BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006H20

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR83865.1|  elongation factor 1-alpha                               290   1e-95   Capsicum annuum
dbj|BAH20400.1|  AT1G07940                                              286   4e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            286   7e-94   
gb|ACF81592.1|  unknown                                                 286   9e-94   Zea mays [maize]
dbj|BAO57272.1|  elongation factor 1-alpha                              294   1e-93   Ipomoea nil [qian niu]
gb|ABW74483.1|  elongation factor                                       285   2e-93   Paeonia suffruticosa [moutan peony]
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     283   1e-92   Glycine max [soybeans]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          292   1e-92   Nicotiana tomentosiformis
gb|AAQ90154.1|  putative translation elongation factor protein          286   1e-92   Solanum tuberosum [potatoes]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               291   3e-92   Nicotiana tomentosiformis
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   281   6e-92   Gossypium raimondii
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    290   1e-91   Nicotiana tabacum [American tobacco]
ref|NP_001234035.1|  elongation factor 1-alpha                          290   1e-91   Solanum lycopersicum
ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               279   1e-91   Nicotiana sylvestris
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               289   1e-91   Nicotiana sylvestris
gb|AFW76429.1|  putative translation elongation factor Tu family ...    284   1e-91   
gb|AAN77897.1|  elongation factor 1 alpha                               289   1e-91   Stevia rebaudiana
dbj|BAA34348.1|  elongation factor-1 alpha                              289   1e-91   Nicotiana paniculata
gb|AHE76183.1|  elongation factor 1-alpha                               289   2e-91   Chrysanthemum indicum
dbj|BAF75826.1|  hypothetical protein                                   280   2e-91   Malus domestica [apple tree]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            285   2e-91   
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  287   3e-91   Solanum tuberosum [potatoes]
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             287   3e-91   Solanum tuberosum [potatoes]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               288   4e-91   Nicotiana tomentosiformis
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          288   4e-91   Solanum lycopersicum
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    285   4e-91   
gb|AGH55661.1|  elongation factor 1-alpha                               284   4e-91   Atropa belladonna [deadly nightshade]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          288   4e-91   Nicotiana sylvestris
gb|AIX10769.1|  elongation factor 1 alpha                               288   4e-91   Panax notoginseng [san-qi]
dbj|BAF75825.1|  hypothetical protein                                   279   5e-91   Malus domestica [apple tree]
emb|CDX70032.1|  BnaA10g23810D                                          284   5e-91   
gb|ABV26710.1|  elongation factor 1 alpha                               288   5e-91   Gerbera hybrid cultivar
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          288   5e-91   Nicotiana sylvestris
dbj|BAL14665.1|  elongation factor 1-alpha                              288   5e-91   Chrysanthemum seticuspe f. boreale
dbj|BAN42602.1|  putative elongation factor 1-alpha                     279   5e-91   Pyrus pyrifolia var. culta [Asian pear]
ref|NP_001275481.1|  elongation factor 1-alpha-like                     288   5e-91   Solanum tuberosum [potatoes]
gb|ABB86283.1|  elongation factor-1 alpha-like                          288   6e-91   Solanum tuberosum [potatoes]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             288   6e-91   Solanum tuberosum [potatoes]
gb|AGZ15393.1|  elongation factor 1-alpha                               283   6e-91   Phaseolus vulgaris [French bean]
dbj|BAC23049.1|  Elongation factor 1-alpha                              287   6e-91   Solanum tuberosum [potatoes]
gb|EEE58429.1|  hypothetical protein OsJ_09630                          287   7e-91   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          287   7e-91   Solanum tuberosum [potatoes]
gb|AAC15413.1|  translation elongation factor-1 alpha                   287   7e-91   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          287   8e-91   Tarenaya hassleriana [spider flower]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          287   8e-91   Oryza brachyantha
ref|NP_001049145.1|  Os03g0177400                                       287   8e-91   
dbj|BAA23658.1|  EF-1 alpha                                             287   8e-91   Oryza sativa [red rice]
dbj|BAN42601.1|  putative elongation factor 1-alpha                     278   9e-91   Pyrus pyrifolia var. culta [Asian pear]
gb|KHG20498.1|  Elongation factor 1-alpha                               287   9e-91   Gossypium arboreum [tree cotton]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          287   1e-90   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    286   1e-90   
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   281   1e-90   Gossypium raimondii
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               286   2e-90   Tarenaya hassleriana [spider flower]
emb|CAA65453.1|  elongation factor                                      280   2e-90   Narcissus pseudonarcissus
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   282   2e-90   Gossypium raimondii
gb|AID52924.1|  elongation factor 1-alpha                               286   2e-90   Carthamus tinctorius
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               286   2e-90   Tarenaya hassleriana [spider flower]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             286   2e-90   Eutrema salsugineum [saltwater cress]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          286   2e-90   Solanum tuberosum [potatoes]
emb|CAL25349.1|  elongation factor 1 alpha                              277   3e-90   Platanus x hispanica [London plane tree]
emb|CDY22710.1|  BnaC08g43440D                                          285   3e-90   Brassica napus [oilseed rape]
gb|AGT16893.1|  elongation factor 1-alpha                               286   3e-90   Saccharum hybrid cultivar R570
gb|KJB09231.1|  hypothetical protein B456_001G130700                    286   3e-90   Gossypium raimondii
gb|AGT16628.1|  elongation factor 1 alpha                               284   3e-90   Saccharum hybrid cultivar R570
emb|CDY61938.1|  BnaCnng38780D                                          285   4e-90   Brassica napus [oilseed rape]
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         279   4e-90   Jatropha curcas
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          285   4e-90   Tarenaya hassleriana [spider flower]
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          285   4e-90   Sesamum indicum [beniseed]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        285   4e-90   Brassica rapa
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    285   4e-90   Theobroma cacao [chocolate]
gb|AAK82537.1|  At1g07930/T6D22_3                                       285   4e-90   Arabidopsis thaliana [mouse-ear cress]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             285   5e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          285   5e-90   Tarenaya hassleriana [spider flower]
dbj|BAH56641.1|  elongation factor 1a                                   282   5e-90   Nelumbo nucifera [Indian lotus]
ref|NP_200847.1|  elongation factor 1-alpha 4                           285   5e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             285   5e-90   Brassica rapa
ref|NP_001152668.1|  LOC100286309                                       285   5e-90   Zea mays [maize]
dbj|BAF02151.1|  elongation factor 1-alpha                              285   5e-90   Arabidopsis thaliana [mouse-ear cress]
emb|CAA34456.1|  elongation factor 1-alpha                              285   5e-90   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57653.1|  At1g07930/T6D22_3                                       285   5e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          279   5e-90   Cucumis melo [Oriental melon]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             285   5e-90   Capsella rubella
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    285   5e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                280   5e-90   Ricinus communis
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        285   5e-90   Brassica rapa
emb|CAD60652.1|  elongation factor                                      285   5e-90   Solanum tuberosum [potatoes]
gb|ACR38047.1|  unknown                                                 285   6e-90   Zea mays [maize]
ref|XP_002539209.1|  elongation factor 1-alpha, putative                280   6e-90   Ricinus communis
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      281   6e-90   Cicer arietinum [garbanzo]
gb|ABU63160.1|  elongation factor                                       285   7e-90   Saccharum officinarum [noble cane]
