BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006E01

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO75101.1|  hypothetical protein CISIN_1g0050432mg                  214   4e-64   Citrus sinensis [apfelsine]
emb|CDO98898.1|  unnamed protein product                                219   4e-63   Coffea canephora [robusta coffee]
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    217   3e-62   Sesamum indicum [beniseed]
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    216   4e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...    216   7e-62   
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...    216   1e-61   Elaeis guineensis
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...    215   1e-61   Elaeis guineensis
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    214   2e-61   Vitis vinifera
emb|CAN77820.1|  hypothetical protein VITISV_043441                     216   4e-61   Vitis vinifera
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    213   8e-61   Phoenix dactylifera
ref|XP_009759318.1|  PREDICTED: tip elongation aberrant protein 3...    210   3e-60   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    211   3e-60   Nicotiana tomentosiformis
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             211   4e-60   Citrus clementina [clementine]
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    211   4e-60   Citrus sinensis [apfelsine]
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...    210   7e-60   
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...    210   8e-60   
ref|XP_011012826.1|  PREDICTED: acyl-CoA-binding domain-containin...    208   1e-59   Populus euphratica
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    209   1e-59   Solanum tuberosum [potatoes]
gb|KJB72597.1|  hypothetical protein B456_011G187500                    207   2e-59   Gossypium raimondii
ref|XP_004486293.1|  PREDICTED: uncharacterized protein LOC101494304    197   2e-59   
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    209   2e-59   Solanum tuberosum [potatoes]
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    208   4e-59   
gb|KJB72601.1|  hypothetical protein B456_011G187500                    207   4e-59   Gossypium raimondii
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   8e-59   Cucumis melo [Oriental melon]
gb|KJB72596.1|  hypothetical protein B456_011G187500                    207   8e-59   Gossypium raimondii
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   8e-59   Cucumis sativus [cucumbers]
ref|XP_002873905.1|  kelch repeat-containing protein                    207   9e-59   
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...    206   1e-58   Camelina sativa [gold-of-pleasure]
dbj|BAH19562.1|  AT5G18590                                              207   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...    206   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg             206   2e-58   Eutrema salsugineum [saltwater cress]
ref|NP_197360.2|  kelch repeat-containing protein                       206   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                             206   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...    206   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    206   2e-58   Solanum lycopersicum
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4            206   3e-58   Gossypium arboreum [tree cotton]
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4            206   3e-58   Gossypium arboreum [tree cotton]
gb|KDP40010.1|  hypothetical protein JCGZ_02008                         206   3e-58   Jatropha curcas
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    205   4e-58   Solanum lycopersicum
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    205   4e-58   Prunus mume [ume]
ref|XP_010931596.1|  PREDICTED: tip elongation aberrant protein 3...    204   5e-58   
ref|XP_002516884.1|  acyl-CoA binding protein, putative                 205   5e-58   Ricinus communis
gb|KJB72598.1|  hypothetical protein B456_011G187500                    205   5e-58   Gossypium raimondii
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    205   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    205   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...    205   7e-58   Populus euphratica
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    205   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...    204   1e-57   Elaeis guineensis
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...    204   1e-57   Elaeis guineensis
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...    204   2e-57   Elaeis guineensis
gb|KJB72599.1|  hypothetical protein B456_011G187500                    204   2e-57   Gossypium raimondii
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...    204   2e-57   
ref|XP_007222490.1|  hypothetical protein PRUPE_ppa004126mg             201   2e-57   
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    203   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    203   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...    203   3e-57   
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g             201   9e-57   
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...    202   9e-57   
gb|KEH32273.1|  acyl-CoA-binding domain protein                         201   2e-56   Medicago truncatula
gb|KJB38636.1|  hypothetical protein B456_006G264600                    200   2e-56   Gossypium raimondii
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    201   2e-56   
gb|AES91803.2|  acyl-CoA-binding domain protein                         201   2e-56   Medicago truncatula
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein         201   2e-56   
emb|CDX92598.1|  BnaA10g16370D                                          201   2e-56   
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...    200   3e-56   Populus euphratica
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g             200   3e-56   
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...    200   5e-56   Populus euphratica
emb|CDY13903.1|  BnaC09g39230D                                          198   1e-55   Brassica napus [oilseed rape]
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...    198   1e-55   Brassica rapa
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein      198   1e-55   Gossypium arboreum [tree cotton]
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    198   2e-55   
gb|KJB38635.1|  hypothetical protein B456_006G264600                    197   2e-55   Gossypium raimondii
