPCGT ++IA
Sbjct  296  TRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLCFKTFFFPCGTLAKIA  355

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSH+MCCCC
Sbjct  356  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHVMCCCC  415

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  416  ALVQELREVEIRGAYGTEKTKISPPSSQFME  446



>emb|CDX69186.1| BnaC01g02670D [Brassica napus]
Length=420

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAAT-SLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCE IQ L+ VT+ VA      +K L  K    +   S +   + +Y++        
Sbjct  212  DVAQCEVIQRLIGVTQTVAEVDGGSEKELSKKASNKKADRSVSHKMEYSYEEDPPMKSTS  271

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP LC+KT  FPCGT ++IATAA
Sbjct  272  RAASRSTSSVTSGHDMLSRRASLHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAKIATAA  331

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCALV
Sbjct  332  TNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHLMCCCCALV  391

Query  253  QEWreieirgieGTHKTKTSPPSTQFME  170
            QE RE+EIRG  GT KTK SPPS+QFME
Sbjct  392  QELREVEIRGAYGTEKTKISPPSSQFME  419



>ref|XP_002867046.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43305.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 157/211 (74%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            +V QCE IQ L+ VT+  AA   PD  K L  K  K     S   ++  +YD+   K   
Sbjct  212  NVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMKTE-YSYDEDSPKKSS  269

Query  616  KWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC+KT  FPCGT ++IA
Sbjct  270  SRTASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAKIA  329

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCC
Sbjct  330  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHLMCCCC  389

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  390  ALVQELREVEIRGAYGTEKTKISPPSSQFME  420



>ref|XP_010526810.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010526811.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=409

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 147/212 (69%), Gaps = 20/212 (9%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DVNQCE IQ L+DVTE VA+                  Y + DS K++Y +      E  
Sbjct  212  DVNQCEVIQRLIDVTEAVASVD---------------SYPEKDSSKKSYHKDASDKKESS  256

Query  610  stsrntssvsSK-----HDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRI  446
              S  +SS ++      HDL+SS+ SH +EEW +DLL CC +P LC+KT  FPCGT ++I
Sbjct  257  YDSSRSSSRTASSVSSGHDLLSSRASHHHEEWETDLLDCCLDPSLCLKTFFFPCGTLAKI  316

Query  445  ATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCC  266
             T AT+RH SSAE CNELMAYSL+LSCCCYTCCIR KLRK+L+I GGFIDDFLSHLMCCC
Sbjct  317  TTVATDRHTSSAETCNELMAYSLVLSCCCYTCCIRGKLRKRLNITGGFIDDFLSHLMCCC  376

Query  265  CALVQEWreieirgieGTHKTKTSPPSTQFME  170
            CALVQEWRE+EIRG     KTK SPPS+QFME
Sbjct  377  CALVQEWREVEIRGAYAQEKTKVSPPSSQFME  408



>ref|XP_003629262.1| Cornifelin [Medicago truncatula]
 gb|AET03738.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=424

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 156/213 (73%), Gaps = 8/213 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV----EHGYSDADSDKQNYDQSYGKN  623
            D+NQCEFIQ LLDVT   AA SLP+K  P    ++     + +SDA+  K +   S  K+
Sbjct  215  DINQCEFIQRLLDVTNF-AAYSLPEKLSPEDNYQIVEYSNNSHSDANGSKGH--SSNEKH  271

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
             +K     ++ +  S+ + +S++ S++ E+WH+DLL CCSEP LCIKT  +PCGTFS+IA
Sbjct  272  HKKSDILSSSRTKVSEKNPVSTRSSYQQEDWHTDLLACCSEPYLCIKTFFYPCGTFSKIA  331

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            T ATNR ISSAE CN+ +AYSL+LSCCCYTCCIRRKLRK ++IPGG++DDFLSHLMCC C
Sbjct  332  TVATNRPISSAEVCNDFIAYSLVLSCCCYTCCIRRKLRKMMNIPGGYVDDFLSHLMCCSC  391

Query  262  ALVQEWreieir-gieGTHKTKTSPPSTQFMES  167
            ALVQEWRE++IR   E   KT  SPP+ Q+MES
Sbjct  392  ALVQEWREVQIRGVYEEPEKTNISPPTAQYMES  424



>ref|XP_009148721.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
 ref|XP_009148775.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
Length=419

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV QCE IQ L+ VT+ VA      +   +K    +   S +   + +Y++         
Sbjct  212  DVAQCEVIQRLIGVTQTVAEVDGGSEKELSKKASKKADRSVSHKTEYSYEEDPPVKSTSR  271

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
            + SR+TSSV+S H+++S + S  +EEWH+DLL CCSEP LC+KT  FPCGT ++IATAAT
Sbjct  272  AASRSTSSVTSGHEMLSRRASLHHEEWHADLLACCSEPSLCLKTFFFPCGTLAKIATAAT  331

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCALVQ
Sbjct  332  NRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHLMCCCCALVQ  391

Query  250  EWreieirgieGTHKTKTSPPSTQFME  170
            E RE+EIRG  GT KTK SPPS+QFME
Sbjct  392  ELREVEIRGAYGTEKTKISPPSSQFME  418



>ref|XP_006282626.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 ref|XP_006282627.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15524.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15525.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
Length=421

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 157/211 (74%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            DV QCE IQ L+ VT+  A+   PD  K L  K  K     S  +++  +YD++  K   
Sbjct  212  DVAQCEVIQRLIGVTQAAASVD-PDSEKELTKKASKKAERTSSMNTE-YSYDENTPKKSS  269

Query  616  KWstsrntssvsSKHDLISSKGS--HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC+KT  FPCG  ++IA
Sbjct  270  SRAASRSTSNVSSGHDLLSRRASMAQHHEEWHTDLLACCSEPSLCLKTFFFPCGALAKIA  329

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCC
Sbjct  330  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHLMCCCC  389

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQE RE+EIRG  G  KTK SPPS+QFME
Sbjct  390  ALVQELREVEIRGAYGMEKTKISPPSSQFME  420



>ref|XP_010446852.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446853.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 155/211 (73%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            DV QCE IQ L+ VT+  A+   PD  K L  K  K     S  +++  +Y++   K   
Sbjct  212  DVAQCEVIQRLIGVTQAAASVD-PDSEKELTKKASKKAERTSSMNTE-YSYEEDTPKKSN  269

Query  616  KWstsrntssvsSKHDLISSKGS--HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+ S+VSS HDL+S + S    +EEWH+DLL CCSEP LC+KT  FPCGT ++IA
Sbjct  270  SRAASRSASNVSSGHDLLSRRASLAEHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAKIA  329

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG IDDFLSH+MCCCC
Sbjct  330  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGLIDDFLSHVMCCCC  389

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQE RE+EIRG  G  KTK SPPS+QFME
Sbjct  390  ALVQELREVEIRGAYGMEKTKISPPSSQFME  420



>ref|XP_009138395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
 ref|XP_009138396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
Length=416

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 154/213 (72%), Gaps = 15/213 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAAT-SLPDKSLPAKPLK-----VEHGYSDADSDKQNYDQSYG  629
            DV QCE IQ L+ VT+ V       +K L  K  +     VE+ Y + D         + 
Sbjct  212  DVAQCEVIQRLIGVTQTVGEVDGGSEKELSKKASRKTDHTVEYSYEEED---------HP  262

Query  628  KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSR  449
            K     + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP LC+KT  FPCGT ++
Sbjct  263  KKSSSRAASRSTSSVTSSHDMLSRRESQHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAK  322

Query  448  IATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCC  269
            IATAATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG+IDDFLSHLMCC
Sbjct  323  IATAATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGYIDDFLSHLMCC  382

Query  268  CCALVQEWreieirgieGTHKTKTSPPSTQFME  170
            CCALVQE RE+EIRG  GT KTK SPP +QFME
Sbjct  383  CCALVQELREVEIRGAYGTEKTKVSPPPSQFME  415



>ref|XP_006574663.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006574664.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006574665.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
 ref|XP_006574666.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=418

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 156/211 (74%), Gaps = 10/211 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDK--QNYDQSYGKND  620
            D++Q EFIQHLLDVTEV A   L D     K ++  ++ YSDA+ DK   + ++ + KND
Sbjct  215  DLHQYEFIQHLLDVTEVAA---LYDSKKNHKTVEYSDYSYSDANGDKAHSSNEKIHKKND  271

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
                T   + S  S+ DL+S+ GS+  E+WH+DLL CCSEP LC KT  +PCGT S+IAT
Sbjct  272  ----THSASGSSVSEKDLLSTGGSYHREDWHTDLLACCSEPCLCFKTCFYPCGTLSKIAT  327

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR ISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCA
Sbjct  328  VANNRPISSAEACNELMAYSLILSCCCYTCCMRRKLRKMLNIRGGFIDDFLSHLMCCCCA  387

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQE RE+EI G+EG   T T PP +Q+MES
Sbjct  388  LVQERREVEIHGVEGPENTNTRPPPSQYMES  418



>ref|XP_003519857.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
 gb|KHN00454.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=416

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 156/211 (74%), Gaps = 10/211 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDK--QNYDQSYGKND  620
            D++Q EFIQHLLDVTEV A   L D     K ++  ++ YSDA+ DK   + ++ + KND
Sbjct  213  DLHQYEFIQHLLDVTEVAA---LYDSKKNHKTVEYSDYSYSDANGDKAHSSNEKIHKKND  269

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
                T   + S  S+ DL+S+ GS+  E+WH+DLL CCSEP LC KT  +PCGT S+IAT
Sbjct  270  ----THSASGSSVSEKDLLSTGGSYHREDWHTDLLACCSEPCLCFKTCFYPCGTLSKIAT  325

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR ISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSHLMCCCCA
Sbjct  326  VANNRPISSAEACNELMAYSLILSCCCYTCCMRRKLRKMLNIRGGFIDDFLSHLMCCCCA  385

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQE RE+EI G+EG   T T PP +Q+MES
Sbjct  386  LVQERREVEIHGVEGPENTNTRPPPSQYMES  416



>ref|XP_010033519.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Eucalyptus 
grandis]
Length=464

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 2/184 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQN-YDQSYGKNDE  617
            D++QCE IQHL+DVTE V    + +   P K  K V +  SDA+++K +  D+S  K  +
Sbjct  138  DMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANNEKNHPSDESRSKKSD  197

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+KTLLFPCGTFSR+AT 
Sbjct  198  CSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVKTLLFPCGTFSRVATV  257

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I GG+ DDFLSH +CCCCAL
Sbjct  258  ASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQGGWFDDFLSHFLCCCCAL  317

Query  256  VQEW  245
            VQEW
Sbjct  318  VQEW  321



>emb|CDY47043.1| BnaAnng08310D [Brassica napus]
Length=416

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 154/213 (72%), Gaps = 15/213 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAAT-SLPDKSLPAKPLK-----VEHGYSDADSDKQNYDQSYG  629
            DV QCE IQ L+ VT+ V       +K L  K  +     VE+ Y + D         + 
Sbjct  212  DVAQCEVIQRLIGVTQTVGEVDGGSEKELSKKASRKTDHTVEYSYEEED---------HP  262

Query  628  KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSR  449
            K     + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP LC+KT  FPCGT ++
Sbjct  263  KKSSSRAASRSTSSVTSSHDMLSRRESQHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAK  322

Query  448  IATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCC  269
            IATAATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG+IDDFLSHLMCC
Sbjct  323  IATAATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGYIDDFLSHLMCC  382

Query  268  CCALVQEWreieirgieGTHKTKTSPPSTQFME  170
            CCALVQE RE+EIRG  GT KTK SPP +QFME
Sbjct  383  CCALVQELREVEIRGAYGTEKTKVSPPPSQFME  415



>gb|KHN35538.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=415

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 155/208 (75%), Gaps = 4/208 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ DK +   S  K  EK 
Sbjct  212  DLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGDKGH--SSNEKIHEKN  267

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
             T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT  +PCGT S+IAT A 
Sbjct  268  DTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTCFYPCGTLSKIATVAN  327

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NR ISSAE CNELMAYSLILSCCCYTCCIRRKLRK L+I GGFIDDFLSHLMCCCCALVQ
Sbjct  328  NRPISSAETCNELMAYSLILSCCCYTCCIRRKLRKMLNIRGGFIDDFLSHLMCCCCALVQ  387

Query  250  EWreieirgieGTHKTKTSPPSTQFMES  167
            E RE+EIRG+EG  KT T PP +Q+MES
Sbjct  388  ERREVEIRGVEGPEKTNTRPPPSQYMES  415



>ref|XP_003548830.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=415

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 155/208 (75%), Gaps = 4/208 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ DK +   S  K  EK 
Sbjct  212  DLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGDKGH--SSNEKIHEKN  267

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
             T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT  +PCGT S+IAT A 
Sbjct  268  DTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTCFYPCGTLSKIATVAN  327

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NR ISSAE CNELMAYSLILSCCCYTCCIRRKLRK L+I GGFIDDFLSHLMCCCCALVQ
Sbjct  328  NRPISSAETCNELMAYSLILSCCCYTCCIRRKLRKMLNIRGGFIDDFLSHLMCCCCALVQ  387

Query  250  EWreieirgieGTHKTKTSPPSTQFMES  167
            E RE+EIRG+EG  KT T PP +Q+MES
Sbjct  388  ERREVEIRGVEGPEKTNTRPPPSQYMES  415



>ref|NP_001049013.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|ABF94063.1| Protein of unknown function, DUF614 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10927.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|EEC74547.1| hypothetical protein OsI_10083 [Oryza sativa Indica Group]
 dbj|BAJ40168.1| mid1-complementing activity 1 [Oryza sativa Japonica Group]
Length=418

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 150/210 (71%), Gaps = 6/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVE--HGYSDADSDKQNYDQSYGKND  620
            D+ QCE IQHLL VT+ VA +S+P+K + P    K +  H     DS K  +D S  K  
Sbjct  211  DMGQCEVIQHLLGVTKTVA-SSIPEKCATPKVSEKADSNHTKVSEDSAKTYHDDSPKKQK  269

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            +  +  R++   S  HDL+SS+GS+  +EWH+DLLGCCSEP LC++T  FPCGTFS+IA+
Sbjct  270  DACTAPRSSPPSSYGHDLVSSRGSYS-DEWHADLLGCCSEPSLCLRTFFFPCGTFSKIAS  328

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR +SS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG IDDFLSHLMCCCCA
Sbjct  329  IAKNRPMSSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGGCIDDFLSHLMCCCCA  388

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFME  170
            LVQEW            +TK SPPS Q+ME
Sbjct  389  LVQEW-REVEIRGAYGERTKISPPSFQYME  417



>ref|XP_010432209.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010432210.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437400.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437401.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 155/211 (73%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            DV QCE IQ L+ VT+  A+   PD  K L  K  K     S  +++  +Y++   K   
Sbjct  212  DVAQCEVIQRLIGVTQAAASVD-PDSEKELTKKASKKAERTSSMNTE-YSYEEDTPKKSS  269

Query  616  KWstsrntssvsSKHDLISSKGS--HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+ S+VSS HDL+S + S    +EEWH+DLL CCSEP LC+KT  FPCGT ++IA
Sbjct  270  SRAASRSASNVSSGHDLLSRRASLAEHHEEWHTDLLACCSEPSLCLKTFFFPCGTLAKIA  329

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG IDDFLSH+MCCCC
Sbjct  330  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGLIDDFLSHVMCCCC  389

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            ALVQE RE+EIRG  G  KTK SPPS+QFME
Sbjct  390  ALVQELREVEIRGAYGMEKTKISPPSSQFME  420



>emb|CDX72565.1| BnaC07g45870D [Brassica napus]
Length=414

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 153/209 (73%), Gaps = 10/209 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVA-ATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            DV QCE IQ L+ VT+ V       +K L  K  +    YS        Y++ + K    
Sbjct  213  DVAQCEVIQRLIGVTQTVGEVQGGSEKELAKKASRKTVEYS--------YEEDHPKKSSS  264

Query  613  WstsrntssvsSKHDLISSKGS-HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
             + SR+TSSV+S+HD++S + S H  EEWH+DLL CCSEP LC+KT  FPCGT ++IATA
Sbjct  265  RAASRSTSSVTSRHDMLSRRESQHHEEEWHTDLLACCSEPSLCLKTFFFPCGTLAKIATA  324

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG+IDDFLSHLMCCCCAL
Sbjct  325  ATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGYIDDFLSHLMCCCCAL  384

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            VQE RE+EIRG  G  KTK SPP +QFME
Sbjct  385  VQELREVEIRGAYGMEKTKVSPPPSQFME  413



>ref|XP_006649427.1| PREDICTED: cell number regulator 13-like [Oryza brachyantha]
Length=419

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 156/210 (74%), Gaps = 7/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVEHGYS--DADSDKQNYDQSYGKND  620
            D+ QCE IQHLL VT+ VA +S+PDK + P    K +   +  + +S K   D S  K  
Sbjct  213  DMGQCEVIQHLLGVTKTVA-SSIPDKCATPKVSEKCDSNLTKINEESAKTYDDDSPKKQK  271

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            +     R++   S  HDL+SS+GS+  +EWH+DLLGCC+EP LC++T  FPCGTFSRIA+
Sbjct  272  DACGAPRSSLPSSYGHDLVSSRGSYS-DEWHADLLGCCTEPSLCLRTFFFPCGTFSRIAS  330

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR ISS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG IDDFLSHLMCCCCA
Sbjct  331  IAKNRPISSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGGCIDDFLSHLMCCCCA  390

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFME  170
            LVQEWRE+EIRG     +TK SPPS Q+ME
Sbjct  391  LVQEWREVEIRGAY--DETKISPPSFQYME  418



>ref|XP_006846924.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
 gb|ERN08505.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
Length=421

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 153/210 (73%), Gaps = 2/210 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQ-NYDQSYGKND-E  617
            DV QCE IQHL+DVTE VA       S      +VE     A+++K+   D  Y +   +
Sbjct  212  DVGQCEVIQHLIDVTETVANNLSEKNSHSRNSKQVEPDCPSANNEKEYEMDDVYHRQQHD  271

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              + SRN S VSS  DLIS +GSHR +EWH+DLLGCCSEP LC+KT  +PCGT S+IA  
Sbjct  272  THTPSRNASPVSSGRDLISVRGSHRSDEWHTDLLGCCSEPCLCLKTCFYPCGTSSKIAAV  331

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            A+N   S  +ACN+LM YSL+L+CCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCAL
Sbjct  332  ASNGDTSPEQACNDLMTYSLLLACCCYTCCVRRKLRKMLNITGGVCDDFLSHLMCCCCAL  391

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG  GT+KTKTSPP++Q+MES
Sbjct  392  VQEWREVEIRGAYGTYKTKTSPPASQYMES  421



>ref|XP_007156188.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 ref|XP_007156189.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28182.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28183.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
Length=415