gb|AGH32502.1|  translation elongation factor-1 alpha                   285   8e-90   Stylosanthes guianensis [stylo]
gb|AAL79775.1|  elongation factor 1 alpha                               285   8e-90   Saccharum hybrid cultivar CP72-2086
gb|KHG26926.1|  Elongation factor 1-alpha                               285   8e-90   Gossypium arboreum [tree cotton]
emb|CDX93604.1|  BnaA06g04440D                                          285   8e-90   
gb|AFC88830.1|  putative elongation factor 1-alpha                      285   8e-90   Miscanthus sinensis
gb|AGJ50595.1|  EF1alpha                                                285   9e-90   Pericallis cruenta
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               284   1e-89   Fragaria vesca subsp. vesca
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     284   1e-89   Saccharum hybrid cultivar CP65-357
gb|AGZ90153.1|  elongation factor 1-alpha                               277   1e-89   Litsea cubeba [may chang]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          284   1e-89   Nelumbo nucifera [Indian lotus]
emb|CDX95108.1|  BnaC05g05630D                                          285   1e-89   
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    284   2e-89   Theobroma cacao [chocolate]
gb|AAX54511.1|  elongation factor 1 alpha                               284   2e-89   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    284   2e-89   Setaria italica
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          284   2e-89   Tarenaya hassleriana [spider flower]
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          284   2e-89   
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               283   2e-89   Elaeis guineensis
ref|WP_033581549.1|  elongation factor 1-alpha                          273   2e-89   
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    283   2e-89   
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    283   2e-89   Eucalyptus grandis [rose gum]
gb|ABA12225.1|  translation elongation factor 1A-9                      283   2e-89   Gossypium hirsutum [American cotton]
emb|CAL07988.1|  translation elongation factor 1 alpha                  276   2e-89   Platanus x hispanica [London plane tree]
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    278   2e-89   
ref|NP_001105587.1|  elongation factor 1-alpha                          283   2e-89   Zea mays [maize]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          283   2e-89   Zea mays [maize]
gb|KHG23927.1|  Elongation factor 1-alpha                               283   2e-89   Gossypium arboreum [tree cotton]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          283   2e-89   Setaria italica
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   283   3e-89   Lilium longiflorum [Easter lily]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               283   3e-89   Elaeis guineensis
gb|ABA12218.1|  translation elongation factor 1A-2                      283   3e-89   Gossypium hirsutum [American cotton]
gb|AEN79476.1|  elongation factor 1-alpha                               283   3e-89   Ziziphus jujuba [Chinese jujube]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    283   3e-89   Daucus carota [carrots]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    283   3e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    283   3e-89   Eucalyptus grandis [rose gum]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         283   3e-89   
dbj|BAH19898.1|  AT1G07930                                              283   3e-89   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237425.1|  elongation factor-1A                               283   3e-89   
gb|ABA12217.1|  translation elongation factor 1A-1                      283   3e-89   Gossypium hirsutum [American cotton]
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       278   3e-89   Cucumis sativus [cucumbers]
gb|KHN18669.1|  Elongation factor 1-alpha                               283   3e-89   Glycine soja [wild soybean]
gb|ABA12221.1|  translation elongation factor 1A-5                      283   4e-89   Gossypium hirsutum [American cotton]
gb|ABA12220.1|  translation elongation factor 1A-4                      283   4e-89   Gossypium hirsutum [American cotton]
gb|ACS68200.1|  elongation factor 1 alpha                               283   4e-89   Brassica napus [oilseed rape]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    283   4e-89   Zea mays [maize]
emb|CDY58828.1|  BnaAnng15460D                                          286   5e-89   Brassica napus [oilseed rape]
gb|ACG34498.1|  elongation factor 1-alpha                               283   5e-89   Zea mays [maize]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             283   5e-89   Citrus clementina [clementine]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     283   5e-89   Zea mays [maize]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               283   5e-89   Sesamum indicum [beniseed]
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        283   5e-89   Brassica rapa
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          283   5e-89   Elaeis guineensis
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  283   5e-89   Citrus sinensis [apfelsine]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    283   5e-89   Sesamum indicum [beniseed]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    282   5e-89   Glycine max [soybeans]
gb|AGY80449.1|  elongation factor 1-alpha                               282   5e-89   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             282   6e-89   Phaseolus vulgaris [French bean]
gb|ADC68236.1|  elongation factor 1-alpha                               275   6e-89   Dendrobium nobile
gb|ABS10822.1|  elongation factor 1-alpha                               274   6e-89   Phaseolus vulgaris [French bean]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               282   6e-89   Pyrus x bretschneideri [bai li]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     275   6e-89   Vitis vinifera
gb|AFY06644.1|  elongation factor 1-alpha                               278   7e-89   Carica papaya [mamon]
gb|ABA12222.1|  translation elongation factor 1A-6                      282   7e-89   Gossypium hirsutum [American cotton]
dbj|BAC66180.1|  elongation factor 1A                                   282   8e-89   Avicennia marina
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          282   8e-89   Cicer arietinum [garbanzo]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  275   9e-89   Plantago major [cart-track plant]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               282   1e-88   Phoenix dactylifera
ref|NP_001105617.1|  elongation factor alpha3                           281   1e-88   Zea mays [maize]
ref|NP_001105933.1|  elongation factor alpha2                           281   1e-88   
gb|ADI24333.1|  elongation factor 1-alpha                               281   1e-88   Miscanthus sinensis
ref|NP_001288465.1|  elongation factor 1-alpha-like                     281   1e-88   Zea mays [maize]
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       278   1e-88   Cucumis sativus [cucumbers]
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              281   1e-88   Capsicum annuum
gb|AFW77593.1|  putative translation elongation factor Tu family ...    281   1e-88   
gb|KHG01531.1|  Elongation factor 1-alpha                               281   1e-88   Gossypium arboreum [tree cotton]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    281   1e-88   Glycine max [soybeans]
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         280   1e-88   Jatropha curcas
gb|AAL32631.1|  putative elongation factor 1-a                          281   2e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528020.1|  elongation factor 1-alpha, putative                278   2e-88   
gb|ACG31866.1|  elongation factor 1-alpha                               281   2e-88   Zea mays [maize]
gb|KHG24249.1|  Elongation factor 1-alpha                               280   2e-88   Gossypium arboreum [tree cotton]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     281   2e-88   Glycine max [soybeans]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          281   2e-88   Eucalyptus grandis [rose gum]
gb|KHG27341.1|  Elongation factor 1-alpha                               281   2e-88   Gossypium arboreum [tree cotton]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    281   2e-88   Zea mays [maize]
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         278   2e-88   Medicago truncatula
gb|KHN42761.1|  Elongation factor 1-alpha                               281   2e-88   Glycine soja [wild soybean]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          281   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          281   3e-88   Eucalyptus grandis [rose gum]
gb|KHN14872.1|  Elongation factor 1-alpha                               281   3e-88   Glycine soja [wild soybean]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               280   3e-88   Malus domestica [apple tree]