ref|XP_004486044.1|  PREDICTED: acyl-CoA-binding domain-containin...    196   3e-55   Cicer arietinum [garbanzo]
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    197   4e-55   Fragaria vesca subsp. vesca
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    196   7e-55   Cicer arietinum [garbanzo]
gb|AES64218.2|  acyl-CoA-binding domain protein                         196   9e-55   Medicago truncatula
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         196   1e-54   
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                196   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             193   1e-53   Phaseolus vulgaris [French bean]
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...    193   1e-53   
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    190   1e-52   Glycine max [soybeans]
gb|KHN47303.1|  hypothetical protein glysoja_020171                     181   2e-52   Glycine soja [wild soybean]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            190   2e-52   Glycine soja [wild soybean]
gb|EPS74438.1|  hypothetical protein M569_00314                         185   3e-52   Genlisea aurea
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             187   1e-51   Phaseolus vulgaris [French bean]
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            184   2e-50   Glycine soja [wild soybean]
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    182   9e-50   
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    182   1e-49   
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    182   1e-49   Glycine max [soybeans]
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    182   1e-49   Glycine max [soybeans]
gb|AES91804.2|  acyl-CoA-binding domain protein                         179   9e-49   Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein         179   1e-48   
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...    177   3e-48   Cicer arietinum [garbanzo]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...    178   4e-48   
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...    178   4e-48   
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...    177   4e-48   Cicer arietinum [garbanzo]
ref|XP_006855461.1|  hypothetical protein AMTR_s00057p00182130          177   8e-48   
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   4e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001068393.1|  Os11g0657000                                       164   7e-44   
gb|EEC68565.1|  hypothetical protein OsI_36893                          165   1e-43   Oryza sativa Indica Group [Indian rice]
gb|EEE52499.1|  hypothetical protein OsJ_34700                          164   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...    162   8e-43   
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...    162   9e-43   Oryza brachyantha
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...    161   2e-42   Setaria italica
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...    157   4e-41   
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...    157   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...    156   1e-40   Zea mays [maize]
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...    151   9e-39   Brachypodium distachyon [annual false brome]
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...    150   2e-38   Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...    150   2e-38   Populus euphratica
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...    147   2e-37   Oryza brachyantha
dbj|BAJ86800.1|  predicted protein                                      147   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00700.1|  predicted protein                                      147   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146281.1|  uncharacterized protein LOC100279856               146   5e-37   Zea mays [maize]
gb|EEC69433.1|  hypothetical protein OsI_38606                          145   2e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180          144   2e-36   
ref|NP_001066944.1|  Os12g0538800                                       145   2e-36   
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    144   5e-36   
ref|NP_001145999.1|  uncharacterized protein LOC100279529               144   6e-36   
dbj|BAK00043.1|  predicted protein                                      138   9e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...    142   2e-35   
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...    142   2e-35   Setaria italica
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...    138   4e-34   
gb|EMT26901.1|  hypothetical protein F775_29769                         133   2e-32   
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                    129   8e-31   
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...    129   8e-31   
gb|KDO75103.1|  hypothetical protein CISIN_1g0050432mg                  123   1e-29   Citrus sinensis [apfelsine]
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315             124   4e-29   Selaginella moellendorffii
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505             124   4e-29   Selaginella moellendorffii
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4            124   9e-29   Triticum urartu
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...    123   2e-28   
ref|XP_010098333.1|  hypothetical protein L484_023581                   116   1e-26   
ref|XP_001759823.1|  predicted protein                                  116   5e-26   
gb|EMT25879.1|  hypothetical protein F775_10881                         112   1e-24   
gb|EMS62709.1|  Acyl-CoA-binding domain-containing protein 4            110   4e-24   Triticum urartu
ref|XP_001760924.1|  predicted protein                                  105   2e-22   
ref|XP_001751751.1|  predicted protein                                95.9    7e-19   
gb|ABA95166.1|  Kelch motif family protein, expressed                 91.3    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001761501.1|  predicted protein                                84.0    4e-16   
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        85.5    1e-15   
emb|CDY02611.1|  BnaC02g08240D                                        71.6    5e-13   
gb|ABR25493.1|  rangap1 interacting protein                           69.7    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_001765510.1|  predicted protein                                66.2    2e-09   
gb|EEE53353.1|  hypothetical protein OsJ_36377                        66.2    3e-09   Oryza sativa Japonica Group [Japonica rice]