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 152/212 (72%), Gaps = 12/212 (6%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAA--TSLPDKSLPAKPLKVEHGYSDADSDK--QNYDQSYGKN  623
            D+ Q EFIQHLLDVTEV A   +   +K++          YSDA+  K   + +  + KN
Sbjct  212  DIYQYEFIQHLLDVTEVAAHYHSEKNNKTVEYSG----SSYSDANGGKPHSSDENIHKKN  267

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
            D    T  ++ S  S+ DL+S  GS+  E+WH+DLL CCSEP LCIKT   PCGT S IA
Sbjct  268  D----TLSSSRSSVSEKDLLSRGGSYNREDWHTDLLACCSEPCLCIKTCFCPCGTLSNIA  323

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            + ATNR ISSAEACNELMAYSLILSCCCYTCCIR KLRK L+I GG+IDDFLSHLMCCCC
Sbjct  324  SVATNRPISSAEACNELMAYSLILSCCCYTCCIRSKLRKMLNIRGGYIDDFLSHLMCCCC  383

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFMES  167
            ALVQEWRE+EIRG  G+ KT T PP +Q+MES
Sbjct  384  ALVQEWREVEIRGASGSEKTNTKPPPSQYMES  415



>gb|EMS65760.1| hypothetical protein TRIUR3_02105 [Triticum urartu]
Length=344

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 153/210 (73%), Gaps = 6/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY---SDADSDKQNYDQSYGKND  620
            D+ QCE I HLL VT  VA +S+P++S  AK  K  +      + DS K   D S  K  
Sbjct  137  DMAQCEVIHHLLGVTRTVA-SSIPEESTDAKVTKKTNSKCTKVNEDSAKSYDDDSPKKQK  195

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            + +   R++S V   HDL+SS  S+  +EWH+DLLGCCSEP LC+KT  FPCGTFSRIA+
Sbjct  196  DAYIAPRSSSPVPYNHDLVSSTASYS-DEWHADLLGCCSEPALCLKTFFFPCGTFSRIAS  254

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A N+ +SS EACN++MAYSL+LSCCCYTCC+RRKLR++L+I GG  DDFLSH+MCCCCA
Sbjct  255  IAKNKPMSSGEACNDIMAYSLVLSCCCYTCCVRRKLRQRLNIAGGCCDDFLSHVMCCCCA  314

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFME  170
            LVQEWRE+EIRG  G  KTK +PP+ Q+ME
Sbjct  315  LVQEWREVEIRGAYGG-KTKITPPAHQYME  343



>ref|XP_010113309.1| hypothetical protein L484_026640 [Morus notabilis]
 gb|EXC35316.1| hypothetical protein L484_026640 [Morus notabilis]
Length=397

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 151/210 (72%), Gaps = 26/210 (12%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQNY-DQSYGKNDE  617
            DVNQCE IQ L+DVTE VA  ++PDKS P K   K+E  YSD +S+K++  D+ Y K  +
Sbjct  212  DVNQCEVIQRLIDVTETVAENTVPDKSSPEKSHKKMERNYSDDNSEKEDSSDEKYSKRGD  271

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
               TSRNTSSVSS HDL+S++ S R+EEW +DLLGCCSEP L                  
Sbjct  272  SRVTSRNTSSVSSGHDLLSTRCSRRHEEWSNDLLGCCSEPSL------------------  313

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
                  S AEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGFIDDFLSH MCCCCAL
Sbjct  314  ------SPAEACNELMAYSLILSCCCYTCCIRRKLRKTLNITGGFIDDFLSHFMCCCCAL  367

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  368  VQEWREVEIRGVYGPEKTKTSPPPSQYMES  397



>gb|ACN26521.1| unknown [Zea mays]
 tpg|DAA43436.1| TPA: putative cell number regulator 13 [Zea mays]
Length=428

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 147/220 (67%), Gaps = 16/220 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYS------------DADSDKQ  650
            D+  CE IQHLL VT+ V +T +P+K    K P K    YS            D D  K+
Sbjct  211  DLGSCEVIQHLLGVTKTVEST-IPEKETNVKAPEKKGSNYSESKGETAKSFDDDDDYPKK  269

Query  649  NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLF  470
              D    K  E  ST R +S V   HDL+SS+GS+  +EWH+DLLGCCSEP LC+KTL F
Sbjct  270  QNDDYPKKQKETCSTQRCSSQVPYGHDLVSSRGSYS-DEWHADLLGCCSEPALCLKTLFF  328

Query  469  PCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDF  290
            PCGTFSRIA+ A +R +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I GG  DDF
Sbjct  329  PCGTFSRIASIAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIAGGCCDDF  388

Query  289  LSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  170
            LSHL+CCCCALVQEW          + KTK +PP+ Q+ME
Sbjct  389  LSHLLCCCCALVQEW-REVEIRGAYSEKTKVTPPACQYME  427



>ref|XP_008440854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440855.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
Length=415

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 147/210 (70%), Gaps = 7/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADSDKQN-YDQSYGKNDE  617
            DV QC+ I+ L D+TE ++A    +K L    P + E+ YSDA+ +  + YD ++ KN +
Sbjct  211  DVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHEYNYSDANGETTHAYDGNFHKNRD  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+KT   PC T S++A+ 
Sbjct  271  G-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMKTFFCPCWTLSKVASV  327

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+SSA+ACNELMAYSL+ SCCCYTCC RRKLR  L+I GG IDDFLSH +CCCCAL
Sbjct  328  ATNRHVSSADACNELMAYSLVFSCCCYTCCFRRKLRSMLNIKGGLIDDFLSHFLCCCCAL  387

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEW   E+    G   TKT PP  Q+MES
Sbjct  388  VQEW--REVEMRCGPENTKTIPPPLQYMES  415



>ref|XP_004985646.1| PREDICTED: cell number regulator 13-like [Setaria italica]
Length=418

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 147/210 (70%), Gaps = 6/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD--KQNYDQSYGKNDE  617
            D+  CE IQHLL VT+ VA T +P++   AK  + +  Y ++  D  K   D  Y K  +
Sbjct  211  DLGSCEVIQHLLGVTKTVACT-IPEEETNAKVSEKDSNYKESKGDVAKSYDDDDYPKKQK  269

Query  616  KWstsrn-tssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
               +++  +S VS  HDL+S +GS+  +EWH+DLLGCCSEP LC+KTL FPCGTFSRIA+
Sbjct  270  DACSTQRCSSPVSYGHDLVSRRGSYS-DEWHADLLGCCSEPALCLKTLFFPCGTFSRIAS  328

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A +R +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I GG  DDFLSHL+CCCCA
Sbjct  329  VAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIAGGCCDDFLSHLLCCCCA  388

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFME  170
            LVQEW            KTKT+PP  Q+ME
Sbjct  389  LVQEW-REVEIRGAYGEKTKTTPPPCQYME  417



>ref|XP_009408218.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 132/185 (71%), Gaps = 6/185 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D+ QCE IQHL+ VT+ VA+T     +    P KVE  YSD ++ K+   +++GKN  + 
Sbjct  208  DIGQCEMIQHLIGVTQNVASTIEERSTQLKSPNKVELNYSDENNYKE---KTFGKNSHEQ  264

Query  610  stsrntssvsSK---HDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
             T     + SS    HD+   +  H +EEWHSDLLGCCSEP LC+KT  +PCGTFS+IAT
Sbjct  265  DTKATFRTTSSDSLGHDMSLHREHHGHEEWHSDLLGCCSEPSLCMKTFFYPCGTFSQIAT  324

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR ++SAEACN+LMAYSLILSCCCYTCCIRRKLRK   I GG  DDFLSHL+CCCCA
Sbjct  325  VAKNRPVTSAEACNDLMAYSLILSCCCYTCCIRRKLRKMFDITGGLCDDFLSHLLCCCCA  384

Query  259  LVQEW  245
            LVQEW
Sbjct  385  LVQEW  389



>ref|XP_009408217.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 132/185 (71%), Gaps = 6/185 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D+ QCE IQHL+ VT+ VA+T     +    P KVE  YSD ++ K+   +++GKN  + 
Sbjct  208  DIGQCEMIQHLIGVTQNVASTIEERSTQLKSPNKVELNYSDENNYKE---KTFGKNSHEQ  264

Query  610  stsrntssvsSK---HDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
             T     + SS    HD+   +  H +EEWHSDLLGCCSEP LC+KT  +PCGTFS+IAT
Sbjct  265  DTKATFRTTSSDSLGHDMSLHREHHGHEEWHSDLLGCCSEPSLCMKTFFYPCGTFSQIAT  324

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR ++SAEACN+LMAYSLILSCCCYTCCIRRKLRK   I GG  DDFLSHL+CCCCA
Sbjct  325  VAKNRPVTSAEACNDLMAYSLILSCCCYTCCIRRKLRKMFDITGGLCDDFLSHLLCCCCA  384

Query  259  LVQEW  245
            LVQEW
Sbjct  385  LVQEW  389



>ref|XP_002468480.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
 gb|EER95478.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
Length=420

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 146/212 (69%), Gaps = 8/212 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPL-KVEHGYSDADSDKQ---NYDQSYGKN  623
            D+  CE IQHL+ VT+ V +T +P++   AK   K    YS++  D     + D  Y K 
Sbjct  211  DLGSCEVIQHLIGVTKTVEST-IPEEETNAKASEKKGSNYSESKGDNAKSFDDDDDYPKK  269

Query  622  DEKW-stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRI  446
             +   ST R +S V   HDL+SS+GS+  +EWH+DLLGCCSEP LC KTL FPCGTFSRI
Sbjct  270  QKDTCSTQRFSSQVPYGHDLVSSRGSYS-DEWHADLLGCCSEPALCFKTLFFPCGTFSRI  328

Query  445  ATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCC  266
            A+ A +R +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I GG  DDFLSHL+CCC
Sbjct  329  ASVAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIAGGCCDDFLSHLLCCC  388

Query  265  CALVQEWreieirgieGTHKTKTSPPSTQFME  170
            CALVQEW          T KTK +PP  Q+ME
Sbjct  389  CALVQEW-REVEIRGAYTEKTKVTPPPCQYME  419



>ref|XP_010680410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=410

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 151/209 (72%), Gaps = 7/209 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSY-GKNDEK  614
            D+ QCE IQ LLDVT+  A     +KS   K      G   A     N   S+ G + +K
Sbjct  208  DMTQCEVIQRLLDVTQTAAVVCETEKSESVK------GNKRAQPPYANEKYSFDGTSPKK  261

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
               SR  S+VSS+ DL+S++ SH + EWH+DLL CC+EP LC+KT+ +PCGTF++I+T A
Sbjct  262  NEISRTASTVSSRRDLLSNRSSHHHGEWHTDLLDCCAEPCLCLKTIFYPCGTFAKISTVA  321

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             N+++SSAEACN+L+AYSLILSCCCYTCC+R KLRK L+I GG  DDFLSH MCCCCALV
Sbjct  322  NNKYMSSAEACNDLVAYSLILSCCCYTCCVRGKLRKILNINGGVFDDFLSHFMCCCCALV  381

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QE+RE+EIRG+ G  KTKT PP +QFMES
Sbjct  382  QEYREVEIRGVCGHEKTKTMPPISQFMES  410



>ref|XP_003558777.1| PREDICTED: cell number regulator 13 [Brachypodium distachyon]
Length=412

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 144/210 (69%), Gaps = 9/210 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDK-QNYD-QSYGKND  620
            D+ QCE I HLL VT+ VA +S+PD+S  AK  K  +   +    D  Q+YD  S  K  
Sbjct  208  DMGQCEVIHHLLGVTKTVA-SSIPDESTNAKVTKKTDSNKTKVSEDSAQSYDYDSPKKQK  266

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            +     R++S V   HDL+SS      +EWH+DLLGCCSEP LC+KT  FPCGTFSRIA+
Sbjct  267  DACDAPRSSSPVPYGHDLVSSTS----DEWHADLLGCCSEPSLCLKTFFFPCGTFSRIAS  322

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             A NR +SS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG  DDFLSH+MCCCCA
Sbjct  323  VAKNRPMSSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGGCCDDFLSHVMCCCCA  382

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFME  170
            LVQEW            KTK +PP  Q+ME
Sbjct  383  LVQEW-REVEIRGAYGEKTKVTPPPCQYME  411



>ref|NP_001182136.1| cell number regulator 13 [Zea mays]
 sp|B6SJQ0.1|CNR13_MAIZE RecName: Full=Cell number regulator 13; AltName: Full=ZmCNR13 
[Zea mays]
 gb|ACG25083.1| domain of unknown function DUF614 containing protein [Zea mays]
 gb|ADI48426.1| cell number regulator 13 [Zea mays]
Length=428

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 149/221 (67%), Gaps = 18/221 (8%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYS----------DADSD---K  653
            D+  CE IQHLL VT+ V +T +P+K    K P K    YS          D D D   K
Sbjct  211  DLGSCEVIQHLLGVTKTVEST-IPEKETNVKAPEKKGSNYSESKGETAKSFDDDDDYPKK  269

Query  652  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  473
            QN D    + D   ST R +S V   HDL+SS+GS+  +EWH+DLLGCCS+P LC+KTL 
Sbjct  270  QNGDYPKKQKD-TCSTQRCSSQVPYGHDLVSSRGSYS-DEWHADLLGCCSKPALCLKTLF  327

Query  472  FPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDD  293
            FPCGTFSRIA+ A +R +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I GG  DD
Sbjct  328  FPCGTFSRIASIAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIAGGCCDD  387

Query  292  FLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  170
            FLSHL+CCCCALVQEW          + KTK +PP+ Q+ME
Sbjct  388  FLSHLLCCCCALVQEW-REVEIRGAYSEKTKVTPPACQYME  427



>ref|XP_004135021.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 ref|XP_004158901.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
Length=416

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 146/210 (70%), Gaps = 7/210 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADSDKQN-YDQSYGKNDE  617
            DV QC+ I+ L D+TE ++A    +K L    P + ++ YSD + +  + Y  ++ KN +
Sbjct  212  DVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHDYNYSDTNGETTHAYVGNFHKNRD  271

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+KT   PC T S++A+ 
Sbjct  272  G-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMKTFFCPCWTLSKVASV  328

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            ATNRH+SSA+ACNELMAYSL+ SCCCYTCC RRKLR KL+I GG IDDFLSH +CCCCAL
Sbjct  329  ATNRHVSSADACNELMAYSLVFSCCCYTCCFRRKLRSKLNIKGGLIDDFLSHFLCCCCAL  388

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEW   E+    G   TKT PP  Q+MES
Sbjct  389  VQEW--REVEMRCGPENTKTIPPPLQYMES  416



>gb|AAK32909.1|AF367322_1 AT4g35920/F4B14_190 [Arabidopsis thaliana]
 gb|AAM91434.1| AT4g35920/F4B14_190 [Arabidopsis thaliana]
Length=440

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 135/185 (73%), Gaps = 6/185 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   ++  +YD+   K   
Sbjct  212  DVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMKTE-YSYDEDSPKKSS  269

Query  616  KWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
              + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC KT  FPCGT ++IA
Sbjct  270  TRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLCFKTFFFPCGTLAKIA  329

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            TAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFIDDFLSH+MCCCC
Sbjct  330  TAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHVMCCCC  389

Query  262  ALVQE  248
            ALVQE
Sbjct  390  ALVQE  394



>ref|XP_006599313.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006599314.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006599315.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
Length=432

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ DK +   S  K  EK 
Sbjct  212  DLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGDKGH--SSNEKIHEKN  267

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
             T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT  +PCGT S+IAT A 
Sbjct  268  DTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTCFYPCGTLSKIATVAN  327

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NR ISSAE CNELMAYSLILSCCCYTCCIRRKLRK L+I GGFIDDFLSHLMCCCCALVQ
Sbjct  328  NRPISSAETCNELMAYSLILSCCCYTCCIRRKLRKMLNIRGGFIDDFLSHLMCCCCALVQ  387

Query  250  E  248
            E
Sbjct  388  E  388



>ref|XP_011074700.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=403

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 142/210 (68%), Gaps = 14/210 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYS--DADSDKQNYDQSYGKNDE  617
            DV QCE I+ L++VTE  A + L + S    P+K +        +++ + YD S    + 
Sbjct  206  DVGQCEVIERLIEVTENAANSVLENGSPSKSPVKSKTDKEPFSGENNAKKYDSSTSPRE-  264

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                    +++SS H++ S K     EEWHSDLLGCCSEP LC+KT L PC T S+IA+A
Sbjct  265  --------TTISSGHNVASMKEIIWKEEWHSDLLGCCSEPYLCMKTFLCPCDTISKIASA  316

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT + ISSA+ACN++MAY+LIL+CCCYTCCIRRKLR++L I GG  DDFLSH+MCCCCAL
Sbjct  317  ATGKEISSAQACNDIMAYTLILACCCYTCCIRRKLRRRLDIKGGMFDDFLSHVMCCCCAL  376

Query  256  VQEWreieirgieGTHKTKTSPPSTQFMES  167
            VQEW       I G HKT+TSPP +Q MES
Sbjct  377  VQEW---REVEIRGCHKTRTSPPPSQRMES  403



>ref|XP_010489410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489413.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489414.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=421

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 146/212 (69%), Gaps = 7/212 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            D +QCE IQHL+DVT+ VA+  L  +K L  K    E   + +     +Y+   G     
Sbjct  211  DTDQCEVIQHLIDVTQTVASADLDSEKVLTKKKSSKEELTTSSKKKDDSYETDSGIR--T  268

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             S+S +  S SS+H+L+S K S   E+WH+DLL CCS P+LC+KT  FPC T ++I+T A
Sbjct  269  TSSSTSYVSFSSEHELVSGKSSRHREDWHTDLLDCCSAPVLCLKTFFFPCCTLAKISTVA  328

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNR ISSA ACNELM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCALV
Sbjct  329  TNRQISSATACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDDFLSHLMCCCCALV  388

Query  253  QEWreieirgieG---THKTK-TSPPSTQFME  170
            QE RE+EIRG      T K K  SPP+ QFME
Sbjct  389  QELREVEIRGASSHAGTEKDKEMSPPTPQFME  420



>ref|XP_010489415.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=420

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 146/211 (69%), Gaps = 6/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            D +QCE IQHL+DVT+ VA+  L  +K L  K    E   + +     +Y+   G     
Sbjct  211  DTDQCEVIQHLIDVTQTVASADLDSEKVLTKKKSSKEELTTSSKKKDDSYETDSGIR--T  268

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             S+S +  S SS+H+L+S K S   E+WH+DLL CCS P+LC+KT  FPC T ++I+T A
Sbjct  269  TSSSTSYVSFSSEHELVSGKSSRHREDWHTDLLDCCSAPVLCLKTFFFPCCTLAKISTVA  328

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TNR ISSA ACNELM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCALV
Sbjct  329  TNRQISSATACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDDFLSHLMCCCCALV  388

Query  253  QEWreieirgieG--THKTK-TSPPSTQFME  170
            QE RE+EIRG     T K K  SPP+ QFME
Sbjct  389  QELREVEIRGASSHGTEKDKEMSPPTPQFME  419