gb|KHG28979.1|  Elongation factor 1-alpha                               280   3e-88   Gossypium arboreum [tree cotton]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             280   3e-88   Citrus clementina [clementine]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          280   3e-88   Fragaria vesca subsp. vesca
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          280   4e-88   Phoenix dactylifera
gb|ABA12219.1|  translation elongation factor 1A-3                      280   4e-88   Gossypium hirsutum [American cotton]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          280   4e-88   
ref|XP_002518073.1|  elongation factor 1-alpha, putative                280   4e-88   Ricinus communis
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          280   4e-88   Eucalyptus grandis [rose gum]
gb|KJB48746.1|  hypothetical protein B456_008G084000                    279   4e-88   Gossypium raimondii
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          280   4e-88   Phoenix dactylifera
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   280   4e-88   Lilium longiflorum [Easter lily]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   280   5e-88   Ornithogalum longebracteatum [sea-onion]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             280   5e-88   Prunus persica
gb|AAL69396.1|  elongation factor 1-alpha                               280   5e-88   Elaeis oleifera
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          280   5e-88   Malus domestica [apple tree]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               280   5e-88   Prunus mume [ume]
gb|ABA12223.1|  translation elongation factor 1A-7                      280   5e-88   Gossypium hirsutum [American cotton]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               280   6e-88   Cucumis melo [Oriental melon]
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         278   6e-88   Jatropha curcas
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    280   6e-88   Vicia faba [broad bean]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    280   6e-88   Gossypium raimondii
gb|AEQ75495.1|  elongation factor 1-alpha                               280   6e-88   Rosa multiflora [Japanese rose]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          280   6e-88   Populus euphratica
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    280   7e-88   Populus euphratica
gb|KJB48747.1|  hypothetical protein B456_008G084000                    279   7e-88   Gossypium raimondii
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    280   7e-88   Populus euphratica
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          280   8e-88   Phoenix dactylifera
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          276   8e-88   Populus euphratica
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               280   8e-88   Cucumis melo [Oriental melon]
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    280   8e-88   
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    279   9e-88   Theobroma cacao [chocolate]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          279   9e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               279   9e-88   Eucalyptus grandis [rose gum]
ref|NP_001290506.1|  elongation factor 1-alpha                          279   9e-88   Elaeis guineensis
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          279   1e-87   Elaeis guineensis
gb|AHB86963.1|  elongation factor 1-alpha                               279   1e-87   Sedum alfredii
dbj|BAM13874.1|  elongation factor 1 alpha                              279   1e-87   Symplocarpus renifolius
ref|XP_003604823.1|  Elongation factor 1-alpha                          279   1e-87   
gb|AEI29162.1|  EF1a-like protein                                       277   1e-87   Phalaenopsis hybrid cultivar
gb|ABD66072.1|  elongation factor 1-alpha                               272   1e-87   Phoenix dactylifera
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         279   1e-87   Jatropha curcas
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             279   1e-87   Prunus persica
gb|ABA12224.1|  translation elongation factor 1A-8                      279   1e-87   Gossypium hirsutum [American cotton]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               279   2e-87   Vitis vinifera
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          279   2e-87   
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          279   2e-87   Elaeis guineensis
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         279   2e-87   Jatropha curcas
ref|NP_001105565.1|  elongation factor alpha5                           279   2e-87   
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          279   2e-87   Amborella trichopoda
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         279   2e-87   Medicago truncatula
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             278   2e-87   Prunus persica
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     278   2e-87   Glycine max [soybeans]
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         279   2e-87   Medicago truncatula
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             278   2e-87   Phaseolus vulgaris [French bean]
ref|XP_003588821.1|  Elongation factor 1-alpha                          279   2e-87   
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          278   2e-87   Elaeis guineensis
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    278   2e-87   
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   278   2e-87   Lilium longiflorum [Easter lily]
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               278   2e-87   Vitis vinifera
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         278   2e-87   Medicago truncatula
ref|XP_002528028.1|  elongation factor 1-alpha, putative                278   2e-87   
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          278   2e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACI96243.1|  elongation factor 1-alpha                               278   2e-87   Prunus persica
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             278   2e-87   Citrus clementina [clementine]
gb|KGN51228.1|  Elongation factor 1-alpha                               277   2e-87   Cucumis sativus [cucumbers]
gb|AGC94754.1|  elongation factor 1 alpha                               278   2e-87   Euphorbia lathyris
ref|NP_001183947.1|  uncharacterized protein LOC100502553               277   2e-87   
gb|ABR16818.1|  unknown                                                 269   2e-87   Picea sitchensis
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               278   2e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|AAY56337.1|  elongation factor-1 alpha                               278   2e-87   Musa acuminata [banana]
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  278   2e-87   Solanum tuberosum [potatoes]
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    278   2e-87   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          278   2e-87   Cucumis sativus [cucumbers]
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       275   2e-87   Cucumis sativus [cucumbers]
ref|NP_001105935.1|  elongation factor alpha8                           278   2e-87   
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          278   3e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               278   3e-87   Prunus mume [ume]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               278   3e-87   Fragaria vesca subsp. vesca
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          278   3e-87   Cucumis sativus [cucumbers]
gb|AFP44110.1|  elongation factor 1-alpha                               278   3e-87   Lycoris longituba
gb|AGV54713.1|  elongation factor 1-alpha                               278   4e-87   Phaseolus vulgaris [French bean]
gb|AFJ04514.1|  elongation factor 1-alpha                               277   5e-87   Vernicia fordii [tung oil tree]
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        277   5e-87   Salsola komarovii
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          278   5e-87   Cicer arietinum [garbanzo]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        278   5e-87   Hevea brasiliensis [jebe]
dbj|BAM13877.1|  elongation factor 1 alpha                              277   5e-87   Arum maculatum [cuckoo-pint]
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    268   5e-87   
gb|ADW83729.1|  elongation factor 1-alpha                               268   6e-87   Musa acuminata AAA Group [Cavendish banana]
ref|NP_001151074.1|  elongation factor 1-alpha                          277   6e-87   
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        277   7e-87   Bruguiera sexangula
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        277   7e-87   Hevea brasiliensis [jebe]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               277   7e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          277   7e-87   Sorghum bicolor [broomcorn]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          277   8e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGI15328.1|  elongation factor 1                                     277   8e-87   Aegiceras corniculatum
gb|KJB76560.1|  hypothetical protein B456_012G094600                    276   9e-87   Gossypium raimondii