>gb|KDO75101.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
 gb|KDO75102.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=365

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE
Sbjct  212  PSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKE  271

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  272  MELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  331

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  332  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  365



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
             +QSYE KL AL+RKNG+LEGQLAAA++SRE+A+K+LS+A+KS+Q+ EKKLADAMKE++L
Sbjct  560  FHQSYELKLGALIRKNGILEGQLAAAISSRESAEKNLSTAVKSRQEMEKKLADAMKEMEL  619

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  620  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  679

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV
Sbjct  680  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  710



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P G+YQ YEAKL +LLRKNG+LEGQLAAALA+REAA+K+LS A+KS+QD E+KL +AM+E
Sbjct  559  PSGVYQIYEAKLASLLRKNGILEGQLAAALAAREAAEKNLSLAIKSRQDMERKLGEAMRE  618

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            I+LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  619  IELLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  678

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQ+LE RAPTPRKPFHV
Sbjct  679  RARAFQLQVEVFHLKQRLQTLETRAPTPRKPFHV  712



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y++K+ AL+RKNG+LE QLAA+LA REAA+K+LSS +KS+QD EKKLAD MKE
Sbjct  554  PSNVYQLYDSKIAALVRKNGILEAQLAASLAGREAAEKNLSSVIKSRQDIEKKLADTMKE  613

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            +++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  614  MEMLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  673

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  674  RARAFQLQVEVFHLKQRLQSVENRAPTPRKPFHM  707



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score =   216 bits (549),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE
Sbjct  553  PSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKE  612

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  613  VELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  672

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  673  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  706



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE
Sbjct  579  PSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKE  638

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  639  VELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  698

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  699  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  732



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE
Sbjct  576  PSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKE  635

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  636  VELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  695

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  696  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  729



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 152/177 (86%), Gaps = 8/177 (5%)
 Frame = -1

Query  615  ETFP*IVMISSFKRAIANLEYQLPIGLYQSYEAKLXALLRKNgllegqlaaalasreaad  436
            E FP      S  +++A   +  P  +YQ YE K+ AL+RKNG+LEGQL AALASREA +
Sbjct  549  EVFP-----ESHGKSVA---FSAPSSIYQLYETKMAALIRKNGILEGQLTAALASREAVE  600

Query  435  kslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVA  256
            K+LSS LK++Q+ EKKLAD +KE+++LKEKLAGVELAQEEAN+LSN+VHSDNVRLEHDVA
Sbjct  601  KNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQEEANNLSNMVHSDNVRLEHDVA  660

Query  255  FLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            FLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  661  FLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  717



>emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera]
Length=1034

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  564   NLEYQLPIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKL  385
             ++ +  P  +YQ YE K+ AL+RKNG+LEGQL AALASREA +K+LSS LK++Q+ EKKL
Sbjct  875   SVAFSAPSSIYQLYETKMAALIRKNGILEGQLTAALASREAVEKNLSSVLKNRQEMEKKL  934