>ref|XP_006297774.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
 gb|EOA30672.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
Length=417

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 140/212 (66%), Gaps = 13/212 (6%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV++CE IQ L+DVT+  A+    D      P KV+    D  S  Q  D  Y  + +  
Sbjct  213  DVDECEVIQRLIDVTQTAASADDTD------PEKVKSSKEDLTS-SQKKDDLYETDSDIR  265

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
            +TSR+TS VSS HDL+S K S   EEWH+DLL CCSEP L +KT  FPC T ++I+T AT
Sbjct  266  TTSRSTSYVSSGHDLLSRKSSQHREEWHTDLLDCCSEPCLSLKTFFFPCCTLAKISTVAT  325

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
             R ISSA+ACN+LM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCALVQ
Sbjct  326  GRQISSAKACNQLMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDDFLSHLMCCCCALVQ  385

Query  250  EWreieirgieGTHKT-----KTSPPSTQFME  170
            E           +H T     + SPP+ QFME
Sbjct  386  EL-REVKIRGANSHGTEKDMKEMSPPTPQFME  416



>ref|XP_008809428.1| PREDICTED: cell number regulator 13-like isoform X3 [Phoenix 
dactylifera]
Length=397

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 151/211 (72%), Gaps = 28/211 (13%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSDKQ-NYDQSY-GKND  620
            D++QCE IQ LL VTE +A  S P+KS   K   KVE  YSD +++K+ ++D  Y  + +
Sbjct  212  DISQCEVIQRLLAVTENIAC-SPPEKSEKLKDSKKVESDYSDTNTEKRYSFDGDYCSQQN  270

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            + +  S++ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP                   
Sbjct  271  DSYMASKSVSQVSSGHDLISNRGSHRHEDWHSDLLGCCSEP-------------------  311

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
                 ++SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG  DDFLSHLMCCCCA
Sbjct  312  -----NLSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGLCDDFLSHLMCCCCA  366

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFMES  167
            LVQEWRE+EIRG+ GT +TKTS P +Q+MES
Sbjct  367  LVQEWREVEIRGVYGTEETKTSSPPSQYMES  397



>ref|XP_008242042.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Prunus 
mume]
Length=385

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 133/160 (83%), Gaps = 6/160 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQ-NYDQSYGKNDEK  614
            DV+QCE IQ LL+VTE VA+ S P+K+      K E  YSDA+S+K+ + ++SY K++ +
Sbjct  212  DVSQCEVIQRLLEVTETVASKSSPEKNNK----KTERNYSDANSEKEPSSNESYQKSESR  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
               SRNTSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT  +PCGTFS+IA+ A
Sbjct  268  -KMSRNTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPSLCIKTFFYPCGTFSKIASVA  326

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
            TNRH+SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I
Sbjct  327  TNRHMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNI  366



>gb|ABR16594.1| unknown [Picea sitchensis]
Length=418

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 140/209 (67%), Gaps = 5/209 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDA-DSDKQNYDQSYGKNDEK  614
            DV+QC+ I+HL++VTE VA      K       +  H  +D  +      D SY +  + 
Sbjct  214  DVDQCDVIRHLIEVTENVANIPPERKHFQHSNCEENHPCADCCEEQPSPMDGSYLRKQD-  272

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
                R  SS+SS  DLIS +GSHRYEEW +DL GCC EP LC KT ++PCGTFS IA  A
Sbjct  273  ---GRQDSSISSGRDLISQRGSHRYEEWKTDLFGCCMEPYLCFKTCIYPCGTFSNIAAVA  329

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            +N  IS  +ACN+LM YSL+  CCCYTCC+RRKLRK L+I GG  DDFL+H+ CCCCALV
Sbjct  330  SNGKISPEQACNDLMTYSLVFGCCCYTCCMRRKLRKLLNIAGGMCDDFLTHMTCCCCALV  389

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWREIE RG++ +H  K SPP +Q MES
Sbjct  390  QEWREIECRGLDDSHMKKMSPPPSQQMES  418



>ref|XP_010692506.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692507.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692508.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
Length=406

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 143/208 (69%), Gaps = 11/208 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDA-DSDKQNYDQSYGKNDEK  614
            DV QC+ IQHL+ VTE  +  S            +E  YS++ D    + D++  K+++ 
Sbjct  208  DVKQCQVIQHLIGVTEAASRHSR----------NLEASYSNSRDRKALSGDENCRKSNDA  257

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             ST R TS  S +HDL   KGS   E+WH+DLL CCSEP LC KT  FPCGT SRIA+ A
Sbjct  258  LSTVRMTSLPSREHDLKYPKGSDPVEDWHTDLLDCCSEPKLCAKTCFFPCGTISRIASVA  317

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             N H+SS EACNEL AYSL +SCCCYTCCIR+K RK  +I GG  DDFLSHL+CCCC+LV
Sbjct  318  NNTHMSSGEACNELAAYSLFMSCCCYTCCIRKKFRKIFNIKGGLCDDFLSHLLCCCCSLV  377

Query  253  QEWreieirgieGTHKTKTSPPSTQFME  170
            QE+RE+EIRG++G  K+ TSPPS Q ME
Sbjct  378  QEYREMEIRGVKGPVKSMTSPPSAQQME  405



>gb|EYU17580.1| hypothetical protein MIMGU_mgv1a007522mg [Erythranthe guttata]
Length=404

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 153/213 (72%), Gaps = 21/213 (10%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK------SLPAKPLKVEHGYSDADSDKQNYDQSYG  629
            DV QC+ I+ LL+V E+ AA+S+ DK      S  ++P+K EH +S+ +  K  YD +  
Sbjct  206  DVGQCQVIERLLEVAEI-AASSVTDKDSSHKASQVSEPVK-EHSFSENNPRK--YDNTSK  261

Query  628  KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSR  449
             + E         +VS  H++ +++ + R ++WH+DLLGCCSEP LCIKT + PC T S+
Sbjct  262  GSRE--------VTVSRSHNMTTNRDAIRQDKWHADLLGCCSEPYLCIKTFVCPCDTLSK  313

Query  448  IATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCC  269
            IA+ AT + ISSAEACN+++AYSLILSCCCYTCC+RRKLR+ L+I GG++DD LSH+MCC
Sbjct  314  IASVATGKEISSAEACNDILAYSLILSCCCYTCCLRRKLRRTLNIQGGWLDDLLSHIMCC  373

Query  268  CCALVQEWreieirgieGTHKTKTSPPSTQFME  170
            CCALVQE+RE+EIRG     +T TSPP +Q ME
Sbjct  374  CCALVQEYRELEIRGGL---QTWTSPPKSQSME  403



>ref|XP_006409246.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
 gb|ESQ50699.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
Length=373

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 121/181 (67%), Gaps = 31/181 (17%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QCE IQ L+ VTE  A                       D D ++ ++   KN +K 
Sbjct  213  DTDQCEVIQRLIGVTETAA-----------------------DVDPESVEELCKKNSKK-  248

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                     SS+HD++S + S  +EEWH+DLL CCSEP LC+KT++FPCGT S+I+T A 
Sbjct  249  -------DDSSRHDIVSGRSSQHHEEWHTDLLDCCSEPSLCLKTVIFPCGTLSKISTVAK  301

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            NRHISS EACNELM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCALVQ
Sbjct  302  NRHISSTEACNELMVYSLILSCCCYTCCIRQKLRKTLNIKGGSIDDFLSHLMCCCCALVQ  361

Query  250  E  248
            E
Sbjct  362  E  362



>ref|XP_010413502.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413510.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413517.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
Length=419

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 145/211 (69%), Gaps = 7/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            D +QCE IQ L+D T+  A+  L  +K L  K    +   + +   K   D SY  +   
Sbjct  211  DNDQCEVIQRLIDYTQTAASADLDSEKGLLTKKKSSKEERTTSSKKK---DDSYETDSGI  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSR+TS VSS+HDL+S   S   E+WH+DLL CCS P LC+KT  FPC T ++I+T A
Sbjct  268  RTTSRSTSYVSSEHDLVSGISSRHREDWHTDLLDCCSAPSLCLKTFFFPCCTLAKISTVA  327

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            T R ISSA+ACN+LM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCALV
Sbjct  328  TKRQISSAKACNDLMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDDFLSHLMCCCCALV  387

Query  253  QEWreieirgieG--THKTK-TSPPSTQFME  170
            QE RE+EIRG     T K K  SPP+ QFME
Sbjct  388  QELREVEIRGASSYGTEKDKEMSPPTPQFME  418



>gb|KJB17609.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=378

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDK-QNYDQSYGKNDE  617
            DV QCE IQHLLDVTEV A  S+PDKS   K  K  E  YSD D++   +Y+ +  K  +
Sbjct  211  DVKQCEVIQHLLDVTEVAA--SIPDKSSSPKVSKKVERNYSDVDNENGHSYNDNSPKKPD  268

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
               TSRNTSSVSS HDL+S +GSHRYEEW++DLLGCCSEP LCIKT  +PCGTFS+IAT 
Sbjct  269  SRMTSRNTSSVSSGHDLLSDRGSHRYEEWNADLLGCCSEPSLCIKTFFYPCGTFSKIATV  328

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
            ATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  329  ATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNI  369



>ref|XP_010467574.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 145/211 (69%), Gaps = 7/211 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLD-VTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            D +QCE IQHL+D VT+  A+  L  + +  K    +   + +   K   D  Y  +   
Sbjct  211  DTDQCEVIQHLIDHVTQTAASADLDSEKVLTKKKSSKEELTTSSKKK---DDLYETDSGI  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSR+TS VSS+H+L+S   S   E+WH+DLL CCS P LC+KT  FPC T ++I+T A
Sbjct  268  RTTSRSTSYVSSEHELVSGISSRHREDWHTDLLDCCSAPSLCLKTFFFPCCTLAKISTVA  327

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TN  ISSA+ACNELM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCALV
Sbjct  328  TNTKISSAKACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDDFLSHLMCCCCALV  387

Query  253  QEWreieirgieG--THKTK-TSPPSTQFME  170
            QE RE+EIRG     T K K  SPP+ QFME
Sbjct  388  QELREVEIRGASSHGTEKDKEMSPPTPQFME  418



>ref|XP_010680412.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 130/183 (71%), Gaps = 7/183 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSY-GKNDEK  614
            D+ QCE IQ LLDVT+  A     +KS   K      G   A     N   S+ G + +K
Sbjct  208  DMTQCEVIQRLLDVTQTAAVVCETEKSESVK------GNKRAQPPYANEKYSFDGTSPKK  261

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
               SR  S+VSS+ DL+S++ SH + EWH+DLL CC+EP LC+KT+ +PCGTF++I+T A
Sbjct  262  NEISRTASTVSSRRDLLSNRSSHHHGEWHTDLLDCCAEPCLCLKTIFYPCGTFAKISTVA  321

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
             N+++SSAEACN+L+AYSLILSCCCYTCC+R KLRK L+I GG  DDFLSH MCCCCALV
Sbjct  322  NNKYMSSAEACNDLVAYSLILSCCCYTCCVRGKLRKILNINGGVFDDFLSHFMCCCCALV  381

Query  253  QEW  245
            QE+
Sbjct  382  QEY  384



>ref|XP_010467573.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=420

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 145/212 (68%), Gaps = 8/212 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLD-VTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            D +QCE IQHL+D VT+  A+  L  + +  K    +   + +   K   D  Y  +   
Sbjct  211  DTDQCEVIQHLIDHVTQTAASADLDSEKVLTKKKSSKEELTTSSKKK---DDLYETDSGI  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
             +TSR+TS VSS+H+L+S   S   E+WH+DLL CCS P LC+KT  FPC T ++I+T A
Sbjct  268  RTTSRSTSYVSSEHELVSGISSRHREDWHTDLLDCCSAPSLCLKTFFFPCCTLAKISTVA  327

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
            TN  ISSA+ACNELM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCALV
Sbjct  328  TNTKISSAKACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDDFLSHLMCCCCALV  387

Query  253  QEWreieirgieG---THKTK-TSPPSTQFME  170
            QE RE+EIRG      T K K  SPP+ QFME
Sbjct  388  QELREVEIRGASSHAGTEKDKEMSPPTPQFME  419



>ref|XP_002886128.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62387.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 140/213 (66%), Gaps = 15/213 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QCE IQ L+DVT+  A++  PD     K L  +   + +      YD       + W
Sbjct  213  DADQCEVIQRLIDVTQTAASSVEPD---LEKVLTKKEELTSSKKKDDLYDT------DSW  263

Query  610  stsr---ntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            S      +TS VSS H+L+S + S  +E WH+DLL CCSEP LC KT  FPCGT ++I+T
Sbjct  264  SLMVECRSTSYVSSGHELLSGRSSQHHENWHADLLDCCSEPCLCFKTFFFPCGTLAKIST  323

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             AT+R ISS EAC  LM YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCA
Sbjct  324  MATDRQISSTEACKNLMVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCA  383

Query  259  LVQEWreieirgi---eGTHKTKTSPPSTQFME  170
            LVQE RE+EIRG+         + SPP+ QFME
Sbjct  384  LVQELREVEIRGVSYGTEMSNKEMSPPTPQFME  416



>ref|NP_001031366.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06683.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=414

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 137/210 (65%), Gaps = 12/210 (6%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    D  + D S  + D 
Sbjct  213  DADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRDDLYDTDSSSIRADS  268

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KTL FPCGT ++I+T 
Sbjct  269  R-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKTLFFPCGTLAKISTV  323

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCAL
Sbjct  324  ATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCAL  383

Query  256  VQEWreieirgieGTHKTK-TSPPSTQFME  170
            VQE RE+EI         K  SPP+ QFME
Sbjct  384  VQELREVEIHRASYEKSNKEMSPPTPQFME  413



>gb|KDO71309.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=409

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQ-NYDQSYGKNDE  617
            DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+ K  ++++   K D 
Sbjct  211  DVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDNGKNHSFNEKSNKCDA  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+KT  +PCGTFS+IAT 
Sbjct  271  RTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMKTFFYPCGTFSKIATV  329

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
            AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I
Sbjct  330  ATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNI  370



>pir||D84556 hypothetical protein At2g17780 [imported] - Arabidopsis thaliana
Length=417

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 138/213 (65%), Gaps = 15/213 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    D  + D S  + D 
Sbjct  213  DADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRDDLYDTDSSSIRADS  268

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KTL FPCGT ++I+T 
Sbjct  269  R-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKTLFFPCGTLAKISTV  323

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCAL
Sbjct  324  ATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCAL  383

Query  256  VQEWreieirgieGTHKTKT----SPPSTQFME  170
            VQE RE+EI         K+    SPP+ QFME
Sbjct  384  VQELREVEIHRASYAGTEKSNKEMSPPTPQFME  416



>ref|NP_179369.2| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 sp|Q3EBY6.1|MCAC2_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 2 [Arabidopsis 
thaliana]
 dbj|BAF46390.1| Mca2 [Arabidopsis thaliana]
 gb|AEC06682.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=416

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 142/212 (67%), Gaps = 14/212 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    D  + D S  + D 
Sbjct  213  DADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRDDLYDTDSSSIRADS  268

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KTL FPCGT ++I+T 
Sbjct  269  R-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKTLFFPCGTLAKISTV  323

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCAL
Sbjct  324  ATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCAL  383

Query  256  VQEWreiei-rgieGTHKT--KTSPPSTQFME  170
            VQE RE+EI R   GT K+  + SPP+ QFME
Sbjct  384  VQELREVEIHRASYGTEKSNKEMSPPTPQFME  415



>emb|CDY30346.1| BnaA09g09310D [Brassica napus]
Length=389

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 128/212 (60%), Gaps = 42/212 (20%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QC+ IQ L+ VTE V                      D     ++YD +Y K     
Sbjct  214  DTDQCQVIQRLIAVTETV------------------EDVDDETEKDESYDTAYPKKS---  252

Query  610  stsrntssvsSKHDLISSKG---SHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
                            S++G   S   EEWH+DLL CCSEP LC+KTL FPCGT ++I+T
Sbjct  253  ----------------STRGLESSQHQEEWHTDLLDCCSEPTLCLKTLFFPCGTLAKIST  296

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             ATN+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L+I GG IDDFLSHLMCCCCA
Sbjct  297  VATNKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLNIKGGSIDDFLSHLMCCCCA  356

Query  259  LVQEWreieirgieGTHKTK--TSPPSTQFME  170
            LVQE RE+EI G     K K   +PPS QFME
Sbjct  357  LVQELREVEIHGASYAEKKKKNMTPPSPQFME  388



>gb|KCW53204.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
Length=316

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQN-YDQSYGKNDE  617
            D++QCE IQHL+DVTE V    + +   P K  K V +  SDA+++K +  D+S  K  +
Sbjct  138  DMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANNEKNHPSDESRSKKSD  197

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
              + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+KTLLFPCGTFSR+AT 
Sbjct  198  CSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVKTLLFPCGTFSRVATV  257

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  302
            A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I   F
Sbjct  258  ASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQVFF  302



>ref|XP_009112457.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Brassica rapa]
Length=376

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 128/209 (61%), Gaps = 36/209 (17%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QC+ IQ L+ VTE V       + +  +P+K E           +YD  Y K     
Sbjct  201  DTDQCQVIQRLIAVTETV-------EDVDDEPVKDE-----------SYDTVYAK-----  237

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                       K      + S   EEWH+DLL CCSEP LC+KT  FPCGT ++I+T AT
Sbjct  238  -----------KSRTRGMESSQHQEEWHTDLLDCCSEPTLCLKTFFFPCGTLAKISTVAT  286

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            N+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L I GG IDDFLSHLMCCCCALVQ
Sbjct  287  NKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLKIKGGSIDDFLSHLMCCCCALVQ  346

Query  250  EWreieirgieGTHKTK--TSPPSTQFME  170
            E RE+EI G     K K   +PPS QFME
Sbjct  347  ELREVEIHGASYAEKKKKNMTPPSPQFME  375



>ref|XP_009112455.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Brassica rapa]
Length=389

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 128/209 (61%), Gaps = 36/209 (17%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QC+ IQ L+ VTE V       + +  +P+K E           +YD  Y K     
Sbjct  214  DTDQCQVIQRLIAVTETV-------EDVDDEPVKDE-----------SYDTVYAK-----  250

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                       K      + S   EEWH+DLL CCSEP LC+KT  FPCGT ++I+T AT
Sbjct  251  -----------KSRTRGMESSQHQEEWHTDLLDCCSEPTLCLKTFFFPCGTLAKISTVAT  299

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            N+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L I GG IDDFLSHLMCCCCALVQ
Sbjct  300  NKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLKIKGGSIDDFLSHLMCCCCALVQ  359

Query  250  EWreieirgieGTHKTK--TSPPSTQFME  170
            E RE+EI G     K K   +PPS QFME
Sbjct  360  ELREVEIHGASYAEKKKKNMTPPSPQFME  388