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          276   9e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          276   1e-86   Pyrus x bretschneideri [bai li]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         276   1e-86   Medicago truncatula
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          276   1e-86   
ref|NP_001280807.1|  elongation factor 1-alpha-like                     276   1e-86   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    276   1e-86   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             276   1e-86   
gb|EPS66340.1|  elongation factor 1-alpha                               276   1e-86   
gb|AAF99703.1|  elongation factor                                       276   2e-86   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        276   2e-86   
gb|ABD66517.1|  EF-1 alpha                                              276   2e-86   
ref|NP_001104938.1|  elongation factor 1 alpha                          276   2e-86   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        276   2e-86   
gb|AIM48895.1|  elongation factor 1-alpha                               275   2e-86   
ref|XP_002311107.1|  ADR12-2 family protein                             276   2e-86   
gb|ABF00115.1|  elongation factor 1-alpha                               276   2e-86   
gb|AAV92325.1|  translation elongation factor-1 alpha                   269   2e-86   
ref|XP_002312029.1|  ADR12-2 family protein                             276   2e-86   
ref|XP_003591959.1|  Elongation factor 1-alpha                          279   3e-86   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             275   3e-86   
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          275   3e-86   
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               275   3e-86   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          275   3e-86   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                275   3e-86   
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          275   3e-86   
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             275   3e-86   
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               275   4e-86   
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    275   5e-86   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         275   5e-86   
ref|XP_001763198.1|  predicted protein                                  271   6e-86   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          275   6e-86   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             271   6e-86   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             275   7e-86   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             274   8e-86   
gb|ADK73624.1|  elongation factor 1 alpha                               270   8e-86   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    274   8e-86   
ref|XP_002311106.1|  ADR12-2 family protein                             274   8e-86   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          274   8e-86   
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             274   9e-86   
gb|EPS66069.1|  elongation factor 1-alpha                               274   9e-86   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    278   9e-86   
ref|NP_001105934.1|  elongation factor alpha7                           274   1e-85   
ref|XP_002892424.1|  T6D22.2                                            285   1e-85   
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          274   1e-85   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    273   2e-85   
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          273   2e-85   
gb|AAF79822.1|AC026875_2  T6D22.2                                       285   2e-85   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             273   3e-85   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          273   3e-85   
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    263   3e-85   
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               273   3e-85   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             273   4e-85   
ref|XP_003604587.1|  Elongation factor 1-alpha                          272   4e-85   
ref|NP_001104939.1|  elongation factor alpha6                           272   7e-85   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             271   8e-85   
ref|XP_001766482.1|  predicted protein                                  271   8e-85   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             271   9e-85   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    271   1e-84   
gb|EMS52529.1|  Elongation factor 1-alpha                               271   1e-84   
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             270   1e-84   
ref|XP_001763194.1|  predicted protein                                  271   2e-84   
ref|XP_001763201.1|  predicted protein                                  271   2e-84   
ref|XP_001753167.1|  predicted protein                                  271   2e-84   
ref|XP_001753181.1|  predicted protein                                  270   2e-84   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 270   3e-84   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                270   3e-84   
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        260   3e-84   
gb|AAC06383.1|  elongation factor 1 alpha                               259   4e-84   
gb|ACN41180.1|  unknown                                                 270   4e-84   
gb|AAR82894.1|  elongation factor 1-alpha                               270   4e-84   
emb|CAC27139.1|  translation elongation factor-1 alpha                  270   4e-84   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    281   5e-84   
gb|ABK25072.1|  unknown                                                 270   5e-84   
gb|EMS59091.1|  Elongation factor 1-alpha                               271   5e-84   
gb|ACN40081.1|  unknown                                                 270   5e-84   
gb|ACN40740.1|  unknown                                                 269   1e-83   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 268   1e-83   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   268   1e-83   
gb|AGI78242.1|  elongation factor 1 alpha                               268   1e-83   
gb|KHG15275.1|  Elongation factor 1-alpha                               268   2e-83   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    268   2e-83   
gb|ABK24265.1|  unknown                                                 268   2e-83   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    268   2e-83   
gb|EMS49772.1|  Elongation factor 1-alpha                               268   2e-83   
gb|AER42621.1|  elongation factor 1 alpha                               268   3e-83   
gb|AHA84124.1|  elongation factor 1-alpha                               268   3e-83   
gb|EMT12343.1|  Elongation factor 1-alpha                               267   5e-83   
gb|ABK24843.1|  unknown                                                 266   9e-83   
gb|EMS65134.1|  Elongation factor 1-alpha                               271   1e-82   
gb|AHZ58493.1|  translation elongation factor alpha                     266   2e-82   
ref|XP_001753059.1|  predicted protein                                  265   2e-82   
gb|ABR17675.1|  unknown                                                 265   3e-82   
ref|XP_003618775.1|  Elongation factor 1-alpha                          276   5e-82   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    276   5e-82   
gb|EMT09703.1|  Elongation factor 1-alpha                               272   5e-82   
gb|AGO97079.1|  elongation factor 1-alpha                               255   8e-82   
gb|AEE98364.1|  elongation factor 1-alpha                               263   2e-81   
gb|AGO97080.1|  elongation factor 1-alpha                               253   8e-81   
gb|ABQ81942.1|  elongation factor 1-alpha                               253   1e-80   
gb|AHZ44777.1|  elongation factor 1 alpha                               248   4e-80   
gb|AGO97078.1|  elongation factor 1-alpha                               250   1e-79   
gb|ABQ81936.1|  elongation factor 1-alpha                               258   1e-79   
dbj|BAK08818.1|  elongation factor 1-alpha                              258   2e-79   
dbj|BAK08744.1|  elongation factor 1-alpha                              258   2e-79   
gb|AFN42763.1|  elongation factor 1-alpha                               249   1e-78   
dbj|BAK08819.1|  elongation factor 1-alpha                              256   1e-78   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    250   2e-78   
dbj|BAL41369.1|  elongation factor 1-alpha                              242   1e-77   
gb|AAP80665.1|AF479046_1  elongation factor-1 alpha                     243   1e-77   
gb|AAO61852.1|  translation elongation factor-1 alpha                   251   2e-77   
ref|XP_009387472.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    241   3e-76   
emb|CAA09041.1|  elongation factor 1-alpha                              239   3e-76   
dbj|BAH23674.1|  elongation factor 1-alpha                              239   2e-75   