Query  384   ADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTR  205
             AD +KE+++LKEKLAGVELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTR
Sbjct  935   ADTLKEMEMLKEKLAGVELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTR  994

Query  204   GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
             G+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  995   GVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  1034



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE K+  L RKN LLE QL  A+AS+EA +K+LSSA+KS+QD EKK+ADAMKE
Sbjct  575  PSNIYQLYETKIVTLTRKNVLLEEQLNVAMASQEATEKNLSSAIKSRQDMEKKIADAMKE  634

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLA VELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  635  VELLKEKLASVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  694

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  695  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  728



>ref|XP_009759318.1| PREDICTED: tip elongation aberrant protein 3-like [Nicotiana 
sylvestris]
Length=634

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  540  GLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  361
            G  Q YEAKL AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++
Sbjct  483  GACQQYEAKLSALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDMEKRMGDTVKEVE  542

Query  360  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  181
            LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERA
Sbjct  543  LLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERA  602

Query  180  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  603  RAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  634



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  540  GLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  361
            G  Q YEAKL AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++
Sbjct  556  GACQQYEAKLSALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDVEKRMGDTVKEVE  615

Query  360  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  181
            LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERA
Sbjct  616  LLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERA  675

Query  180  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  676  RAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  707



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE K+  L+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE
Sbjct  564  PSSIYQFYETKMADLIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKE  623

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  624  MELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  683

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  684  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE K+  L+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE
Sbjct  564  PSSIYQFYETKMADLIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKE  623

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  624  MELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  683

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  684  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE ++ AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE
Sbjct  563  PSSIYQFYETRMAALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKE  622

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  623  MELLKEKLAGIELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  682

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  683  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  716



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA+++LS A+++KQ+TEKKLADAM+E++L
Sbjct  548  VYQFHEAKMAALIRRNGILEGQLTAALAGREAAERNLSVAMRTKQETEKKLADAMREVEL  607

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            +KEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  608  MKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  667

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  668  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  698



>ref|XP_011012826.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=616

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DL
Sbjct  465  IYQLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDL  524

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  525  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  584

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENR  TPRKPFHV
Sbjct  585  AFQLQVEVFHLKQRLQSMENRTSTPRKPFHV  615



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 7/152 (5%)
 Frame = -1

Query  540  GLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  361
            G  Q YEAKL +L+RKNG+LEGQLA ALA REAA KS        QD EKK+ADA+KE++
Sbjct  518  GACQQYEAKLSSLMRKNGILEGQLATALAGREAAVKSK-------QDMEKKMADAVKEME  570

Query  360  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  181
            LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERA
Sbjct  571  LLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERA  630

Query  180  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  631  RAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  662



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE
Sbjct  453  PTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKE  512

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  513  MELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  572

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  573  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  606



>ref|XP_004486293.1| PREDICTED: uncharacterized protein LOC101494304 [Cicer arietinum]
Length=201

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE K+ +L+RK G+LE QL AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+L
Sbjct  51   IYDYYETKVSSLIRKFGILEAQLLAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIEL  110

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG ELAQE+A++LSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERAR
Sbjct  111  LREKLAGAELAQEDASNLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERAR  170

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  171  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  201



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 7/152 (5%)
 Frame = -1

Query  540  GLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  361
            G  Q YEAKL +L+RKNG+LEGQLA ALA REAA KS        QD EKK+ADA+KE++
Sbjct  557  GACQQYEAKLSSLMRKNGILEGQLATALAGREAAVKSK-------QDMEKKMADAVKEME  609

Query  360  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  181
            LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERA
Sbjct  610  LLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERA  669

Query  180  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  670  RAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  701



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE K+  L RKN LLE QL AALA++EAA+K+LSSALKS+QD EKKLADAMKE++L
Sbjct  565  IYQLYETKIVTLTRKNVLLEEQLTAALANQEAAEKNLSSALKSRQDMEKKLADAMKEVEL  624