>ref|XP_009112456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Brassica rapa]
Length=388

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 128/208 (62%), Gaps = 35/208 (17%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QC+ IQ L+ VTE V       + +  +P+K E           +YD  Y K     
Sbjct  214  DTDQCQVIQRLIAVTETV-------EDVDDEPVKDE-----------SYDTVYAK-----  250

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                       K      + S   EEWH+DLL CCSEP LC+KT  FPCGT ++I+T AT
Sbjct  251  -----------KSRTRGMESSQHQEEWHTDLLDCCSEPTLCLKTFFFPCGTLAKISTVAT  299

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            N+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L I GG IDDFLSHLMCCCCALVQ
Sbjct  300  NKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLKIKGGSIDDFLSHLMCCCCALVQ  359

Query  250  EWreieirgieGTHKTKT-SPPSTQFME  170
            E RE+EI G     K K  +PPS QFME
Sbjct  360  ELREVEIHGASYEKKKKNMTPPSPQFME  387



>gb|KCW56602.1| hypothetical protein EUGRSUZ_I02323 [Eucalyptus grandis]
Length=472

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 130/182 (71%), Gaps = 9/182 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY-SDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LL+VTE VA+ SLPD   P K  K +  Y SDADSD+ Q+  ++Y  N  
Sbjct  211  DMNQCEVIQRLLEVTETVASNSLPDYGSPVKGSKKKEKYTSDADSDREQSTGETYPNNST  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                +  ++SVS  +DL+ SKGS+ + EWH+DLLGCCSEPLLCIKT   PC TFS+IAT 
Sbjct  271  S--KTSRSTSVSLDNDLLPSKGSYGHYEWHTDLLGCCSEPLLCIKTFFCPCDTFSKIATV  328

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIP--GGFIDDFLSHLMCCCC  263
            ATNRH+S  EACN+L+AYSLILSCCCYTCC+RRKLRK L+I   G  I    SH++C   
Sbjct  329  ATNRHMSPGEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITVVGLMIS---SHILCAAA  385

Query  262  AL  257
            AL
Sbjct  386  AL  387



>ref|XP_011083456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=405

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 136/210 (65%), Gaps = 14/210 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLP---AKPLKVEHGYSDADSDKQNYDQSYGKND  620
            DV++CE I+ LL+VTE  AA+S  +K  P   ++ L+ E G+  ++ +    D      +
Sbjct  206  DVSECEVIERLLEVTEN-AASSAREKESPCKVSQKLEPEKGHFSSEKNPSKVDALMTSRE  264

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
              +S+          H+  S   +   E+W +DLLGCCSEP LCIKT   PC T S+IA+
Sbjct  265  ATFSSV---------HNTGSKGEATWQEDWQADLLGCCSEPYLCIKTFFCPCDTLSKIAS  315

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
            AAT   IS AEACNE+MAYSLI++CCCYTCC+RRKLR+ L+I GG+ DDFLSH MCCCCA
Sbjct  316  AATGEEISPAEACNEIMAYSLIMACCCYTCCVRRKLRRTLNIRGGWFDDFLSHFMCCCCA  375

Query  259  LVQEWreieirgieGTHKTKTSPPSTQFME  170
            LVQEWRE+EIRG        T PP  Q ME
Sbjct  376  LVQEWREVEIRGGPQKSWI-TRPPPYQEME  404



>emb|CDY26830.1| BnaC09g09570D [Brassica napus]
Length=391

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 131/214 (61%), Gaps = 44/214 (21%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QC+ IQ L+ VTE V       + +  +P+K             +YD  Y K     
Sbjct  214  DTDQCQVIQRLIAVTETV-------EDVDDEPVK-----------DDSYDAVYPKKS---  252

Query  610  stsrntssvsSKHDLISSKG---SHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
                            S++G       EEWH+DLL CCSEP LC+KT  FPCGT ++I+T
Sbjct  253  ----------------STRGLESPQHQEEWHTDLLDCCSEPTLCLKTFFFPCGTLAKIST  296

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
             ATN+ I+S+EAC++LM YSLILSCCCYTCCIR+KLRK LSI GG IDDFLSHLMCCCCA
Sbjct  297  VATNKQITSSEACSDLMVYSLILSCCCYTCCIRKKLRKTLSIKGGSIDDFLSHLMCCCCA  356

Query  259  LVQEWreieirgie-GTHKTK---TSPPSTQFME  170
            LVQE RE+EIRG    T K K    +PP  QFME
Sbjct  357  LVQELREVEIRGASYETEKKKMKNMTPPLPQFME  390



>ref|NP_001031367.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06684.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=410

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 123/183 (67%), Gaps = 11/183 (6%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    D  + D S  + D 
Sbjct  213  DADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRDDLYDTDSSSIRADS  268

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KTL FPCGT ++I+T 
Sbjct  269  R-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKTLFFPCGTLAKISTV  323

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
            AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG IDDFLSHLMCCCCAL
Sbjct  324  ATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCAL  383

Query  256  VQE  248
            VQE
Sbjct  384  VQE  386



>ref|XP_004512162.1| PREDICTED: cell number regulator 13-like isoform X6 [Cicer arietinum]
Length=387

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVE-HGYSDADSDK--QNYDQSYGKND  620
            D+NQCE IQ LLDVT+V A  SLPD   P K  K E + YS+A+ DK   + ++ Y K D
Sbjct  211  DMNQCEVIQRLLDVTKV-AEYSLPDNCSPEKSHKKEKYSYSNANDDKGLSSDEKYYAKTD  269

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
               ST   +    S+ DL+S+ GS++  EWH+DLL CCSEP LC+KT  +PCGTFS+IAT
Sbjct  270  ---STVSTSRFSVSQKDLMSTGGSYQQAEWHTDLLACCSEPSLCLKTFFYPCGTFSKIAT  326

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
             A NR +SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I
Sbjct  327  VAKNRPMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNI  368



>ref|XP_009386557.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 8/165 (5%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYG-----  629
            DV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   DK++Y  SYG     
Sbjct  212  DVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLDDKEDYS-SYGNYYSQ  269

Query  628  KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSR  449
            ++D   ++SR +S  SS HDL+S+K S RYEEWHSDLLGCCSEP LCIKT  FPCGTFS+
Sbjct  270  QDDTCKASSRISSIASSGHDLLSNKASSRYEEWHSDLLGCCSEPFLCIKTCCFPCGTFSK  329

Query  448  IATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
            IA+ A NRH+SSAEACN+ MAY+L+LSCCCYTCCIRRKLRK L+I
Sbjct  330  IASVAKNRHVSSAEACNDFMAYALVLSCCCYTCCIRRKLRKMLNI  374



>gb|EPS70744.1| mid1-complementing activity 2 [Genlisea aurea]
Length=376

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 124/207 (60%), Gaps = 37/207 (18%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            DV QCE I+ L++VTE  A  ++  +S    P KV     D ++   ++++S       W
Sbjct  206  DVKQCEVIERLMEVTETAACAAVETES----PRKVAVPEVDDETTNSSHNES-----RVW  256

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                                    E+WH+DLLGCCSEP LC+KT + PC T S+IAT A+
Sbjct  257  D-----------------------EDWHADLLGCCSEPYLCVKTCVCPCDTLSKIATVAS  293

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
             + I   EACN+++AYSLILSCCCYTCCIRRKLR+ L I GG +DDFLSHLMCCCCA+VQ
Sbjct  294  GKEI--WEACNDILAYSLILSCCCYTCCIRRKLRRALGIEGGCLDDFLSHLMCCCCAVVQ  351

Query  250  EWreieirgieGTHKTKTSPPSTQFME  170
            EW       I G   ++ +PP +Q ME
Sbjct  352  EW---REVKIRGAEGSRIAPPPSQTME  375



>gb|AFK40961.1| unknown [Lotus japonicus]
Length=386

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (71%), Gaps = 6/161 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVEHGYSDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LL+VTEV A+ S+P+K S      K E+ YSDA+ +K  + D+ Y     
Sbjct  211  DMNQCEVIQRLLEVTEV-ASYSVPEKCSSEKSHKKEEYNYSDANGEKVHSSDEKYHA---  266

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K  T   +    S+ DL S+ GS+  E+WH+DLL CCSEP LC+KT  +PCGTFS+IA+ 
Sbjct  267  KVDTVSPSRFSVSRKDLQSNGGSYHQEDWHTDLLACCSEPSLCMKTFFYPCGTFSKIASV  326

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
            A NR ISS EACN LMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  327  AKNRPISSGEACNGLMAYSLILSCCCYTCCVRRKLRKMLNI  367



>ref|XP_006574667.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X6 [Glycine max]
 ref|XP_006574668.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X7 [Glycine max]
Length=378

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 116/162 (72%), Gaps = 10/162 (6%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADSDK--QNYDQSYGKND  620
            D++Q EFIQHLLDVTEV A   L D     K ++  ++ YSDA+ DK   + ++ + KND
Sbjct  215  DLHQYEFIQHLLDVTEVAA---LYDSKKNHKTVEYSDYSYSDANGDKAHSSNEKIHKKND  271

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
                T   + S  S+ DL+S+ GS+  E+WH+DLL CCSEP LC KT  +PCGT S+IAT
Sbjct  272  ----THSASGSSVSEKDLLSTGGSYHREDWHTDLLACCSEPCLCFKTCFYPCGTLSKIAT  327

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
             A NR ISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  328  VANNRPISSAEACNELMAYSLILSCCCYTCCMRRKLRKMLNI  369



>gb|EEE65313.1| hypothetical protein OsJ_20556 [Oryza sativa Japonica Group]
Length=458

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 120/185 (65%), Gaps = 29/185 (16%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVE--HGYSDADSDKQNYDQSYGKND  620
            D+ QCE IQHLL VT+ VA +S+P+K + P    K +  H     DS K  +D S  K  
Sbjct  181  DMGQCEVIQHLLGVTKTVA-SSIPEKCATPKVSEKADSNHTKVSEDSAKTYHDDSPKKQK  239

Query  619  EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
            +  +  R++   S  HDL+SS+GS+  +EWH+DLLGCCSEP L                 
Sbjct  240  DACTAPRSSPPSSYGHDLVSSRGSYS-DEWHADLLGCCSEPSL-----------------  281

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
                   SS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG IDDFLSHLMCCCCA
Sbjct  282  -------SSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGGCIDDFLSHLMCCCCA  334

Query  259  LVQEW  245
            LVQEW
Sbjct  335  LVQEW  339



>gb|KDP44714.1| hypothetical protein JCGZ_01214 [Jatropha curcas]
Length=381

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 117/211 (55%), Gaps = 40/211 (19%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDADSDKQNYDQSYGKN  623
            D NQC  I+HL++VTE V   ++P+K     L  +P  +  GY D++ D           
Sbjct  206  DPNQCRVIEHLIEVTENVV-NAIPEKKVTKVLVNEPTYILSGYEDSNPD-----------  253

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
                                  KG     EW  DL  CC EP L +KT ++PCGTFS IA
Sbjct  254  ---------------------DKGQF---EWQVDLFDCCEEPCLSLKTCIYPCGTFSSIA  289

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
               +   IS   A N+LMAY++   CCCY+C IRRK+R+ L+I GG  DDFL+HLMCCCC
Sbjct  290  NVVSKGEISRERAINDLMAYAIFCGCCCYSCGIRRKVRQVLNIEGGICDDFLTHLMCCCC  349

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            A+VQEWRE+E+RG EG    K  PP  QFM+
Sbjct  350  AMVQEWRELEVRGFEGCQGRKMIPPPYQFMK  380



>ref|XP_010087526.1| hypothetical protein L484_006931 [Morus notabilis]
 gb|EXB29257.1| hypothetical protein L484_006931 [Morus notabilis]
Length=388

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 120/208 (58%), Gaps = 27/208 (13%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D +QC  I+HL+DVTE V   +LP K +  K L  E  Y     D  N D     ++E  
Sbjct  208  DPDQCRVIEHLIDVTENVV-NALPSKKV-KKVLSNEPTYV-VSGDITNGDFELKTDNEVQ  264

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
            S                        EW +DL+GCC+EP L +KT ++PCGTFS +A   +
Sbjct  265  S------------------------EWQADLIGCCNEPCLSLKTFIYPCGTFSWMANIVS  300

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
               IS   A N L+AYSL+  CCCY+CC+RRKLR+ L+I GG  DDFL+HLMCCCCA+VQ
Sbjct  301  RGKISRERAINNLLAYSLVGGCCCYSCCMRRKLRELLNIEGGSCDDFLTHLMCCCCAMVQ  360

Query  250  EWreieirgieGTHKTKTSPPSTQFMES  167
            E RE+E+R  EG    K  PP  Q+M++
Sbjct  361  ERRELELRNFEGCQGRKMIPPPFQYMKT  388



>ref|XP_010067558.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Eucalyptus 
grandis]
Length=390

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 113/211 (54%), Gaps = 34/211 (16%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDADSDKQNYDQSYGKN  623
            +  QC  I+HL+ V E   + +LP K     L  +P  V  GY +         Q  G++
Sbjct  209  ETKQCRVIEHLISVAEN-PSNTLPSKRVTKLLVNQPAFVMSGYINNVKSITESFQDQGQD  267

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
            D                             W +DL GCC EP L  KT L+PCG F++IA
Sbjct  268  D-----------------------------WQADLFGCCMEPCLSFKTCLYPCGMFAKIA  298

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
             A +   IS   A N + A+SLI SCCCYT C+RR+LRK  +I G   DDFL+HLMCCCC
Sbjct  299  NAVSRGEISREVAVNNVFAFSLIGSCCCYTFCVRRRLRKLFNIQGSLCDDFLTHLMCCCC  358

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            A+VQEWRE+E+RG+EG    K  PP  QFM+
Sbjct  359  AMVQEWRELELRGVEGYQGRKMIPPPYQFMK  389



>ref|XP_009386556.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 120/209 (57%), Gaps = 36/209 (17%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYGKNDEK  614
            DV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   DK++Y  SYG     
Sbjct  212  DVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLDDKEDYS-SYGN----  265

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
                      S + D  + K S R+++                  +LFP   F +     
Sbjct  266  --------YYSQQDD--TCKASSRHQD------------------MLFPLWDFFK-NRFG  296

Query  433  TNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALV  254
              +  SSAEACN+ MAY+L+LSCCCYTCCIRRKLRK L+I GG  DDFLSHLMCCCCA V
Sbjct  297  CKKQTSSAEACNDFMAYALVLSCCCYTCCIRRKLRKMLNITGGLCDDFLSHLMCCCCAFV  356

Query  253  QEWreieirgieGTHKTKTSPPSTQFMES  167
            QEWRE+E RG     KTKT+PP++Q+MES
Sbjct  357  QEWREVEFRGTNVVDKTKTNPPASQYMES  385



>ref|XP_009369211.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Pyrus 
x bretschneideri]
Length=242

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 114/209 (55%), Gaps = 25/209 (12%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADSDKQNYDQSYGKNDE  617
            D +QC  I+HL+ V E V +  LP K +  K L  E  Y  S   ++  +     G   E
Sbjct  56   DPDQCRMIEHLIHVAENVVSGVLPGKKV-EKLLVNEPSYVVSGCITNANSIYTGPGFQPE  114

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                                +G     EW ++L GCCSEP L +KT ++PCGTFS IA  
Sbjct  115  N-----------------EGRG-----EWQAELFGCCSEPCLSLKTCIYPCGTFSWIANV  152

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             +   IS  +A + L+AYSL   CCCY CC+RRKLR+  +I G   DD L+HLMCCCCAL
Sbjct  153  VSKGKISREQAASNLIAYSLFGGCCCYACCVRRKLRELFNIEGSCCDDLLTHLMCCCCAL  212

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            VQE RE+E+R  EG H  K  PP  Q+M+
Sbjct  213  VQELRELELRSFEGCHGRKMVPPPFQWMK  241



>ref|NP_001242304.1| uncharacterized protein LOC100811369 [Glycine max]
 gb|ACU17641.1| unknown [Glycine max]
Length=372

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 98/142 (69%), Gaps = 6/142 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDK-QNYDQSYGKNDE  617
            D+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSDA+SDK  + D+ Y    +
Sbjct  211  DMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDANSDKDHSSDEKYHAKID  269

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K      +    ++ DL S+ GS++ E+WH+DLL CCSEP LC+KT  +PCGTFS+IA+ 
Sbjct  270  K---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSEPSLCMKTFFYPCGTFSKIASV  326

Query  436  ATNRHISSAEACNELMAYSLIL  371
            A NR ISS EACN+LMAYSLI 
Sbjct  327  ARNRPISSGEACNDLMAYSLIF  348



>ref|XP_006435802.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
 gb|ESR49042.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
Length=393

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 117/207 (57%), Gaps = 21/207 (10%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D  QC+ I+HL+DVTE V    LP K +  K +  E  Y  +       +  YG      
Sbjct  207  DTKQCQLIEHLIDVTENVV-NELPGKKM-QKLVANEPTYVISGYVTNAVNSGYG------  258

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                         D  S        EW +DL GC  EP L +KT ++PCGTFS+IA A T
Sbjct  259  -------------DPGSKAADESRSEWEADLFGCLREPCLSLKTCIYPCGTFSKIANAVT  305

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
               IS  +A N LMAYS+   CCCY+CCIR+KLR+  +I GG  DDFL+HLMCCCCA+VQ
Sbjct  306  EGKISREQAINTLMAYSIFCGCCCYSCCIRKKLRETFNIQGGSCDDFLTHLMCCCCAMVQ  365

Query  250  EWreieirgieGTHKTKTSPPSTQFME  170
            EWRE+E+RG EG    K  PP  Q+M+
Sbjct  366  EWRELELRGFEGCQGRKMIPPPYQYMK  392



>gb|KHN38534.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=372

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 110/208 (53%), Gaps = 22/208 (11%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D  QC  I+HL++VT+ V   S P+K    K  K+          +   D +        
Sbjct  187  DPEQCRVIEHLIEVTKNVVNMS-PNK----KVTKIVFNEPTDLIARHITDNAIAS-----  236

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                         DL    G     EW +DL GCC EP LC+KT  FPCGTFS IA   T
Sbjct  237  ------------EDLELESGDKSQSEWKTDLFGCCREPCLCLKTCFFPCGTFSWIANVVT  284

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
                S   A   L+AYS+   CCCY+CCIRRKLR + +I GG  DDFL+HLMCCCCA+VQ
Sbjct  285  RGETSRKRAMTNLVAYSIFCGCCCYSCCIRRKLRNQFNIEGGLCDDFLTHLMCCCCAMVQ  344

Query  250  EWreieirgieGTHKTKTSPPSTQFMES  167
            EWRE+E+ G     + K  PP  QFMES
Sbjct  345  EWRELELSGFGDCQERKMFPPPNQFMES  372



>ref|XP_006575552.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
Length=384