gb|ABE01407.1|  translation elongation factor 1a-1                      236   3e-75   
gb|ABL10112.1|  translation elongation factor 1-alpha                   237   4e-75   
gb|ABE01408.1|  translation elongation factor 1a-2                      235   9e-75   
gb|AJF94634.1|  elongation factor 1-alpha                               233   3e-74   
gb|KJB73628.1|  hypothetical protein B456_011G2414001                   234   4e-74   
gb|ACO50109.1|  elongation factor 1 alpha                               238   9e-74   
ref|XP_011069517.1|  PREDICTED: elongation factor 1-alpha               232   9e-74   
gb|ACT36602.1|  elongation factor 1 alpha                               240   2e-73   
gb|AAV34150.1|  EF-1 alpha                                              234   3e-73   
ref|XP_005650451.1|  translation elongation factor                      240   1e-72   
gb|ACL97363.1|  elongation factor-1 alpha                               239   1e-72   
gb|ACO50110.1|  elongation factor 1 alpha                               239   2e-72   
gb|AIM46989.1|  translation elongation factor 1-alpha                   238   1e-71   
emb|CEI96289.1|  Putative Elongation factor 1-alpha                     228   1e-71   
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     238   2e-71   
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     236   2e-71   
gb|ACL97366.1|  elongation factor-1 alpha                               236   2e-71   
ref|XP_002392294.1|  hypothetical protein MPER_08150                    232   4e-71   
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   236   6e-71   
gb|ABQ81935.1|  elongation factor 1-alpha                               235   6e-71   
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  236   6e-71   
gb|EKG07919.1|  elongation factor 1-alpha (ef-1-alpha), putative        228   6e-71   
gb|EPY25861.1|  elongation factor 1-alpha                               233   7e-71   
gb|EPY33803.1|  elongation factor 1-alpha                               232   8e-71   
gb|ACO50115.1|  elongation factor 1 alpha                               235   1e-70   
gb|EPR59445.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         229   1e-70   
emb|CDH51884.1|  elongation factor 1-alpha                              229   1e-70   
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    235   1e-70   
gb|ACN60128.1|  translation elongation factor 1-alpha                   226   2e-70   
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  235   2e-70   
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   235   2e-70   
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  235   2e-70   
ref|XP_006454380.1|  hypothetical protein AGABI2DRAFT_133083            234   2e-70   
gb|KFH03380.1|  elongation factor 1-alpha                               224   3e-70   
gb|ADB55729.1|  elongation factor 1-alpha                               236   3e-70   
ref|XP_003037261.1|  translation elongation factor 1a                   234   3e-70   
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    234   3e-70   
gb|KFG40151.1|  elongation factor 1-alpha                               228   4e-70   
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  234   4e-70   
gb|EKF27061.1|  elongation factor 1-alpha (ef-1-alpha), putative        225   4e-70   
gb|KIK71054.1|  hypothetical protein GYMLUDRAFT_33174                   234   4e-70   
emb|CCW70819.1|  unnamed protein product                                227   5e-70   
emb|CBY16376.1|  unnamed protein product                                227   5e-70   
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             233   6e-70   
ref|XP_007762783.1|  translation elongation factor 1a                   233   7e-70   
ref|XP_003873869.1|  elongation factor 1-alpha                          226   7e-70   
gb|AJP77649.1|  elongation factor 1-alpha                               227   7e-70   
gb|ADK90073.1|  elongation factor 1 alpha                               233   8e-70   
gb|KIO18434.1|  hypothetical protein M407DRAFT_16247                    232   8e-70   
gb|AEG78376.1|  elongation factor 1 alpha                               226   9e-70   
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          227   9e-70   
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 233   9e-70   
gb|EPR56707.1|  elongation factor 1-alpha                               228   1e-69   
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    228   1e-69   
ref|XP_007861104.1|  translation elongation factor 1a                   233   1e-69   
gb|KIM66163.1|  hypothetical protein SCLCIDRAFT_111138                  233   1e-69   
gb|EPR57682.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         228   1e-69   
gb|EPY27955.1|  elongation factor 1-alpha                               232   1e-69   
gb|KIJ45278.1|  hypothetical protein M422DRAFT_30129                    233   1e-69   
dbj|GAK62779.1|  elongation factor 1-alpha                              223   1e-69   
gb|KIJ21706.1|  hypothetical protein PAXINDRAFT_65274                   233   1e-69   
ref|XP_001873214.1|  predicted protein                                  232   2e-69   
emb|CCO27325.1|  elongation factor EF-1 alpha subunit                   229   2e-69   
gb|KIL70783.1|  hypothetical protein M378DRAFT_116001                   232   2e-69   
gb|ADG23104.1|  elongation factor 1-alpha                               223   2e-69   
gb|KDQ63704.1|  hypothetical protein JAAARDRAFT_29726                   232   2e-69   
ref|XP_009547250.1|  hypothetical protein HETIRDRAFT_319829             232   2e-69   
gb|KIO31120.1|  hypothetical protein M407DRAFT_241866                   232   2e-69   
ref|XP_008033061.1|  translation elongation factor                      232   2e-69   
gb|ACL97367.1|  elongation factor-1 alpha                               231   2e-69   
emb|CDP93913.1|  Protein Bm5195, isoform h                              223   3e-69   
ref|XP_007359855.1|  translation elongation factor 1a                   232   3e-69   
gb|KIM48158.1|  hypothetical protein M413DRAFT_439881                   231   3e-69   
gb|KIK28513.1|  hypothetical protein PISMIDRAFT_673531                  232   3e-69   
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   232   3e-69   
gb|AAZ81003.1|  eukaryotic translation elongation factor 1 alpha 1      222   3e-69   
gb|AEK26871.1|  elongation factor 1-alpha                               221   3e-69   
gb|AGW80518.1|  elongation factor 1-alpha 1                             223   3e-69   
ref|XP_001828758.1|  translation elongation factor 1 alpha              232   3e-69   
gb|KJA29192.1|  hypothetical protein HYPSUDRAFT_61224                   232   3e-69   
gb|EDL77720.1|  rCG25445, isoform CRA_b                                 222   3e-69   
gb|AHC00621.1|  tranlation elongation factor                            232   3e-69   
emb|CAI94748.1|  elongation factor                                      231   3e-69   
gb|AAH12509.1|  EEF1A1 protein                                          222   4e-69   
emb|CCI49302.1|  unnamed protein product                                231   4e-69   
ref|XP_822464.1|  elongation factor 1-alpha                             228   4e-69   
gb|EMD41826.1|  elongation factor 1-alpha                               231   5e-69   
gb|KDQ30740.1|  hypothetical protein PLEOSDRAFT_1070256                 231   5e-69   
ref|XP_007378612.1|  translation elongation factor 1a                   231   5e-69   
gb|EPT04282.1|  hypothetical protein FOMPIDRAFT_1021956                 231   5e-69   
gb|KHN88882.1|  Elongation factor 1-alpha                               231   5e-69   
ref|XP_009541702.1|  hypothetical protein HETIRDRAFT_413587             231   6e-69   
gb|ACF70735.1|  eukaryotic translation elongation factor 1              223   6e-69   
gb|ELU43120.1|  elongation factor 1-alpha                               234   6e-69   
gb|KIK06947.1|  hypothetical protein K443DRAFT_673838                   231   7e-69   
emb|CCA22726.1|  PREDICTED: hypothetical protein                        230   7e-69   
gb|KFH65589.1|  elongation factor EF-1 alpha subunit                    227   7e-69   
ref|XP_007298247.1|  translation elongation factor                      231   8e-69   
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    228   8e-69   
sp|P28295.1|EF1A_ABSGL  RecName: Full=Elongation factor 1-alpha; ...    231   8e-69   
gb|AJP13557.1|  translation elongation factor-1 alpha                   221   8e-69   
gb|AIM46986.1|  translation elongation factor 1-alpha                   230   8e-69   
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             231   8e-69   
gb|ETI46853.1|  elongation factor 1-alpha 1                             221   1e-68   
emb|CDH51795.1|  elongation factor 1-alpha                              230   1e-68   
gb|ABB46371.1|  elongation factor-1 alpha                               222   1e-68   
emb|CCC51155.1|  putative elongation factor 1-alpha                     230   1e-68   
gb|ESL10157.1|  hypothetical protein TRSC58_02114                       224   1e-68   
emb|CCC51157.1|  putative EF-1-alpha                                    230   1e-68   
dbj|BAH28836.1|  elongation factor 1-alpha                              230   1e-68   
gb|EQB55271.1|  hypothetical protein CGLO_04815                         224   1e-68   