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLAG+ELAQEEAN+LSN+ HSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  625  LKEKLAGMELAQEEANNLSNMSHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  684

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVE FHLKQRLQS+ENRAPTPRKPFH+
Sbjct  685  AFQLQVEAFHLKQRLQSMENRAPTPRKPFHI  715



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE
Sbjct  512  PTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKE  571

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  572  MELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  631

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  632  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  665



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YEAK+ AL+RKNG+LEGQLAAA ASREA +K+LSSALK +Q+ EK++AD +KE+++
Sbjct  527  IYQFYEAKMAALIRKNGVLEGQLAAATASREAVEKNLSSALKIRQEMEKRIADMIKEMEM  586

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L++KLAGVE+A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER+R
Sbjct  587  LRDKLAGVEIAKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERSR  646

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  647  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  677



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE
Sbjct  556  PTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKE  615

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  616  MELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  675

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  676  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  709



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YEAK+ AL+RKNG+LEGQLAAA ASREA +K+LSSALK +Q+ EK++AD +KE+++
Sbjct  528  IYQFYEAKMAALIRKNGVLEGQLAAATASREAVEKNLSSALKIRQEMEKRIADMIKEMEM  587

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L++KLAGVE+A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER+R
Sbjct  588  LRDKLAGVEIAKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERSR  647

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  648  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  678



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  559  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  618

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  619  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  678

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  679  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  709



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  541  VYQFHEAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  600

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  601  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  660

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  661  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  691



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  558  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  617

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  618  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  677

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  678  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  557  VYQFHEAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  616

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  617  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  676

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  677  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL DAM++++L
Sbjct  551  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLCDAMRDVEL  610

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  611  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  670

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  671  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  701



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  558  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  617

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  618  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  677

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  678  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  708



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  558  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  617

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  618  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  677

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  678  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  557  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  616

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  617  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  676

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  677  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 7/152 (5%)
 Frame = -1

Query  540  GLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  361
            G  Q +EAKL +L+RKNG+LEGQLAAALA REAA +S        QD EKK++DA+KE++
Sbjct  517  GACQQHEAKLSSLMRKNGILEGQLAAALAGREAAVRSK-------QDMEKKMSDAVKEME  569

Query  360  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  181
            LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG+L GERA
Sbjct  570  LLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRGVLAGERA  629

Query  180  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  630  RAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  661



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y+ ++ +L RKNG+LE QLA ALASR+ A+++L++ALKSK++ EKK ADAMKE
Sbjct  580  PTSIYQFYDTRMASLSRKNGILEVQLATALASRDTAERTLAAALKSKEEMEKKFADAMKE  639

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKL G+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  640  MELLKEKLTGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  699

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  700  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  733



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y+ ++ +L RKNG+LE QLA ALASR+ A+++L++ALKSK++ EKK ADAMKE
Sbjct  556  PTSIYQFYDTRMASLSRKNGILEVQLATALASRDTAERTLAAALKSKEEMEKKFADAMKE  615

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKL G+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  616  MELLKEKLTGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  675

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  676  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  709



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE K+ AL+RKNG+LEGQLAAAL+SR++A+K+LSS LKSKQ+ EKKL DA++E++L
Sbjct  559  IYQLYETKIAALIRKNGVLEGQLAAALSSRDSAEKNLSSVLKSKQELEKKLTDALREMEL  618

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKE+LA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  619  LKERLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  678

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENR PTPRKPF+V
Sbjct  679  AFQLQVEVFHLKQRLQSMENRVPTPRKPFNV  709



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 7/152 (5%)
 Frame = -1

Query  540  GLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  361
            G  Q +EAKL +L+RKNG+LEGQLAAALA REAA +S        QD EKK++DA+KE++
Sbjct  556  GACQQHEAKLSSLMRKNGILEGQLAAALAGREAAVRSK-------QDMEKKMSDAVKEME  608

Query  360  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  181
            LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG+L GERA
Sbjct  609  LLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRGVLAGERA  668