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 110/208 (53%), Gaps = 22/208 (11%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D  QC  I+HL++VT+ V   S P+K    K  K+          +   D +        
Sbjct  199  DPEQCRVIEHLIEVTKNVVNMS-PNK----KVTKIVFNEPTDLIARHITDNAIAS-----  248

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                         DL    G     EW +DL GCC EP LC+KT  FPCGTFS IA   T
Sbjct  249  ------------EDLELESGDKSQSEWKTDLFGCCREPCLCLKTCFFPCGTFSWIANVVT  296

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
                S   A   L+AYS+   CCCY+CCIRRKLR + +I GG  DDFL+HLMCCCCA+VQ
Sbjct  297  RGETSRKRAMTNLVAYSIFCGCCCYSCCIRRKLRNQFNIEGGLCDDFLTHLMCCCCAMVQ  356

Query  250  EWreieirgieGTHKTKTSPPSTQFMES  167
            EWRE+E+ G     + K  PP  QFMES
Sbjct  357  EWRELELSGFGDCQERKMFPPPNQFMES  384



>ref|XP_007008883.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY17693.1| PLAC8 family protein [Theobroma cacao]
Length=385

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 114/211 (54%), Gaps = 30/211 (14%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDADSDKQNYDQSYGKN  623
            D  QC  I+HL+DVTE V    LP K     L  +P  V  GY    ++K    +   K 
Sbjct  200  DSKQCRVIEHLIDVTENVVNV-LPGKEVHKLLVNEPAYVLAGY--MTNEKPRGRELGLKT  256

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
            +E+  +                       EW  DL  CCSEP L +KT  +PCG FS I 
Sbjct  257  EERCQS-----------------------EWQVDLFDCCSEPCLSLKTCFYPCGVFSSIT  293

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
               +    S  +A ++LMAYSLI  C CY+CCIR+KLR+  +I GG  DD+L+HL+CCCC
Sbjct  294  NVVSKGKTSREQAISDLMAYSLICGCRCYSCCIRKKLRELFNIKGGSGDDYLTHLICCCC  353

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            A+VQEWRE+E RG EG    +  PP  Q+M+
Sbjct  354  AMVQEWRELEARGFEGCEGREMIPPPYQYMK  384



>gb|KHG10652.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=332

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 91/125 (73%), Gaps = 5/125 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK-QNYDQSYGKNDEK  614
            DV QCE IQHLL+VTEV AATS PDK    +  KVE  YSDA+S+K  +YD+   K    
Sbjct  212  DVQQCEVIQHLLEVTEVAAATSAPDK----RSKKVERNYSDANSEKGHSYDEISPKKPGS  267

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAA  434
              TSRNTSSVSS  DL+S +G  RY+EWH+DLLGCCSEP LCIKT   PCGT S+IAT A
Sbjct  268  GITSRNTSSVSSGRDLLSDRGLDRYDEWHADLLGCCSEPYLCIKTFFCPCGTLSKIATVA  327

Query  433  TNRHI  419
            TNRH+
Sbjct  328  TNRHM  332



>ref|XP_008234071.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Prunus 
mume]
Length=398

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 113/214 (53%), Gaps = 32/214 (15%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLP----DKSLPAKPLKVEHGYSDADSDKQNY-DQSYGK  626
            D +QC  I+HL+DV E V +  LP    +K L  +P  V  GY    + K  Y D     
Sbjct  211  DPDQCRVIEHLIDVAENVVSGVLPGRKVEKLLVNEPSYVVSGY--ITNAKSIYGDHGLRP  268

Query  625  NDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRI  446
             +E W                          W +DL GCCSEP L +KT ++PCGTFS I
Sbjct  269  ENEGWFG------------------------WQADLFGCCSEPCLSLKTCVYPCGTFSWI  304

Query  445  ATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCC  266
            A   +    S  +A N+L+A S+   CCCYTC +RRKLR+  SI G   DDF +HLMCCC
Sbjct  305  ANVVSKGKTSREQATNDLIACSVFGGCCCYTCFVRRKLRQLFSIEGSSCDDFFTHLMCCC  364

Query  265  CALVQEWreieirgieGTHKTKT-SPPSTQFMES  167
            CA+VQE RE+E+R  EG   T    PPS Q M +
Sbjct  365  CAMVQERRELELRNFEGCRGTNMIVPPSLQCMNA  398



>ref|XP_008363765.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Malus domestica]
Length=392

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 115/215 (53%), Gaps = 40/215 (19%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLP----DKSLPAKPLKVEHGYSDADSDKQNYDQSYGKN  623
            D +QC  I+HL+ V E V +  LP    +K L  +P  V  GY   +  +          
Sbjct  209  DPDQCRVIEHLIHVAENVVSGVLPGKKVEKLLVNEPSYVVSGYVVFEGLR----------  258

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
                               + ++G     EW ++L GCCSEP L +KT ++PCGTFS IA
Sbjct  259  -------------------LENEGRG---EWQAELFGCCSEPCLSLKTCIYPCGTFSWIA  296

Query  442  TAATNRHISSAEACNELMA----YSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLM  275
               +   IS  +A + LMA    YSL   CCCYTCC+RRKLR+  +I G   DD L+HLM
Sbjct  297  NVVSKGKISREQAASNLMAXTCPYSLFGGCCCYTCCMRRKLREFFNIEGSCCDDLLTHLM  356

Query  274  CCCCALVQEWreieirgieGTHKTKTSPPSTQFME  170
            CCCCALVQE RE+E+R  EG +  K  PP  Q+M+
Sbjct  357  CCCCALVQERRELELRNFEGCNGRKMVPPPFQWMK  391



>ref|XP_007219349.1| hypothetical protein PRUPE_ppa019431mg [Prunus persica]
 gb|EMJ20548.1| hypothetical protein PRUPE_ppa019431mg [Prunus persica]
Length=398

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 113/211 (54%), Gaps = 30/211 (14%)
 Frame = -2

Query  784  NQCEFIQHLLDVTEVVAATSLP----DKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            +QC  I+HL+DV E V +  LP    +K L  +P  V  GY        N    YG +  
Sbjct  213  DQCRVIEHLIDVAENVVSGVLPGKKVEKLLVNEPSYVVSGYIT------NAKSIYGDHG-  265

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                             +  +   R+  W +DL  CCSEP L +K+ ++PCGTFS IA  
Sbjct  266  -----------------LRPENEGRFG-WQADLFSCCSEPCLSLKSCVYPCGTFSWIANV  307

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             +   IS  +A N L+A S+  +CCCYTC +RRKLR+  +I G   DDF +HLMCCCCA+
Sbjct  308  VSEGKISREQATNNLIACSVFGACCCYTCFVRRKLRQLFNIEGSSCDDFFTHLMCCCCAM  367

Query  256  VQEWreieirgieGTHKTKT-SPPSTQFMES  167
            VQE RE+E+R  EG   T    PPS Q M +
Sbjct  368  VQERRELELRNFEGCRGTNMIVPPSLQCMNA  398



>gb|ACF79860.1| unknown [Zea mays]
Length=84

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  421  ISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEWr  242
            +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I GG  DDFLSHL+CCCCALVQEW 
Sbjct  1    MSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIAGGCCDDFLSHLLCCCCALVQEW-  59

Query  241  eieirgieGTHKTKTSPPSTQFME  170
                     + KTK +PP+ Q+ME
Sbjct  60   REVEIRGAYSEKTKVTPPACQYME  83



>ref|XP_002520777.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41486.1| conserved hypothetical protein [Ricinus communis]
Length=393

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 118/212 (56%), Gaps = 31/212 (15%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQ---NYDQSYGK--  626
            D NQC  I+HL+DVTE V   ++P+K +  K L  E  Y  + S  +   N   SYG   
Sbjct  205  DTNQCRVIEHLIDVTENVV-NAIPEKKV-TKLLVNEPTYLISGSGFRYISNAQSSYGDLK  262

Query  625  -NDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSR  449
             +DEK  +                       EW  DL  CC EP L + T ++PCGTFSR
Sbjct  263  PDDEKGQS-----------------------EWQVDLFDCCKEPCLSLNTCIYPCGTFSR  299

Query  448  IATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCC  269
            IA   +   I    A N++MAY++   CCCYTCC RR++R+   I GG  DDFL+HLMCC
Sbjct  300  IANLVSEGEIPHERAVNDVMAYAIFCGCCCYTCCFRRRIRQIFDIEGGACDDFLTHLMCC  359

Query  268  CCALVQEWreieirgieGTHKTKTSPPSTQFM  173
            CCA+VQE RE+E+RG EG  + K  PP  Q+M
Sbjct  360  CCAMVQELRELEVRGFEGCQERKMIPPPYQYM  391



>ref|XP_010658233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Vitis vinifera]
Length=446

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 113/209 (54%), Gaps = 31/209 (15%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADSDKQNYDQSYGKNDE  617
            D  QC  I+HL++VT+ V        ++P + L   H Y  S  +++ ++    +G   E
Sbjct  266  DPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEANAKSCHGGHGSQPE  318

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                S                      EW +DL GCC EP L +KT  +PCG FS IA  
Sbjct  319  DQDES----------------------EWQADLFGCCREPCLSLKTCFYPCGIFSFIANV  356

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             +   IS   ACNELM YSL   CCCYTCC+RR LRK  +I GG  DDFL+HLMCCCCA+
Sbjct  357  VSKGKISRERACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSCDDFLTHLMCCCCAM  416

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  417  VQERRELELRNFDGCQGRKMIPPPFQYMK  445



>ref|XP_010658232.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Vitis vinifera]
Length=450

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 113/209 (54%), Gaps = 31/209 (15%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADSDKQNYDQSYGKNDE  617
            D  QC  I+HL++VT+ V        ++P + L   H Y  S  +++ ++    +G   E
Sbjct  270  DPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEANAKSCHGGHGSQPE  322

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                S                      EW +DL GCC EP L +KT  +PCG FS IA  
Sbjct  323  DQDES----------------------EWQADLFGCCREPCLSLKTCFYPCGIFSFIANV  360

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             +   IS   ACNELM YSL   CCCYTCC+RR LRK  +I GG  DDFL+HLMCCCCA+
Sbjct  361  VSKGKISRERACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSCDDFLTHLMCCCCAM  420

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  421  VQERRELELRNFDGCQGRKMIPPPFQYMK  449



>ref|XP_004235233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum lycopersicum]
Length=390

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 119/211 (56%), Gaps = 31/211 (15%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK---SLPAKPLKVEHGYSDADSDK-QNYDQSYGKN  623
            D  QC  I+HL+DVT+ V   ++PD+   +L A+P       S A   + Q  + S  ++
Sbjct  206  DPKQCRIIEHLIDVTQNV--VNVPDEKFLALSAQPYIRTGLVSAAKVGQVQMVNVSQAEH  263

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
             EK                          +W +DL  CCSEP LC K  ++PCG FSR+A
Sbjct  264  QEK-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGIFSRVA  298

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCC  263
            +  ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I GG  DDFL+HLMCCCC
Sbjct  299  SLVSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRQLFNIEGGSCDDFLTHLMCCCC  358

Query  262  ALVQEWreieirgieGTHKTKTSPPSTQFME  170
            A++QEWRE+E+R  +G    K  PP  Q+M+
Sbjct  359  AMIQEWRELELRDFKGCQGRKMIPPPYQYMK  389



>ref|XP_010658231.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Vitis vinifera]
Length=453

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 113/209 (54%), Gaps = 31/209 (15%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADSDKQNYDQSYGKNDE  617
            D  QC  I+HL++VT+ V        ++P + L   H Y  S  +++ ++    +G   E
Sbjct  273  DPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEANAKSCHGGHGSQPE  325

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                S                      EW +DL GCC EP L +KT  +PCG FS IA  
Sbjct  326  DQDES----------------------EWQADLFGCCREPCLSLKTCFYPCGIFSFIANV  363

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             +   IS   ACNELM YSL   CCCYTCC+RR LRK  +I GG  DDFL+HLMCCCCA+
Sbjct  364  VSKGKISRERACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSCDDFLTHLMCCCCAM  423

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  424  VQERRELELRNFDGCQGRKMIPPPFQYMK  452



>ref|XP_003518431.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=403

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 95/182 (52%), Gaps = 22/182 (12%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D  QC  I+HL++VT+ V   S P+K    K  K+          +   D +        
Sbjct  199  DPEQCRVIEHLIEVTKNVVNMS-PNK----KVTKIVFNEPTDLIARHITDNAIAS-----  248

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                         DL    G     EW +DL GCC EP LC+KT  FPCGTFS IA   T
Sbjct  249  ------------EDLELESGDKSQSEWKTDLFGCCREPCLCLKTCFFPCGTFSWIANVVT  296

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
                S   A   L+AYS+   CCCY+CCIRRKLR + +I GG  DDFL+HLMCCCCA+VQ
Sbjct  297  RGETSRKRAMTNLVAYSIFCGCCCYSCCIRRKLRNQFNIEGGLCDDFLTHLMCCCCAMVQ  356

Query  250  EW  245
            EW
Sbjct  357  EW  358



>ref|XP_006356473.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
Length=274

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 114/209 (55%), Gaps = 27/209 (13%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTE-VVAATSLPDKSLPAKPLKVEHGYSDADSDK-QNYDQSYGKNDE  617
            D  QC  I+HL+DVT+ VV   +    +L  +P       S A   + Q  + S  ++ E
Sbjct  90   DPKQCRIIEHLIDVTQNVVNVPAEKFLALNTQPYIGTRWVSAAKVGQVQMVNASQAEHQE  149

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K                          +W +DL  CCSEP LC K  ++PCG  SRIA+ 
Sbjct  150  K-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGMVSRIASL  184

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I GG  DDFL+HL+CCCCA+
Sbjct  185  VSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRRLFNIEGGSCDDFLTHLICCCCAM  244

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            +QEWRE+++R  EG    K  PP  Q+M+
Sbjct  245  IQEWRELKLRDFEGCQGRKMIPPPYQYMK  273



>ref|XP_002316192.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
 gb|EEF02363.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
Length=396

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 110/211 (52%), Gaps = 35/211 (17%)
 Frame = -2

Query  784  NQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            NQC  I+HL++VTE V    +P K     L  +P  V  GY        N   S G    
Sbjct  212  NQCRVIEHLIEVTENVV-NDVPAKKVTKLLVNEPTYVVSGYI------TNARSSNG----  260

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                             +   G     EW  DL  CC EP L +KT ++PCG FSRIA  
Sbjct  261  -----------------VLKPGDKCQSEWQVDLFDCCKEPCLSLKTCIYPCGVFSRIANV  303

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             +    S   A N+LMAYS+   CCCYTCCIR+K+R    I GG  DDFL+H MCCCCA+
Sbjct  304  VSKGKTSRERAINDLMAYSIFCGCCCYTCCIRKKIRHLFDIEGGSCDDFLTHFMCCCCAM  363

Query  256  VQEWreieirgieGT---HKTKTSPPSTQFM  173
            VQEWRE+E+RG EGT    + K  PP  Q+M
Sbjct  364  VQEWRELEVRGFEGTCGCPERKMIPPPYQYM  394



>ref|XP_006356472.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
Length=389

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 114/209 (55%), Gaps = 27/209 (13%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTE-VVAATSLPDKSLPAKPLKVEHGYSDADSDK-QNYDQSYGKNDE  617
            D  QC  I+HL+DVT+ VV   +    +L  +P       S A   + Q  + S  ++ E
Sbjct  205  DPKQCRIIEHLIDVTQNVVNVPAEKFLALNTQPYIGTRWVSAAKVGQVQMVNASQAEHQE  264

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
            K                          +W +DL  CCSEP LC K  ++PCG  SRIA+ 
Sbjct  265  K-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGMVSRIASL  299

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I GG  DDFL+HL+CCCCA+
Sbjct  300  VSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRRLFNIEGGSCDDFLTHLICCCCAM  359

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            +QEWRE+++R  EG    K  PP  Q+M+
Sbjct  360  IQEWRELKLRDFEGCQGRKMIPPPYQYMK  388



>ref|XP_011035883.1| PREDICTED: cell number regulator 13-like [Populus euphratica]
Length=388

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 109/208 (52%), Gaps = 32/208 (15%)
 Frame = -2

Query  784  NQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDADSDKQNYDQSYGKNDE  617
            +QC  I+HL++VTE V    +P K     L  +P  V  GY        N   S G    
Sbjct  207  DQCRVIEHLIEVTENVV-NDVPAKKVTKLLVNEPTYVVSGYI------TNARSSNG----  255

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                             +   G     EW  DL  C  EP L +KT ++PCG FSRIA  
Sbjct  256  -----------------VLKPGDKCQSEWQVDLFDCFKEPCLSLKTCIYPCGVFSRIANV  298

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
             +    S   A N+LMAYS+   CCCYTCCIR+K+R    I GG  DDFL+H+MCCCCA+
Sbjct  299  VSKGKTSRERAINDLMAYSIFCGCCCYTCCIRKKIRHLFDIEGGSCDDFLTHVMCCCCAM  358

Query  256  VQEWreieirgieGTHKTKTSPPSTQFM  173
            VQEWRE+E+RG EG  + K  PP  Q+M
Sbjct  359  VQEWRELEVRGFEGCPERKMIPPPYQYM  386



>emb|CDP13977.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  356
            EW +DL  CCSEP L +K  ++PCG FSRIA   +   I+  EA N LMAYSL   CCCY
Sbjct  256  EWQADLFECCSEPCLSMKACIYPCGIFSRIANVVSCGKITREEALNNLMAYSLFCGCCCY  315

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQF  176
            TCCIR K+RK   I GG  DDFL+HLMCCCCALVQEWRE+E+R  EG  + K   P  Q 
Sbjct  316  TCCIRGKVRKLFGIEGGSCDDFLTHLMCCCCALVQEWRELELRDFEGCQRRKNIAPPYQC  375

Query  175  M  173
            M
Sbjct  376  M  376



>ref|XP_002970226.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
 gb|EFJ28356.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
Length=395

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 98/181 (54%), Gaps = 21/181 (12%)
 Frame = -2

Query  784  NQCEFIQHLLDVTEV-VAATSLPDKSLPAKPLKVEH-GYSDADSDKQNYDQSYGKNDEKW  611
            +QC+ I+ L+D+TE  V  T   D     +  K E   Y  ++SD   Y +S+  N+   
Sbjct  212  DQCDVIRRLIDITETDVKGTYEKDPDYMKEAKKYEQSNYEQSNSDAYTYQESHKSNE---  268

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                            ++  S + ++WH DL GCC  PLLC+ T L PC TF+ +A  AT
Sbjct  269  ----------------TASKSWQLQDWHHDLYGCCGSPLLCVGTFLCPCCTFATVAATAT  312

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            N  +    AC   + Y+++LSCC YTCC RRKLRK  +I GG  DD  +H +C CCALVQ
Sbjct  313  NGIMPKHAACTNCLIYTMVLSCCFYTCCFRRKLRKLYNIEGGSCDDCWAHFLCFCCALVQ  372