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   290 bits (741),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  11   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  70

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  71   HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  130

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  131  FAVRDMRQTVAVGVVKNVDKKDPTG  155



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  29   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  88

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  89   HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  148

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  149  FAVRDMRQTVAVGVIKSVDKKDPTG  173



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   286 bits (731),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  31   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  90

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  91   HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  150

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  151  FAVRDMRQTVAVGVIKSVDKKDPTG  175



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   286 bits (731),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  29   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  88

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  89   HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  148

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  149  FAVRDMRQTVAVGVIKSVEKKDPTG  173



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  29   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  88

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  89   HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  148

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMR+TVAVGVIK+VDKKDPTG
Sbjct  149  FAVRDMRRTVAVGVIKSVDKKDPTG  173



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  38   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  97

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  98   HTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  157

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  158  FAVRDMRQTVAVGVIKNVEKKDPTG  182



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   286 bits (733),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  131  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  190

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  191  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  250

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  251  FAVRDMRQTVAVGVVKNVDKKDPTG  275



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  31   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  90

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGR
Sbjct  91   HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGR  150

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  151  FAVRDMRQTVAVGVIKSVEKKDPTG  175



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_009773066.1| PREDICTED: elongation factor 1-alpha, partial [Nicotiana sylvestris]
Length=149

 Score =   279 bits (713),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/138 (96%), Positives = 138/138 (100%), Gaps = 0/138 (0%)
 Frame = -1

Query  716  NVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV  537
            NVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV
Sbjct  1    NVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV  60

Query  536  KFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMR  357
            KFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMR
Sbjct  61   KFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMR  120

Query  356  QTVAVGVIKNVDKKDPTG  303
            QTVAVGVIKNVDKKDPTG
Sbjct  121  QTVAVGVIKNVDKKDPTG  138



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  138  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  197

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  198  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  257

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  258  FAVRDMRQTVAVGVIKSVEKKDPTG  282



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVA KDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  29   PGDNVGFNVKNVAAKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  88

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  89   HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  148

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  149  FAVRDMRQTVAVGVIKSVEKKEPTG  173



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  168  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  227

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  228  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  287

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  288  FAVRDMRQTVAVGVIKSVDKKDPTG  312



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  244  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  303

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  304  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  363

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  364  FAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  244  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  303

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  304  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  363

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  364  FAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPSG  436



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  191  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  250

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  251  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  310

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  311  FAVRDMRQTVAVGVIKNVEKKDPTG  335



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  179  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  238

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFA +LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  239  HTSHIAVKFAXILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  298

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  299  FAVRDMRQTVAVGVIKSVDKKDPTG  323



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKAVDKKDPTG  436



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK  A+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  29   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKETANFTSQVIIMNHPGQIGNGYAPVLDC  88

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR
Sbjct  89   HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  148

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  149  FAVRDMRQTVAVGVIKSVEKKDPSG  173



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  187  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  246

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  247  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  306

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  307  FAVRDMRQTVAVGVIKSVDKKDPTG  331



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   279 bits (714),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  46   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  105

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPT+PMVVETFSEYPPLGR
Sbjct  106  HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTRPMVVETFSEYPPLGR  165

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  166  FAVRDMRQTVAVGVIKSVEKKDPSG  190



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  293  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  352

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  353  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  412

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  413  FAVRDMRQTVAVGVVKNVDKKDPTG  437



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   283 bits (723),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  138  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  197

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  198  HTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  257

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  258  FAVRDMRQTVAVGVIKSVEKKDPTG  282



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   287 bits (735),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  272  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  331

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  332  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  391

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  392  FAVRDMRQTVAVGVIKNVEKKDPTG  416



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   287 bits (735),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   287 bits (735),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   287 bits (735),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   278 bits (712),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDC
Sbjct  46   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDC  105

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  106  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  165

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  166  FAVRDMRQTVAVGVIKSVEKKDPTG  190



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   287 bits (734),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  294  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  353

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  354  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  413

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  FAVRDMRQTVAVGVIKNVEKKDPTG  438



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  145  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  204

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  205  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  264

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  265  FAVRDMRQTVAVGVIKSVEKKDPTG  289



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  87   PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  146

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAV+FAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPP+GR
Sbjct  147  HTSHIAVRFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGR  206

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  207  FAVRDMRQTVAVGVIKSVEKKDPTG  231



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  167  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  226

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  227  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  286

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  287  FAVRDMRQTVAVGVIKSVEKKDPTG  311



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFQELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPSG  436



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  44   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  103

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  104  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  163

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  164  FAVRDMRQTVAVGVIKSVEKKDPSG  188



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  270  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  329

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  330  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  389

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  390  FAVRDMRQTVAVGVIKSVDKKDPTG  414



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  244  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  303

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  304  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  363

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  364  FAVRDMRQTVAVGVIKSVEKKDPTG  388



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  271  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  330

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  331  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  390

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  391  FAVRDMRQTVAVGVIKSVDKKDPTG  415



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  92   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  151

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  152  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  211

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  212  FAVRDMRQTVAVGVIKSVEKKDPSG  236



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNVDKK+P+G
Sbjct  412  FAVRDMRQTVAVGVIKNVDKKEPSG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  211  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  270

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  271  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  330

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  331  FAVRDMRQTVAVGVIKAVDKKDPTG  355



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  116  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  175

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  176  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  235

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK V+KKD +G
Sbjct  236  FAVRDMRQTVAVGVIKAVEKKDASG  260



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   280 bits (716),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  138  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  197

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  198  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  257

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  258  FAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  138  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  197

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  198  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  257

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  258  FAVRDMRQTVAVGVIKSVEKKDPSG  282



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  171  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  230

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  231  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGR  290

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  291  FAVRDMRQTVAVGVIKSVEKKDPTG  315



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   285 bits (728),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  286  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  345

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  346  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  405

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  406  FAVRDMRQTVAVGVIKSVEKKDPTG  430



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  303  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  362

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  363  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  422

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  423  FAVRDMRQTVAVGVIKSVDKKDPTG  447



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   285 bits (728),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKD+KRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMMPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  84   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  143

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGR
Sbjct  144  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGR  203

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  204  FAVRDMRQTVAVGVIKSVEKKDPSG  228



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSK+DPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKEDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPSG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  313  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  372

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  373  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  432

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  433  FAVRDMRQTVAVGVIKSVDKKDPTG  457



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -1

Query  740  SPVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLD  561
            SP  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLD
Sbjct  291  SPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLD  350

Query  560  CHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLG  381
            CHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLG
Sbjct  351  CHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLG  410

Query  380  RFAVRDMRQTVAVGVIKNVDKKDPTG  303
            RFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  411  RFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKD +G
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDASG  436



>ref|WP_033581549.1| elongation factor 1-alpha, partial [Dickeya zeae]
Length=147

 Score =   273 bits (698),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  6    PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  65

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  66   HTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  125

Query  377  FAVRDMRQTVAVGVIKNVDKKD  312
            FAVRDMRQTVAVGVIK+V+KKD
Sbjct  126  FAVRDMRQTVAVGVIKSVEKKD  147



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPM+VETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMLVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  81   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  140

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  141  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  200

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  201  FAVRDMRQTVAVGVIKSVEKKDPSG  225



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  138  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  197

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGR
Sbjct  198  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGR  257

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  258  FAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKD+KRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELE+EPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEREPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVR MRQTVAVGVIK V+KKDPTG
Sbjct  412  FAVRVMRQTVAVGVIKAVEKKDPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKN AVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNFAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMV M PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVMMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   278 bits (711),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  138  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  197

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGR
Sbjct  198  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGR  257

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  258  FAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASN KDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNPKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  270  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  329

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  330  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  389

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  390  FAVRDMRQTVAVGVIKSVDKKDPTG  414



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKK PTG
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKHPTG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   275 bits (704),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  84   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  143

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM+PT+PMVVETFS+YPPLGR
Sbjct  144  HTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTRPMVVETFSQYPPLGR  203

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  204  FAVRDMRQTVAVGVIKSVEKKDPTG  228



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   274 bits (700),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  56   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  115

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  116  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGR  175

Query  377  FAVRDMRQTVAVGVIKNVDKKDP  309
            FAVRDMRQTVAVGVIK+V+KKDP
Sbjct  176  FAVRDMRQTVAVGVIKSVEKKDP  198



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKEPTG  436



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  71   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  130