Query  250  E  248
            E
Sbjct  373  E  373



>ref|XP_009386559.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386560.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 8/130 (6%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADSDKQNYDQSYG-----  629
            DV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   DK++Y  SYG     
Sbjct  212  DVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLDDKEDYS-SYGNYYSQ  269

Query  628  KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSR  449
            ++D   ++SR +S  SS HDL+S+K S RYEEWHSDLLGCCSEP LCIKT  FPCGTFS+
Sbjct  270  QDDTCKASSRISSIASSGHDLLSNKASSRYEEWHSDLLGCCSEPFLCIKTCCFPCGTFSK  329

Query  448  IATAATNRHI  419
            IA+ A NRH+
Sbjct  330  IASVAKNRHL  339



>ref|XP_006599316.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=335

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ DK +   S  K  EK 
Sbjct  212  DLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGDKGH--SSNEKIHEKN  267

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
             T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT  +PCGT S+IAT A 
Sbjct  268  DTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTCFYPCGTLSKIATVAN  327

Query  430  NRHI  419
            NR I
Sbjct  328  NRPI  331



>ref|XP_001785848.1| predicted protein [Physcomitrella patens]
 gb|EDQ49335.1| predicted protein, partial [Physcomitrella patens]
Length=399

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
            E+WH  L  CC EP LC++T  +PC TF+ +A  AT+   S   AC+ L  +SL   C C
Sbjct  292  EDWHHGLCDCCIEPCLCMETFCYPCETFTLVAETATDGETSQDTACHLLAFHSLYGGCYC  351

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            YTCCIRRK+R++ +IPG    D+ +H  CC CA++QE
Sbjct  352  YTCCIRRKVRQRFNIPGDCCSDYWTHACCCWCAILQE  388



>ref|XP_002978386.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
 gb|EFJ20372.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
Length=380

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 90/181 (50%), Gaps = 36/181 (20%)
 Frame = -2

Query  784  NQCEFIQHLLDVTEV-VAATSLPDKSLPAKPLKVEH-GYSDADSDKQNYDQSYGKNDEKW  611
            +QC+ I+ L+D+TE  V  T   D     +  K E   Y  ++SD   Y +S+  N+   
Sbjct  211  DQCDVIRRLIDITETDVKGTYEKDPDYMKEAKKYEQSNYEQSNSDAYTYQESHKSNE---  267

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                            ++  S + ++WH DL GCC  PLLC+ T L PC TF+ +A  AT
Sbjct  268  ----------------TASKSWQLQDWHHDLYGCCGSPLLCVGTFLCPCCTFATVAATAT  311

Query  430  NRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQ  251
            N                ++  CC YTCC RRKLRK  +I GG  DD  +H +C CCALVQ
Sbjct  312  N---------------GIMRDCCFYTCCFRRKLRKLYNIEGGSCDDCWAHFLCFCCALVQ  356

Query  250  E  248
            E
Sbjct  357  E  357



>ref|XP_008440857.1| PREDICTED: cell number regulator 13 isoform X2 [Cucumis melo]
Length=336

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 80/123 (65%), Gaps = 5/123 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADSDKQN-YDQSYGKNDE  617
            DV QC+ I+ L D+TE ++A    +K L    P + E+ YSDA+ +  + YD ++ KN +
Sbjct  211  DVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHEYNYSDANGETTHAYDGNFHKNRD  270

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+KT   PC T S++A+ 
Sbjct  271  G-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMKTFFCPCWTLSKVASV  327

Query  436  ATN  428
            ATN
Sbjct  328  ATN  330



>gb|KGN48940.1| hypothetical protein Csa_6G507150 [Cucumis sativus]
Length=336

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 81/126 (64%), Gaps = 5/126 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADSDKQN-YDQSYGKNDE  617
            DV QC+ I+ L D+TE ++A    +K L    P + ++ YSD + +  + Y  ++ KN +
Sbjct  212  DVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHDYNYSDTNGETTHAYVGNFHKNRD  271

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+KT   PC T S++A+ 
Sbjct  272  G-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMKTFFCPCWTLSKVASV  328

Query  436  ATNRHI  419
            ATNRH+
Sbjct  329  ATNRHV  334



>ref|XP_001768983.1| predicted protein [Physcomitrella patens]
 gb|EDQ66181.1| predicted protein [Physcomitrella patens]
Length=415

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 100/184 (54%), Gaps = 7/184 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            ++ +C  I+HL+D TE  AA    D  + A+ +       + + ++     +  +  E  
Sbjct  208  ELEKCGVIEHLIDFTEAAAA----DPVILAEAMAEIPEEDNEEEERHRKPHTRTEVVESS  263

Query  610  stsrntssvsSKHDLISSKGSH--RYEE-WHSDLLGCCSEPLLCIKTLLFPCGTFSRIAT  440
                     S     +SS+     R+E+ W  DL  CC +P LCI+T  +PCGTF+ +A+
Sbjct  264  KRHMKHLKPSFSTLSLSSQKVVQCRHEDNWRYDLFDCCVDPCLCIETFCYPCGTFTLVAS  323

Query  439  AATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCA  260
            + T+   S   AC++L  +SL   CCCYT CIRRK+R++  IPG    D+ +H+ CCCCA
Sbjct  324  SVTDGGTSEDSACSQLAFHSLYGGCCCYTSCIRRKVRRRFDIPGDCFSDYWAHVCCCCCA  383

Query  259  LVQE  248
            ++QE
Sbjct  384  VLQE  387



>ref|XP_010658234.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Vitis vinifera]
Length=429

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 101/209 (48%), Gaps = 55/209 (26%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADSDKQNYDQSYGKNDE  617
            D  QC  I+HL++VT+ V        ++P + L   H Y  S  +++ ++    +G   E
Sbjct  273  DPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEANAKSCHGGHGSQPE  325

Query  616  KWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATA  437
                S                      EW +DL GCC EP          C T  R    
Sbjct  326  DQDES----------------------EWQADLFGCCREP----------CLTRER----  349

Query  436  ATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCAL  257
                      ACNELM YSL   CCCYTCC+RR LRK  +I GG  DDFL+HLMCCCCA+
Sbjct  350  ----------ACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSCDDFLTHLMCCCCAM  399

Query  256  VQEWreieirgieGTHKTKTSPPSTQFME  170
            VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  400  VQERRELELRNFDGCQGRKMIPPPFQYMK  428



>ref|XP_010318233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum lycopersicum]
Length=377

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 84/163 (52%), Gaps = 31/163 (19%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK---SLPAKPLKVEHGYSDADSDK-QNYDQSYGKN  623
            D  QC  I+HL+DVT+ V   ++PD+   +L A+P       S A   + Q  + S  ++
Sbjct  206  DPKQCRIIEHLIDVTQNV--VNVPDEKFLALSAQPYIRTGLVSAAKVGQVQMVNVSQAEH  263

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
             EK                          +W +DL  CCSEP LC K  ++PCG FSR+A
Sbjct  264  QEK-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGIFSRVA  298

Query  442  TAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  314
            +  ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I
Sbjct  299  SLVSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRQLFNI  341



>gb|AAM51833.1|AC105730_7 Unknown protein [Oryza sativa Japonica Group]
Length=1202

 Score = 50.8 bits (120),  Expect(3) = 5e-10, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -2

Query  310  GGFIDDFLSHLMCCCCALVQEW  245
            GG IDDFLSHLMCCCCALVQEW
Sbjct  300  GGCIDDFLSHLMCCCCALVQEW  321


 Score = 35.4 bits (80),  Expect(3) = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 34/61 (56%), Gaps = 4/61 (7%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVE--HGYSDADSDKQNYDQSYGKND  620
            D+ QCE IQHLL VT+ V A+S+P+K + P    K +  H     DS K  +D S  K  
Sbjct  211  DMGQCEVIQHLLGVTKTV-ASSIPEKCATPKVSEKADSNHTKVSEDSAKTYHDDSPKKQK  269

Query  619  E  617
            +
Sbjct  270  D  270


 Score = 24.6 bits (52),  Expect(3) = 5e-10, Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = -1

Query  500  TSSVHKNLTISLWDIFKNCNRSNQQAY  420
            T+   +N+   LW+I K+C    +QA+
Sbjct  273  TAPRFENILFPLWNILKDCFNCEEQAH  299



>ref|XP_006486524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Citrus 
sinensis]
Length=342

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 55/128 (43%), Gaps = 29/128 (23%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPA----KPLKVEHGYSDADSDKQNYDQSYGKN  623
            D  QC+ I+HL+DVTE V    LP K +      +P  V  GY          +  YG  
Sbjct  204  DTKQCQLIEHLIDVTENVV-NELPGKKMQKLVANEPTYVISGYV-----TNAVNSGYG--  255

Query  622  DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA  443
                             D  S        EW +DL GC  EP L +KT ++PCGTFS+IA
Sbjct  256  -----------------DPGSKAADESRSEWEADLFGCLREPCLSLKTCIYPCGTFSKIA  298

Query  442  TAATNRHI  419
             A T   I
Sbjct  299  NAVTEGKI  306



>gb|KDO68875.1| hypothetical protein CISIN_1g020555mg [Citrus sinensis]
Length=324

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 55/124 (44%), Gaps = 21/124 (17%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEKW  611
            D  QC+ I+HL+DVTE V    LP K L  K +  E  Y  +       +  YG      
Sbjct  207  DTKQCQLIEHLIDVTENVV-NELPGKKL-QKLVANEPTYVISGYVTNAVNSGYG------  258

Query  610  stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAAT  431
                         D  S  G     EW +DL  C  EP L +KT ++PCGTFS+IA A T
Sbjct  259  -------------DPGSKAGDESRSEWEADLFCCLREPCLSLKTCIYPCGTFSKIANAVT  305

Query  430  NRHI  419
               I
Sbjct  306  EGKI  309



>gb|EMT07324.1| hypothetical protein F775_31025 [Aegilops tauschii]
Length=395

 Score = 59.7 bits (143),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  319  SIPGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  170
            S+ GG  DDFLSH+MCCCCALVQEWRE+EIRG  G  KTK +PP+ Q+ME
Sbjct  346  SVEGGCCDDFLSHVMCCCCALVQEWREVEIRGAYGG-KTKITPPAHQYME  394


 Score = 26.6 bits (57),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (11%)
 Frame = -1

Query  602  KKHFFSFIQTRLDFF*GLTSI*R-MAFRSFGLLFRTSSVHKNLTISLWDIFKNCNRSNQQ  426
            KK   +++  R+  F  L  I   M  + +G   R S   ++L  S+W++ KNC    +Q
Sbjct  263  KKQKDAYVAPRMLLFLTLLQIMPLMCEKQYG---RRS---EDLLFSMWNVLKNCFNRQEQ  316

Query  425  AYIF  414
            A++ 
Sbjct  317  AHVL  320



>ref|XP_002531154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31239.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSDKQNYDQSYGK  626
            DVNQCE IQHL+DVTE  AA SLP+KS P K   K+E  YSD      ++D SY K
Sbjct  211  DVNQCEVIQHLIDVTEAAAANSLPEKSSPVKTSQKLEPNYSDVSEKNHSFDGSYHK  266



>ref|XP_009604568.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nicotiana 
tomentosiformis]
Length=209

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 9/101 (9%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC--  359
            W +++  CC +P  C+KT   PC T  +IA   +    S    C E +  + +L C C  
Sbjct  72   WSTNIFACCRDPKNCLKTCFCPCITSGQIAEIVSEGRTS----CMEGVIINFLLCCFCLA  127

Query  358  ---YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
               YT   R KLR+K  + G  + D L+H +CC CAL QE+
Sbjct  128  APLYTFYNRVKLRRKFKLEGNGVLDCLTHTLCCYCALCQEY  168



>ref|XP_010489416.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Camelina sativa]
Length=315

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 3/101 (3%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSDKQNYDQSYGKNDEK  614
            D +QCE IQHL+DVT+ VA+  L  +K L  K    E   + +     +Y+   G     
Sbjct  211  DTDQCEVIQHLIDVTQTVASADLDSEKVLTKKKSSKEELTTSSKKKDDSYETDSGIR--T  268

Query  613  WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLL  491
             S+S +  S SS+H+L+S K S   E+WH+DLL CCS P+L
Sbjct  269  TSSSTSYVSFSSEHELVSGKSSRHREDWHTDLLDCCSAPVL  309



>ref|XP_008346854.1| PREDICTED: uncharacterized protein LOC103409845 [Malus domestica]
Length=388

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 51/99 (52%), Gaps = 7/99 (7%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  365
            W + L  C  +P   I TLL PC TF +IA    N    S+ A N L+ Y LI+ C    
Sbjct  249  WKTGLFECMEDPPNAIMTLLCPCWTFGQIAEIVNNG--RSSCAANALI-YMLIMLCIFVP  305

Query  364  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            C  +C  R+KLR K  +P     D ++H +C  CAL QE
Sbjct  306  CLLSCTYRKKLRNKFDLPESPAPDCITHFLCEWCALCQE  344



>ref|XP_002964322.1| hypothetical protein SELMODRAFT_28363, partial [Selaginella moellendorffii]
 ref|XP_002967711.1| hypothetical protein SELMODRAFT_28366, partial [Selaginella moellendorffii]
 gb|EFJ31058.1| hypothetical protein SELMODRAFT_28366, partial [Selaginella moellendorffii]
 gb|EFJ34655.1| hypothetical protein SELMODRAFT_28363, partial [Selaginella moellendorffii]
Length=105

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS---CC  362
            W S + GC  +P  C  T + PC TF R+A    N   S     N L+ Y L+ +   CC
Sbjct  8    WKSGICGCWRDPESCCVTGIAPCITFGRLAETVDNDLRSCLF--NGLL-YCLLCAAGLCC  64

Query  361  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            C +   R KLR+K  +PG    DF+SH  C CC+L QE+
Sbjct  65   CLSAHYRTKLREKYKLPGSRSQDFISHCFCECCSLAQEF  103



>ref|XP_011097029.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6 [Sesamum indicum]
Length=299

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 47/102 (46%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC--  365
            + W SDL  C   P   I T+ FPC TF +IA    +   S   +    M Y LI  C  
Sbjct  163  QAWRSDLFDCMKNPQNAIITMFFPCVTFGQIAEIVDSGSTSCGTSG---MLYGLIACCLA  219

Query  364  --CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              C  +C  R K+R +  +      D+L H  C CCAL QE+
Sbjct  220  IPCIMSCTYRSKMRSRFGLIESPAPDWLVHCFCECCALCQEY  261



>ref|XP_010265197.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Nelumbo nucifera]
Length=323

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS---  368
            E W + L  C  +P   + T  FPC TF ++A    N   S   +    + Y L+L    
Sbjct  186  EGWKTGLFDCMDDPTNTLITFFFPCLTFGQVAEIVDNGQTSCGTSG---LLYGLVLGFIG  242

Query  367  -CCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              C Y+C  R KLR K  +      D+++H +C  CAL QE+
Sbjct  243  LPCIYSCTYRTKLRSKFGLVESPAPDWVTHFLCEYCALCQEY  284



>ref|XP_010265196.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 4-like [Nelumbo nucifera]
Length=314

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLIL-SCC  362
            E W + L  C  +P   + T  FPC TF ++A    N + +   +     A +L++   C
Sbjct  176  EPWSTGLFDCMEDPTNAVTTAFFPCLTFGQVAEIVDNGYTNCGTSGLLYGAIALLIWIPC  235

Query  361  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             Y+C  R KLR K  +      D+++H +C  CAL QE+
Sbjct  236  IYSCTYRTKLRNKFGLMEAPAPDWVTHFLCEWCALCQEY  274



>ref|XP_010045639.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Eucalyptus 
grandis]
Length=397

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = -2

Query  553  GSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI  374
            G+   E W + L  C  +PL  + T LFPC TF ++A    N   + A A    M Y+LI
Sbjct  253  GNVNTEGWTTGLFDCMDDPLNAVITCLFPCLTFGQVAELIDNGTTTCATAG---MMYALI  309

Query  373  LSC-----CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              C     C Y+C  R KLR K  +      D++ H +   CAL QE+
Sbjct  310  -GCFIGLPCIYSCTFRSKLRSKFGLVESPAPDWIVHFLFEPCALCQEY  356



>gb|KCW83842.1| hypothetical protein EUGRSUZ_B00710 [Eucalyptus grandis]
Length=380

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = -2

Query  553  GSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI  374
            G+   E W + L  C  +PL  + T LFPC TF ++A    N   + A A    M Y+LI
Sbjct  236  GNVNTEGWTTGLFDCMDDPLNAVITCLFPCLTFGQVAELIDNGTTTCATAG---MMYALI  292

Query  373  LSC-----CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              C     C Y+C  R KLR K  +      D++ H +   CAL QE+
Sbjct  293  -GCFIGLPCIYSCTFRSKLRSKFGLVESPAPDWIVHFLFEPCALCQEY  339



>emb|CAN71842.1| hypothetical protein VITISV_036262 [Vitis vinifera]
Length=425

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = -2

Query  790  DVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSDKQ-NYDQSYGK  626
            DV QCE IQHL+ VTE VAA S+P+ +LP +   K E  YSDA+SDK+ + D+SY K
Sbjct  308  DVXQCEVIQHLIGVTEAVAANSVPEXNLPVRSSKKAESDYSDANSDKEYSVDESYPK  364



>ref|XP_010465946.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 5-like [Camelina 
sativa]
Length=183

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
              W S L  C ++    + TLL PC TF +IA          A A     A     +C  
Sbjct  50   NRWSSQLFDCMNDSENAVITLLAPCVTFGQIAEIVDEGATPCATAGVLYGAIFFTGACFV  109

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+   R K+R K  +P     D+L+HL+C  CAL QE+
Sbjct  110  YSHIFRAKIRNKYGLPDAPAPDWLTHLVCMPCALCQEY  147



>ref|XP_009025528.1| hypothetical protein HELRODRAFT_189206 [Helobdella robusta]
 gb|ESN96350.1| hypothetical protein HELRODRAFT_189206 [Helobdella robusta]
Length=230

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 8/97 (8%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
            E+W   L GC  +  LCI T  FPC T +R A           E  NE M     L  C 
Sbjct  119  EQWSFRLFGCLEDINLCISTFCFPCYTEARNAAYF-------YEEENE-MGIGYCLGFCG  170

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
                +R +LR+   I G  + D  +H++C CCAL+QE
Sbjct  171  VGAVMRWRLRQHKRIEGHMLADVATHMLCPCCALIQE  207



>ref|XP_006485849.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Citrus sinensis]
Length=315

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 56/113 (50%), Gaps = 9/113 (8%)
 Frame = -2

Query  565  ISSKGSHRYEE--WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNEL  392
            + S G    +E  W S L  C ++P+  + T  FPC TF ++A    + H +   +    
Sbjct  165  VPSPGPKSIQENAWSSGLFDCMNDPMNALVTACFPCLTFGQLAEIVDDGHTTCGTSG---  221