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  131  HTSHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  190

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  191  FAVRDMRQTVAVGVIKSVEKKDPSG  215



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  179  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  238

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGR
Sbjct  239  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGR  298

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  299  FAVRDMRQTVAVGVIKNVEKKDPSG  323



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   282 bits (722),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   275 bits (703),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDC
Sbjct  92   PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDC  151

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  152  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  211

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  212  FAVRDMRQTVAVGVIKSVEKKEPSG  236



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  175  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  234

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  235  HTSHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSTYPPLGR  294

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  295  FAVRDMRQTVAVGVIKSVEKKDPTG  319



>gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  291  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDC  350

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDR SGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+E PPLGR
Sbjct  351  HTSHIAVKFGEILTKIDRWSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAENPPLGR  410

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  411  FAVRDMRQTVAVGVVKNVDKKDPTG  435



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGLIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVII+NHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  189  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  248

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  249  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  308

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  309  FAVRDMRQTVAVGVIKSVEKKDPSG  333



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTV V VIK+VDKKDPTG
Sbjct  412  FAVRDMRQTVTVSVIKSVDKKDPTG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  191  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  250

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  251  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  310

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  311  FAVRDMRQTVAVGVIKSVEKKDPSG  335



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKD+KRGYVASNS DDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDIKRGYVASNSXDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  244  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  303

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  304  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  363

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  364  FAVRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+P+KPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPSKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVAS SKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  191  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  250

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGR
Sbjct  251  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGR  310

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  311  FAVRDMRQTVAVGVIKAVEKKDPSG  335



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AASF SQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAASFASQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVK +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKVSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGD+GMVKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  244  PGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  303

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  304  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  363

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  364  FAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KK+PTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKEPTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+F +QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQ IIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQGIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSSYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  244  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  303

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  304  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  363

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  364  FAVRDMRQTVAVGVIKSVEKKDPSG  388



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   280 bits (715),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   280 bits (715),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   280 bits (715),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  271  PGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  330

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  331  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGR  390

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  391  FAVRDMRQTVAVGVIKSVEKKDPTG  415



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   280 bits (715),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   276 bits (706),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  183  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  242

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGR
Sbjct  243  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGR  302

Query  377  FAVRDMRQTVAVGVIKNVDKKDPT  306
            FAVRDMRQTVAVGVIK+V+KKD +
Sbjct  303  FAVRDMRQTVAVGVIKSVEKKDAS  326



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   280 bits (715),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   280 bits (715),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HT HIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTCHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF++YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAATFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELL+KIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEY PLGR
Sbjct  352  HTSHIAVKFSELLSKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYSPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKGVEKKDPSG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  243  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  302

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGR
Sbjct  303  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGR  362

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  363  FAVRDMRQTVAVGVIKSVEKKDPTG  387



>gb|ABD66072.1| elongation factor 1-alpha [Phoenix dactylifera]
Length=245

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  103  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  162

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LT+IDRRSGKELEKEPKFLK+GDAG VKM+PTKPMVVETFS+YPPLGR
Sbjct  163  HTSHIAVKFAEILTEIDRRSGKELEKEPKFLKSGDAGFVKMIPTKPMVVETFSQYPPLGR  222

Query  377  FAVRDMRQTVAVGVIKNVDKKDP  309
            FAVRDMRQTVAVGVIK+V+KKDP
Sbjct  223  FAVRDMRQTVAVGVIKSVEKKDP  245



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+F SQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDL RG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLNRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAV DMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVLDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AES59072.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=465

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  295  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  354

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGR
Sbjct  355  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGR  414

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  415  FAVRDMRQTVAVGVIKAVEKKDPSG  439



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG GYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEMLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKAVEKKDPSG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003588821.1| Elongation factor 1-alpha [Medicago truncatula]
Length=458

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  288  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  347

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGR
Sbjct  348  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGR  407

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  408  FAVRDMRQTVAVGVIKAVEKKDPSG  432



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK A SFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAGSFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKAVEKKDPSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSK+DP K AASFTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKEDPTKEAASFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGR
Sbjct  352  HTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIM HPGQIGNGYAPVLDC
Sbjct  245  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMKHPGQIGNGYAPVLDC  304

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  305  HTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  364

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  365  FAVRDMRQTVAVGVIKSVEKKDPSG  389



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGR
Sbjct  352  HTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFAEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001183947.1| uncharacterized protein LOC100502553 [Zea mays]
 gb|ACF84684.1| unknown [Zea mays]
Length=399

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  244  PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTAQVIIMNHPGQIGNGYAPVLDC  303

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKF+ELLTKIDRRSGKELE  PKFLKNGDAG VKM+PTKPMVVETFSEYPPLGR
Sbjct  304  HTSHIAVKFSELLTKIDRRSGKELESAPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGR  363

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  364  FAVRDMRQTVAVGVIKSVEKKDPTG  388



>gb|ABR16818.1| unknown [Picea sitchensis]
Length=167

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  TSPVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVL  564
             SP  NVGFNVKNVAVKDLKRG+VAS+SK+DPA+ AA+FT+QVIIMNHPGQIGNGYAPVL
Sbjct  9    ASPGDNVGFNVKNVAVKDLKRGFVASDSKNDPAREAANFTAQVIIMNHPGQIGNGYAPVL  68

Query  563  DCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPL  384
            DCHTSHIAVKFAE++TK+DRRSGKELE+EPKFLKNGDAG +KM+P+KPMVVETFSEYPPL
Sbjct  69   DCHTSHIAVKFAEIMTKVDRRSGKELEREPKFLKNGDAGFIKMIPSKPMVVETFSEYPPL  128

Query  383  GRFAVRDMRQTVAVGVIKNVDKKDPT  306
            GRFAVRDMRQTVAVGVIK V+KKDPT
Sbjct  129  GRFAVRDMRQTVAVGVIKAVEKKDPT  154



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VAS+SK+DPAK AA+FT+QVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASDSKNDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGR
Sbjct  352  HTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  737  PVTNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDC  558
            P  NVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDC
Sbjct  292  PGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDC  351

Query  557  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  378
            HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF+EY PLGR
Sbjct  352  HTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGR  411

Query  377  FAVRDMRQTVAVGVIKNVDKKDPTG  303
            FAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  412  FAVRDMRQTVAVGVIKSVEKKDPTG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680