Query  391  MAYSLILSC----CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            + Y+ I  C    C  +C  R KLR K ++P     D+++H +C  CAL QE+
Sbjct  222  LLYAGIAFCIAIPCIMSCTYRTKLRSKFNLPEAPAPDWITHCLCEWCALCQEY  274



>ref|XP_009785412.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nicotiana 
sylvestris]
 ref|XP_009785413.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nicotiana 
sylvestris]
Length=208

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC--  359
            W +++  CC +P  C+ T   PC T   +    +    S    C E +  +L+L CC   
Sbjct  72   WSTNIFACCRDPKNCLTTCFCPCITSGHVTEIVSEGRTS----CMEGVIVNLLLCCCLAA  127

Query  358  --YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              YT   R KLRKK  + G  + D ++H +CC CAL QE+
Sbjct  128  PLYTFYNRVKLRKKFKLEGNGVLDCITHTLCCYCALCQEY  167



>ref|XP_006826803.1| hypothetical protein AMTR_s00010p00033430 [Amborella trichopoda]
 gb|ERM94040.1| hypothetical protein AMTR_s00010p00033430 [Amborella trichopoda]
Length=162

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 48/103 (47%), Gaps = 3/103 (3%)
 Frame = -2

Query  547  HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS  368
              +  W + L GCC +P  C  T   PC TF RIA    +R  +S    + L    L  +
Sbjct  24   QNFSPWSTGLCGCCEDPTNCFTTCCCPCITFGRIA-EVVDRGTTSCAVSSSLFCCLLWFT  82

Query  367  CC--CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            CC   Y+C  R KLR + ++      D L H  C  CAL QE+
Sbjct  83   CCPYLYSCTYRSKLRGQFNLEESPCADCLVHWACGYCALCQEY  125



>ref|XP_009146119.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 4-like [Brassica 
rapa]
Length=173

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
              W+SD+  C ++    + T + PC TF +IA        + A       A  L L    
Sbjct  40   NRWNSDIFDCMNDSENAVITFIVPCVTFGQIAEIVDEGATTCAIGGVLYGAIFLTLFPSV  99

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+   R K+R K  +P     D+L+HL C  CAL QE+
Sbjct  100  YSSLFRAKIRNKYGLPDAPAPDWLTHLFCEPCALCQEY  137



>gb|KJB39330.1| hypothetical protein B456_007G006900 [Gossypium raimondii]
Length=341

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W + L     +P+  + T  FPC TF +IA    + H +   +     A + ++   C  
Sbjct  207  WRTGLFDFMDDPMNALVTAFFPCLTFGQIAEIVDDGHTTCGTSGLLYGAIAFLIGLPCLM  266

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            +C  R KLR K  +P     D+++H +C  CAL QE+
Sbjct  267  SCTYRTKLRNKFGLPEAPAPDWVTHFLCEWCALCQEY  303



>ref|XP_010506915.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 5-like [Camelina 
sativa]
Length=183

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
              W S L  C ++    + TLL PC TF +IA          A A     A     +C  
Sbjct  50   NRWSSQLFDCMNDSENAVITLLAPCVTFGQIAEIVDEGATPCATAGVLYGAIFFTGACFV  109

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+   R K+R K  +P     D+++HL+C  CAL QE+
Sbjct  110  YSHIFRAKIRNKYGLPDAPAPDWITHLVCMPCALCQEY  147



>ref|XP_006817786.1| PREDICTED: cell number regulator 13-like [Saccoglossus kowalevskii]
Length=128

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 6/96 (6%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  356
            +W + L GC  +  LC+ T   PC T  + A A     +  +   + L+    ++ C C 
Sbjct  12   DWENGLFGCFGDCGLCLVTSFLPCCTAGKNAQA-----VGKSCLVHSLLGLIPVVGCVCQ  66

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            +  +RR +R++ SI G    D+L HL+C CCAL+QE
Sbjct  67   SG-VRRDIREQRSIDGSCCGDYLVHLLCGCCALIQE  101



>ref|XP_010042703.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like, partial [Eucalyptus 
grandis]
Length=165

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 11/114 (10%)
 Frame = -2

Query  568  LISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELM  389
            +++   S  Y  W +DL  C S+P LC  T   PC TF +I+       +    +C  L 
Sbjct  14   VVTPPPSLDYVPWSTDLFDCFSDPNLCCITFFCPCVTFGKISEI-----VDRGNSCCVLN  68

Query  388  A--YSLILSCCCYTCCI----RRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
               Y LI     Y  C     R K+R++  I G  I+DF+ H  C  CAL QE+
Sbjct  69   GAIYFLIAWLTGYARCFSFFNRLKMRRQYKIRGDVIEDFILHCFCEPCALTQEY  122



>ref|XP_007036477.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20978.1| PLAC8 family protein [Theobroma cacao]
Length=229

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-C  362
            + W S L     +P+  + T  FPC TF +IA    + H +   +     A + ++   C
Sbjct  91   DGWRSGLFDFMDDPMNALVTAFFPCLTFGQIAEIVDDGHTTCGTSGLLYGAIAFLIGMPC  150

Query  361  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              +C  R KLR K  +P     D+++H +C  CAL QE+
Sbjct  151  LLSCTYRTKLRNKFGLPEAPGPDWVTHFLCEWCALCQEY  189



>ref|XP_007036475.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20976.1| PLAC8 family protein [Theobroma cacao]
Length=369

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L     +P+  + T  FPC TF +IA    + H +   +     A + ++   C  
Sbjct  233  WRSGLFDFMDDPMNALVTAFFPCLTFGQIAEIVDDGHTTCGTSGLLYGAIAFLIGMPCLL  292

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            +C  R KLR K  +P     D+++H +C  CAL QE+
Sbjct  293  SCTYRTKLRNKFGLPEAPGPDWVTHFLCEWCALCQEY  329



>ref|XP_010489915.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 5-like, partial [Camelina 
sativa]
Length=158

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
              W S L  C ++    + TLL PC TF +IA          A A     A     +C  
Sbjct  25   NRWSSQLFDCMNDSENAVITLLAPCVTFGQIAEIVDEGATPCATAGVLYGAIFFTGACFV  84

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+   R K+R K  +P     D+++HL+C  CAL QE+
Sbjct  85   YSHIFRAKIRNKYGLPDAPAPDWITHLVCMPCALCQEY  122



>ref|XP_006817787.1| PREDICTED: cell number regulator 11-like [Saccoglossus kowalevskii]
Length=124

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 6/96 (6%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  356
            +W + L GC  +  LCI T   PC T  R A       +  +   + L+    +L   C 
Sbjct  11   QWKNGLFGCFGDVGLCIFTFFLPCWTAGRNAEG-----VGKSCLIHSLLCLVPVLGWVCQ  65

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            +  +RR++R++ +I G   +D+L H+ C CCAL+QE
Sbjct  66   SG-VRREIREQRTIAGTCCNDYLVHIFCGCCALIQE  100



>ref|XP_008244010.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Prunus mume]
Length=415

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 47/99 (47%), Gaps = 7/99 (7%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  365
            W + L  C  +P   I TL  PC TF ++A    N   S A   N L+ Y LI  C    
Sbjct  276  WKTGLFQCLDDPPNAIMTLFCPCWTFGQVAEIVNNGQTSCA--VNSLI-YMLITVCIFVP  332

Query  364  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            C  +C  R+KLR K  +P     D + H +C  CAL QE
Sbjct  333  CLLSCTYRKKLRNKFDLPESPAPDCIIHFLCEWCALCQE  371



>ref|XP_002885257.1| hypothetical protein ARALYDRAFT_479347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61516.1| hypothetical protein ARALYDRAFT_479347 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 46/98 (47%), Gaps = 0/98 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
              W S+L  C ++    + TL+ PC TF +IA          A A     A     +C  
Sbjct  50   NRWSSELFDCMNDSENAVITLIAPCVTFGQIAEVVDEGATPCATAGLLYGAIFFSGACFV  109

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+   R K+R K  +P     D+++HL+C  CAL QE+
Sbjct  110  YSYMFRAKIRNKYGLPDAPAPDWITHLVCMQCALCQEY  147



>ref|XP_006826802.1| hypothetical protein AMTR_s00010p00032660 [Amborella trichopoda]
 gb|ERM94039.1| hypothetical protein AMTR_s00010p00032660 [Amborella trichopoda]
Length=258

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 7/101 (7%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC---  365
             W SD+  CC +P+  + T LFPC TF++IA        +   +    + Y+ I  C   
Sbjct  119  PWSSDIFSCCDDPMNALITALFPCLTFAQIAEIVDEGRTTCTTSG---IMYAGIACCIGL  175

Query  364  -CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             C  +C  R KLR K  +      D++SH +C  CAL QE+
Sbjct  176  PCLLSCTYRTKLRAKYELVEAPAPDWVSHFLCEWCALCQEY  216



>ref|XP_009339371.1| PREDICTED: proline-rich proteoglycan 2-like [Pyrus x bretschneideri]
Length=406

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  362
            E+W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  265  EQWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVIDNGTSSCATSG---LFYGLIASFIG  321

Query  361  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                 +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  322  IPFIMSCTYRTKLRSKYNLIESPAPDWVTHLFCEPCALCQEY  363



>emb|CDX92237.1| BnaA05g21700D [Brassica napus]
Length=173

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
              W+SDL  C ++    + T + PC TF +IA        + A       A  L L    
Sbjct  40   NRWNSDLFDCMNDSENAVITCIVPCVTFGQIAEIVDEGATTCAIGGVLYGAIFLTLFPSV  99

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+   R K+R K  +P     D+L+HL C  CAL QE+
Sbjct  100  YSSLFRAKIRNKYGLPDAPAPDWLTHLFCEPCALCQEY  137



>ref|XP_010527531.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 12 [Tarenaya hassleriana]
Length=162

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 48/95 (51%), Gaps = 0/95 (0%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYT  353
            W + L  C  +P +C +T + PC TF + +   +   I  + + +  M  SL+  CC Y 
Sbjct  30   WTTGLCDCHEDPQICFQTAVLPCITFGQNSEIVSRGTIPWSNSSSIHMVLSLVGCCCIYG  89

Query  352  CCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
               R +LR+ LS+P     D L H+ C  CAL QE
Sbjct  90   FPNRTRLREHLSLPEEPCRDCLLHIFCTHCALCQE  124



>ref|XP_009339439.1| PREDICTED: uncharacterized protein LOC103931645 [Pyrus x bretschneideri]
Length=952

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  362
            E+W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  214  EQWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVIDNGTSSCATSG---LFYGLIASFIG  270

Query  361  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                 +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  271  IPFIMSCTYRTKLRSKYNLIESPAPDWVTHLFCEPCALCQEY  312



>ref|XP_008244011.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Prunus mume]
Length=412

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 46/99 (46%), Gaps = 10/99 (10%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  365
            W + L  C  +P   I TL  PC TF ++A    N      +  N L+ Y LI  C    
Sbjct  276  WKTGLFQCLDDPPNAIMTLFCPCWTFGQVAEIVNN-----GQTFNSLI-YMLITVCIFVP  329

Query  364  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            C  +C  R+KLR K  +P     D + H +C  CAL QE
Sbjct  330  CLLSCTYRKKLRNKFDLPESPAPDCIIHFLCEWCALCQE  368



>ref|XP_008393299.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Malus domestica]
Length=402

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  362
            E+W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI +   
Sbjct  261  EQWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVVDNGRSSCATSG---LFYGLIAAFIG  317

Query  361  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                 +C  R KLR K ++      D++ HL+C  CAL QE+
Sbjct  318  IPFIMSCTYRTKLRSKYNLIESPAPDWVIHLLCEPCALCQEY  359



>ref|XP_007036480.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20981.1| PLAC8 family protein [Theobroma cacao]
Length=381

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 54/111 (49%), Gaps = 3/111 (3%)
 Frame = -2

Query  571  DLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACN  398
            D  SS      + W++ L  C  +P+  + T+ FPC TF R+A      H S  ++    
Sbjct  230  DAASSGFPLPVKVWNTGLFDCMDDPMNALITVCFPCLTFGRVAEIVDEGHTSCGTSGLLY  289

Query  397  ELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             L+A+  I   C  +C  R KLR KL +      D+++H  C  CAL QE+
Sbjct  290  GLIAF-FIGVPCILSCAYRTKLRNKLGLVESPAPDWVTHCFCDWCALCQEY  339



>ref|XP_010663577.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6 [Vitis vinifera]
 emb|CBI15431.3| unnamed protein product [Vitis vinifera]
Length=313

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACNELMAYSLILSC  365
            E W S L  C ++P   + T+ FPC TF ++A      H S  ++     L+A+ LI   
Sbjct  174  EYWTSGLFDCMNDPTNALVTVFFPCVTFGQVAEIVDRGHTSCGTSGLLYGLIAF-LIGLP  232

Query  364  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            C  +C  R K+R   ++      D++ H +C CCAL QE+
Sbjct  233  CIMSCTYRTKMRSMYNLSESPGPDWVVHCLCECCALCQEY  272



>gb|EJT99228.1| PLAC8-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
Length=206

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 53/109 (49%), Gaps = 15/109 (14%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEA--CNELMA-------Y  383
            EWH+ L GCC    +C   L+ PC  +SR    A  RH+S        E  A       Y
Sbjct  43   EWHTGLFGCCGAIDICCPALVCPCWVYSR--NRARLRHLSGTGQPLGRETSAWDGNCGLY  100

Query  382  SLILSCCCYTCC----IRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            +L+ +  C+       +RR +R++ +IPG    D L+ L+C  CAL QE
Sbjct  101  ALLTAVGCWGWVLEGNVRRGIRERYNIPGDSCTDTLTTLLCPPCALTQE  149



>ref|XP_002318695.2| hypothetical protein POPTR_0012s09370g [Populus trichocarpa]
 gb|EEE96915.2| hypothetical protein POPTR_0012s09370g [Populus trichocarpa]
Length=184

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA-YSLILS-C  365
             +W + L  CC +P  C+ T   PC TF +IA    NR  +   AC    A Y+L+L   
Sbjct  48   RKWSTGLCHCCDDPANCLITCFCPCITFGQIAEI-VNRGSTRIAACFISGAVYALLLGFA  106

Query  364  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            C Y+CC R KLR +  +      D L H  C  CAL QE+
Sbjct  107  CLYSCCYRSKLRGQYDLEEAPCVDCLVHFCCETCALSQEY  146



>ref|XP_009348105.1| PREDICTED: proline-rich protein HaeIII subfamily 1-like [Pyrus 
x bretschneideri]
Length=414

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (48%), Gaps = 9/103 (9%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEAC-NELMAYSLILSCC  362
            E W S+L  C  +P+  + T   PC TF +IA    N     A +C    + Y LI +  
Sbjct  273  EPWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVVDN----GASSCVTSGLFYGLIAAFV  328

Query  361  ----CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                  +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  329  GIPFIMSCTYRTKLRSKYNLIESPAPDWITHLFCEPCALCQEY  371



>ref|XP_006826804.1| hypothetical protein AMTR_s00010p00034340 [Amborella trichopoda]
 gb|ERM94041.1| hypothetical protein AMTR_s00010p00034340 [Amborella trichopoda]
Length=191

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSL-ILSC-CC  359
            W + L  CC +P  C  T   PC TF +IA  A +R I+S      L    L I+ C CC
Sbjct  57   WSTGLCDCCEDPANCCITCWCPCITFGQIAEIA-DRGITSCGVSGSLYGLMLLIVGCACC  115

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+C  R KLR + ++      D L H  C  CAL QE+
Sbjct  116  YSCFYRSKLRSQYNLSKSPCADCLVHFFCEGCALCQEY  153



>ref|XP_006393318.1| hypothetical protein EUTSA_v10011755mg [Eutrema salsugineum]
 gb|ESQ30604.1| hypothetical protein EUTSA_v10011755mg [Eutrema salsugineum]
Length=227

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 45/102 (44%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI----L  371
            + W S L  C ++    I T  FP  TF +IA        S   A    M Y LI     
Sbjct  89   QNWTSGLFDCMNDGENAIITCFFPFVTFGQIAEVTDEGATSCGTAG---MLYGLICCLFG  145

Query  370  SCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              C YTC  R KLR K  +P     D+++H  C  CAL QE+
Sbjct  146  IPCVYTCTYRAKLRNKFGLPDAPAPDWITHCFCEYCALCQEY  187



>gb|KJB37241.1| hypothetical protein B456_006G195300 [Gossypium raimondii]
Length=268

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 49/108 (45%), Gaps = 1/108 (1%)
 Frame = -2

Query  565  ISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA  386
            + S      E W + L  C  +P+  + T+ FPC TF ++A        S A +      
Sbjct  119  VHSTYQQHVEGWKTGLFDCMDDPINALITVCFPCVTFGQVAEIVDEGRTSCASSGLLYGV  178

Query  385  YSLILSC-CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             +L++   C  +C  R KLR K  +      D++ H  C CCAL QE+
Sbjct  179  IALLIGIPCILSCGYRTKLRSKFQLSESPAPDWVVHCFCDCCALCQEY  226



>ref|XP_006857399.1| hypothetical protein AMTR_s00067p00142050 [Amborella trichopoda]
 gb|ERN18866.1| hypothetical protein AMTR_s00067p00142050 [Amborella trichopoda]
Length=139

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 6/105 (6%)
 Frame = -2

Query  550  SHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI-  374
            S R  +W + L G C + +LC  T + PC TF +IA      H S          Y L+ 
Sbjct  5    SSRPPQWTTSLTGSCDDGVLCCITCVLPCITFGQIAEVLDEGHTSCLV---HGFIYGLLW  61

Query  373  -LSC-CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             + C C ++C  R +LR+K ++P    +DF  H  C  CAL QE+
Sbjct  62   TMGCHCLHSCTYRGRLREKYNLPEEPCNDFCVHWCCDACALCQEY  106



>ref|XP_006469221.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Citrus sinensis]
Length=176

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLVISLVTGCGCLY  99

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            + C R K+R++  + GG   D L+H  C  CAL QE+
Sbjct  100  SACYRSKMRQQYMLKGGPCGDCLAHFCCETCALSQEY  136



>gb|KJB12064.1| hypothetical protein B456_002G175600, partial [Gossypium raimondii]
Length=162

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W +    CCS+   C  +   PC TF +IA        S   +    +    I  C C Y
Sbjct  40   WSAGFCDCCSDLKTCCISYWCPCITFGQIAEIVDKGSTSCGASGALYILIMFITGCGCLY  99

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            +CC R KLRK+ ++ GG   D + H  C  CAL QE+
Sbjct  100  SCCYRSKLRKQYNLKGGDCGDCMRHFCCEPCALTQEY  136



>ref|XP_007160407.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
 gb|ESW32401.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
Length=164

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI---LSC  365
            EW + L  C S+   C  T L PC TF +IA    ++  +S  A   L  YSLI   L C
Sbjct  28   EWSTGLFDCFSDLKNCFITCLCPCITFGQIA-EVVDKGATSCGASGAL--YSLIYCLLGC  84

Query  364  -CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
             C Y+C  R K+R++  + G    DFL+H  C  CAL QE
Sbjct  85   GCIYSCVYRTKMRQQYKLKGTPFLDFLTHCCCETCALCQE  124



>ref|XP_007210160.1| hypothetical protein PRUPE_ppa021734mg [Prunus persica]
 gb|EMJ11359.1| hypothetical protein PRUPE_ppa021734mg [Prunus persica]
Length=429

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  362
            E W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  317  EGWSSELFDCMDDPMNALTTAFVPCLTFGQIAEIVDNGTTSCAISG---LFYGLIASFLG  373

Query  361  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                 +C  R KLR    +      D+++HL C  CAL QE+
Sbjct  374  VPFIMSCTYRTKLRSMFGLVEAPAPDWVTHLFCEPCALCQEY  415



>ref|XP_004297458.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=196

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
            E W S LL C S+P  C  T   PC TF +IA        S   +       + +  C C
Sbjct  56   EPWKSGLLDCFSDPKSCCLTFWCPCVTFGQIAEIVDKGSTSCGASGALYALIAFVTGCSC  115

Query  358  -YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             Y+C  R K+R++ S+      D L H  C  CAL QE+
Sbjct  116  IYSCFYRSKMRQQYSLEESPCGDCLVHCFCEACALCQEY  154



>gb|KDO38128.1| hypothetical protein CISIN_1g031916mg [Citrus sinensis]
Length=150

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALYLVISLVTGCGCLY  99

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            + C R K+R++  + GG   D L+H  C  CAL QE+
Sbjct  100  SSCYRSKMRQQYMLKGGPCGDCLAHFCCDTCALSQEY  136



>ref|XP_009346952.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Pyrus x bretschneideri]
Length=132

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 58/130 (45%), Gaps = 23/130 (18%)
 Frame = -2

Query  502  EPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----CCYTCCIRRK  335
            +P   I TLL PC TF +IA    N    S+ A N L+ Y LI+ C    C  +C  R+K
Sbjct  3    DPPNAIMTLLCPCWTFGQIAEIVNNGR--SSCAANALI-YMLIMLCIFVPCLLSCTYRKK  59

Query  334  LRKKLSIPGGFIDDFLSHLMCCCCALVQE--------------WreieirgieGTHKTKT  197
            LR K  +P     D ++H +C  CAL QE              W     +      K + 
Sbjct  60   LRNKFDLPESPAPDCITHFLCEWCALCQEHRELQLRGLDPTLGWVGNLEQIQRMQQKRQA  119

Query  196  --SPPSTQFM  173
              SPP+TQ M
Sbjct  120  AMSPPTTQRM  129



>emb|CDP00820.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC-Y  356
            W + L  C S+   C  TL  PC T  RIA    ++  +S EAC  L A   IL C C +
Sbjct  36   WSTGLYDCFSDVPNCCLTLWCPCVTLGRIAEI-VDKGSTSREACGALYAVLNILGCACLH  94

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            +   R +LRK+ ++P     D L H  C  CAL QE
Sbjct  95   SRLYRSRLRKQYNLPATPCGDCLVHFFCEPCALCQE  130



>ref|XP_008346788.1| PREDICTED: proline-rich protein HaeIII subfamily 1-like [Malus 
domestica]
Length=414

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  362
            E W S L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI +   
Sbjct  273  EPWSSKLFDCMDDPMNALTTAFVPCLTFGQIAEVVDNGTSSCATSG---LFYGLIAAFIG  329

Query  361  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                 +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  330  VPFIMSCTYRTKLRSKYNLIESPAPDWVTHLFCEPCALCQEY  371



>ref|XP_008244012.1| PREDICTED: proline-rich protein 2-like [Prunus mume]
Length=461

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 7/102 (7%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  362
            E W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  317  EGWSSELFDCMDDPMNALTTAFVPCLTFGQIAEIVDNGTTSCAISG---LFYGLIASFLG  373

Query  361  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                 +C  R KLR    +      D+++HL C  CAL QE+
Sbjct  374  VPFIMSCTYRTKLRSMFGLVEAPAPDWVTHLFCEPCALCQEY  415



>ref|XP_010066569.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Eucalyptus grandis]
Length=187

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L  C  +  +C  +   PC TF RIA    +  +S         A +L+  C CC+
Sbjct  54   WSSGLFSCFGDIPICCLSFWCPCITFGRIAEITDHGSVSCPVHGAIYTAIALLTGCACCF  113

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            +CC R K+R++  +      D L H  C  CAL QE+
Sbjct  114  SCCYRTKMRQQYQLKEDPCADCLVHFCCETCALTQEY  150



>ref|XP_007036476.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20977.1| PLAC8 family protein [Theobroma cacao]
Length=391

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACNELMAYSLILSCCC  359
            W + L  C  +P+  + T+ FPC TF ++A      H S  ++     L+A+  I   C 
Sbjct  132  WKTGLFDCMDDPMNALITVCFPCVTFGQVAEIVDEGHTSCGTSGLLYGLIAF-FIGVPCI  190

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             +C  R KLR KL +      D+++H  C  CAL QE+
Sbjct  191  LSCAYRTKLRNKLGLVESPAPDWVTHCFCDWCALCQEY  228



>ref|XP_011016153.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Populus euphratica]
Length=181

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 50/99 (51%), Gaps = 4/99 (4%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS-CC  362
             +W + L  CC +P  C  T L PC TF +IA    NR  ++      +  Y+L+L   C
Sbjct  48   RKWSTGLCHCCDDPANCFITCLCPCITFGQIAEI-VNRGSTTCFMSGSV--YALLLGFAC  104

Query  361  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             Y+CC R KLR +  +      D L+H  C  CAL QE+
Sbjct  105  LYSCCYRSKLRGQYDLEEAPCMDCLAHFCCETCALSQEY  143



>gb|AFM43805.1| fruit weight 2.2-2 protein [Dimocarpus longan]
Length=175

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 2/135 (1%)
 Frame = -2

Query  643  DQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLCIKTLLF  470
             Q + K  ++++ + N       H   +  G+H     +W + L  CC +P  C+ T  +
Sbjct  5    SQDHHKYAQRYAGAMNIQPTQPYHSSYTPPGAHGTATTQWSTGLCHCCDDPANCLITCFW  64

Query  469  PCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDF  290
            PC TF +IA       IS   +        L    C Y+C  R +LR +  +      D 
Sbjct  65   PCITFGQIAEIVNQGSISCVASGMVYGLLGLTGLSCLYSCLYRSRLRGQYDLEEAPCADC  124

Query  289  LSHLMCCCCALVQEW  245
            L H  C  CAL QE+
Sbjct  125  LVHFCCETCALCQEY  139



>ref|XP_006448197.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
 gb|ESR61437.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
Length=150

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLVISLVTGCGCLY  99

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            + C R K+R++  + GG   D L H  C  CAL QE+
Sbjct  100  SACYRSKMRQQYMLKGGPCGDCLVHFCCETCALSQEY  136



>ref|XP_009009567.1| hypothetical protein HELRODRAFT_184849 [Helobdella robusta]
 gb|ESO12847.1| hypothetical protein HELRODRAFT_184849 [Helobdella robusta]
Length=105

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 8/97 (8%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNR-HISSAEACNELMAYSLILSCCC  359
            EW + + GC ++  +CI T   PC T  + A A      +     C E +   L  +   
Sbjct  3    EWKNGIFGCFNDCTVCIITYFLPCYTAGKNAEAVGKSCFLYGCLTCIEPIGCILRST---  59

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
                IR+++R++ SI G F  D L H+ C CCALVQE
Sbjct  60   ----IRQQIREQYSIDGSFGGDLLCHMCCPCCALVQE  92



>ref|XP_001756741.1| predicted protein [Physcomitrella patens]
 gb|EDQ78338.1| predicted protein, partial [Physcomitrella patens]
Length=107

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACNELMAYSLILSCCC  359
            W + L  CC++  +C  T+ FPC  F   A A      S  +A     ++ +++ L C  
Sbjct  1    WSTGLFDCCADMPMCCFTMFFPCLAFGWNAQALDESKNSCWTAATAWWVLQHTIALGCL-  59

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            Y+   R KLR K +IP G   D L H +C  CA  QE
Sbjct  60   YSASYRGKLRSKYNIPEGPFSDSLIHCLCWPCAFCQE  96



>ref|XP_006448196.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
 gb|ESR61436.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
Length=176

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLVISLVTGCGCLY  99

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            + C R K+R++  + GG   D L H  C  CAL QE+
Sbjct  100  SACYRSKMRQQYMLKGGPCGDCLVHFCCETCALSQEY  136



>ref|XP_007046277.1| PLAC8 family protein, putative [Theobroma cacao]
 gb|EOY02109.1| PLAC8 family protein, putative [Theobroma cacao]
Length=157

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 43/97 (44%), Gaps = 0/97 (0%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  356
            +W + L  CC +P  C+ T   PC TF RIA        S   +C    A   I     Y
Sbjct  24   QWTTGLYDCCDDPSNCLTTCFCPCITFGRIAEIIDRGDRSCGLSCLVYFAMHSIHCAWLY  83

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                R +LR+  S+P     D L H  CC C+L QE+
Sbjct  84   GGIYRTQLRQLFSLPETPRGDKLVHRCCCLCSLSQEY  120



>ref|XP_004297457.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 3-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-C  362
            E W+S LL C S+P  C  T L PC TF RI   A     S        +  +L+  C C
Sbjct  3    EPWNSGLLDCFSDPKSCCLTYLCPCVTFGRIVEIADKGSTSCCLGGAAYVLVALMFGCPC  62

Query  361  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              +   R +LR++ S+ G    D L H  C  CAL QE+
Sbjct  63   LLSFRYRSRLRQQYSLEGNSCGDCLVHCFCETCALCQEY  101



>ref|XP_006362555.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 9-like [Solanum tuberosum]
Length=144

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 45/99 (45%), Gaps = 4/99 (4%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC--  362
            +W +DL  C  +P LC+KT   PC T   +         S   AC  L+AY++    C  
Sbjct  10   QWTTDLFDCWDDPSLCVKTCFCPCVTIGEVVEMLDQGTTSKGHAC--LLAYAMGSIHCGW  67

Query  361  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
             Y    RRKLR+   +P     D L    CC C + QE+
Sbjct  68   IYGRRYRRKLREMFKLPESPYSDTLISCCCCVCGISQEY  106



>ref|NP_188474.1| PLAC8 family protein [Arabidopsis thaliana]
 sp|Q9LS45.1|PCR5_ARATH RecName: Full=Protein PLANT CADMIUM RESISTANCE 5; Short=AtPCR5 
[Arabidopsis thaliana]
 dbj|BAB01111.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAR24222.1| At3g18450 [Arabidopsis thaliana]
 gb|AAR92357.1| At3g18450 [Arabidopsis thaliana]
 gb|AEE76099.1| PLAC8 family protein [Arabidopsis thaliana]
Length=184

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
             +W S L  C ++    + TL+ PC TF +IA          A A     A     +   
Sbjct  50   NQWSSQLFDCMNDSENAVITLIAPCVTFGQIAEIVDEGATPCATAGLLYGALFFTGASFV  109

Query  358  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            Y+   R ++RKK  +P     D+++HL+C   AL QE+
Sbjct  110  YSYMFRARIRKKFGLPDAPAPDWITHLVCMPFALCQEY  147



>gb|KCW64493.1| hypothetical protein EUGRSUZ_G02100 [Eucalyptus grandis]
Length=237

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L  C  +  +C  +   PC TF RIA    +  +S         A +L+  C CC+
Sbjct  104  WSSGLFSCFGDIPICCLSFWCPCITFGRIAEITDHGSVSCPVHGAIYTAIALLTGCACCF  163

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            +CC R K+R++  +      D L H  C  CAL QE+
Sbjct  164  SCCYRTKMRQQYQLKEDPCADCLVHFCCETCALTQEY  200



>ref|XP_002527777.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34587.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  356
            W S L GCCS+   C  T   PC TF +IA  A     S A +       +    C C Y
Sbjct  54   WSSGLCGCCSDVKNCCITCWCPCITFGQIAEIADKGTTSCATSGAIYGILAWFTGCGCIY  113

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            +C  R KLR++  +P    +D L H  C  CAL QE+
Sbjct  114  SCLYRSKLRQQYMLPESPCNDCLVHCCCEACALCQEY  150



>ref|XP_010068707.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
Length=146

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 1/108 (1%)
 Frame = -2

Query  565  ISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA  386
            +++ G+     W + L  CC +   C  T   PC TF +I+        S    C     
Sbjct  3    LTNPGNVEEHPWSTGLCDCCGDIKSCCITFWCPCITFGQISEILDKGATSCVMNCAIYTL  62

Query  385  YSLILSCCC-YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              L+ SC C Y+CC R KLR++  +     +D L H  C  CAL QE+
Sbjct  63   IYLLTSCACLYSCCYRTKLRREFGLKEDPCNDCLVHCCCMYCALCQEY  110



>ref|XP_010265361.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nelumbo nucifera]
Length=214

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 7/100 (7%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  365
            W + L  C  +P   I+T  FPC TF  +A    +   S    C   + Y +I++C    
Sbjct  70   WTTGLFDCMEDPENAIETFFFPCCTFGEVAEIVDDGETS---CCLAALLYLIIMNCSLPP  126

Query  364  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            C  +C  R  LRKK  +    + D+  HL    CAL QE+
Sbjct  127  CILSCGFRSMLRKKFGLVESPLPDWAVHLFFEPCALCQEY  166



>gb|KCW64542.1| hypothetical protein EUGRSUZ_G02148, partial [Eucalyptus grandis]
Length=149

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 1/108 (1%)
 Frame = -2

Query  565  ISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA  386
            +++ G+     W + L  CC +   C  T   PC TF +I+        S    C     
Sbjct  6    LTNPGNVEEHPWSTGLCDCCGDIKSCCITFWCPCITFGQISEILDKGETSCVMNCAIYKL  65

Query  385  YSLILSCCC-YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              L+ SC C Y+CC R KLR++  +     +D L H  C  CAL QE+
Sbjct  66   IYLLTSCACLYSCCYRTKLRREFGLKEDPCNDCLVHCCCMHCALCQEY  113



>ref|XP_004294816.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=188

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 48/105 (46%), Gaps = 7/105 (7%)
 Frame = -2

Query  547  HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS  368
            H   EW + L  CC +P  C+ T   PC TF +IA        S A+   +   Y ++L+
Sbjct  51   HVGGEWSTGLCHCCDDPANCLITFFCPCITFGQIAEIVEQGSSSCAQ---QGTCYGILLA  107

Query  367  ----CCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
                 C Y+C  R +LR +  +      D L H  C  CAL QE+
Sbjct  108  TTGLACLYSCFFRSRLRGQYDLEESPCVDCLVHFCCATCALCQEY  152



>ref|XP_003382500.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 3-like [Amphimedon 
queenslandica]
Length=107

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 47/98 (48%), Gaps = 8/98 (8%)
 Frame = -2

Query  538  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  359
            + W   L GC S+  LC+ T L PC T  R A A       + E+C     Y LI     
Sbjct  3    QTWSHGLFGCFSDIGLCLVTFLVPCYTNGRNAEA-------TGESCIMHAIYFLIPLVGF  55

Query  358  YT-CCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  248
            Y     R K+R+K +I G F +D L  + C  CAL+QE
Sbjct  56   YCHATTRGKIREKKNIDGTFFNDLLCSICCAYCALIQE  93



>ref|XP_004294815.1| PREDICTED: cell number regulator 2-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 5/112 (4%)
 Frame = -2

Query  568  LISSKGSHRY--EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAE--AC  401
            ++S+  S R+   EW + L  CC +P  C+ T   PC TF +IA        S A+   C
Sbjct  42   VVSTGHSARHVGGEWSTGLCHCCDDPPNCMITCFCPCITFGQIAEIVDQGSSSCAQQGTC  101

Query  400  NELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
              ++  + +L+ C Y+C  R KLR +  +      D L H  C  CAL QE+
Sbjct  102  YGILLATTVLA-CLYSCFYRSKLRGQYDLEESPCVDCLVHFCCPGCALCQEY  152



>ref|XP_006644037.1| PREDICTED: cell number regulator 5-like [Oryza brachyantha]
Length=182

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 64/153 (42%), Gaps = 18/153 (12%)
 Frame = -2

Query  577  KHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACN  398
            ++D    K S    +W S +  C  +P  C    + PC  F R A    +  ++ +    
Sbjct  29   ENDATRHKLSRDPTQWSSGICACFDDPQSCCIGAICPCFLFGRNAQFLGSGTLAGS-CTT  87

Query  397  ELMAYSLILSCCC-----------------YTCCIRRKLRKKLSIPGGFIDDFLSHLMCC  269
              M + L+ S CC                 Y C  R+ LR K ++P     D  +HL C 
Sbjct  88   HCMLWGLLTSLCCVFTGGLVLAVPGSAVACYACGYRQALRTKYNLPEAPCGDLTTHLFCH  147

Query  268  CCALVQEWreieirgieGTHKTKTSPPSTQFME  170
             CA+ QE+REI  R   G+    T PP TQ M+
Sbjct  148  LCAICQEYREIRERTDSGSSLAPTVPPPTQTMD  180



>ref|XP_006352289.1| PREDICTED: cell number regulator 1-like [Solanum tuberosum]
Length=219

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 49/101 (49%), Gaps = 9/101 (9%)
 Frame = -2

Query  532  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC--  359
            W +++  C  +P  C  T + PC T  +IA   +    S    C E +  +++L C C  
Sbjct  82   WSTNIFACGRDPKNCFTTCVCPCITSGQIAEIVSEGRTS----CMEGVIINMLLCCLCCT  137

Query  358  ---YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
               YT   R KLR+K  + G    D L H +CC CAL QE+
Sbjct  138  TPLYTFYYRVKLRRKFKLEGNECLDCLIHTLCCYCALCQEY  178



>ref|XP_010070341.1| PREDICTED: cell number regulator 2-like [Eucalyptus grandis]
 ref|XP_010026422.1| PREDICTED: cell number regulator 2-like [Eucalyptus grandis]
 gb|KCW59028.1| hypothetical protein EUGRSUZ_H01656 [Eucalyptus grandis]
 gb|KCW59325.1| hypothetical protein EUGRSUZ_H02012 [Eucalyptus grandis]
Length=174

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 46/97 (47%), Gaps = 0/97 (0%)
 Frame = -2

Query  535  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  356
            +W + L  CC +P  C+ T   PC TF +IA   +   +S A +       +L    C Y
Sbjct  41   QWSTGLCHCCDDPANCLITAFCPCVTFGQIAEIVSRGSVSCAASGFAYAVLALTGLPCLY  100

Query  355  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  245
            +C  R ++R +  +    + D L H  C  C+L QE+
Sbjct  101  SCFYRSRMRGQYVLEEAPVADCLVHFCCEPCSLCQEY  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570