Query  180  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  669  RAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  700



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +Y  YE+K+ +L+RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E+KLAD  KE
Sbjct  563  PSSIYHYYESKMASLIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEMERKLADTAKE  622

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  623  MELLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  682

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  683  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  714



>ref|XP_010931596.1| PREDICTED: tip elongation aberrant protein 3 isoform X5 [Elaeis 
guineensis]
Length=629

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE
Sbjct  476  PSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKE  535

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  536  VELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  595

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  596  RARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  629



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE K+ +L+RKNG+LEGQLAAALASREAA+K+LSS LKS+Q+ E+KL D ++E++L
Sbjct  563  IYQLYETKIASLIRKNGVLEGQLAAALASREAAEKNLSSVLKSRQEIERKLTDTLREMEL  622

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  623  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLTGERAR  682

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENR PTPRKPF+V
Sbjct  683  AFQLQVEVFHLKQRLQSMENRVPTPRKPFNV  713



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score =   205 bits (521),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 120/154 (78%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE
Sbjct  526  PTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKE  585

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  586  MELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  645

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  646  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  679



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  552  QLPIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAM  373
             +P  + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +
Sbjct  550  SVPSNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTI  609

Query  372  KEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLG  193
            KE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L 
Sbjct  610  KEVEILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLA  669

Query  192  GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            GERARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  670  GERARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  705



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  552  QLPIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAM  373
             +P  + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +
Sbjct  549  SVPSNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTI  608

Query  372  KEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLG  193
            KE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L 
Sbjct  609  KEVEILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLA  668

Query  192  GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            GERARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  669  GERARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  704



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score =   205 bits (521),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DL
Sbjct  570  IYQLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDL  629

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  630  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  689

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENR  TPRKPFHV
Sbjct  690  AFQLQVEVFHLKQRLQSMENRTSTPRKPFHV  720



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  552  QLPIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAM  373
             +P  + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +
Sbjct  555  SVPSNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTI  614

Query  372  KEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLG  193
            KE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L 
Sbjct  615  KEVEILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLA  674

Query  192  GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            GERARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  675  GERARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  710



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE
Sbjct  577  PSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKE  636

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  637  VELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  696

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  697  RARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  730



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE
Sbjct  564  PSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKE  623

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  624  VELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  683

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  684  RARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  717



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE
Sbjct  580  PSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKE  639

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  640  VELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  699

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  700  RARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  733



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score =   204 bits (518),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 120/154 (78%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE
Sbjct  553  PTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKE  612

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  613  MELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  672

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  673  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  706



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE
Sbjct  574  PSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKE  633

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  634  VELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  693

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  694  RARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  727



>ref|XP_007222490.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
 gb|EMJ23689.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
Length=528

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +Y  YE+K+   +RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E+KLAD  KE
Sbjct  377  PSSIYHYYESKMATQIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEMERKLADTAKE  436

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEK AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  437  MELLKEKAAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  496

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  497  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  528



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+K+ AL+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E+KL+D+ KE++ 
Sbjct  563  MYHYYESKMAALIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEMERKLSDSAKEMEF  622

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  623  LKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  682

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  683  AFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+K+ AL+RKNG+LEG+LA  +A++EAA+K+LSSALKS+Q+ E+KL+D+ KE++ 
Sbjct  563  MYHYYESKMAALIRKNGILEGKLATVMANQEAAEKNLSSALKSRQEMERKLSDSAKEMEF  622

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  623  LKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  682

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  683  AFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE K+ +L RKN LLE QL AAL  REAA+K+LSSA+KSKQ+ E KLAD +KE
Sbjct  552  PSNIYQLYETKIASLTRKNVLLEEQLKAALTCREAAEKNLSSAVKSKQEVETKLADTVKE  611

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLKEKLAGVELAQEEANSLSNIVHS NVRLEHDVAFLKA+LDDTQKEL+STRG+L GE
Sbjct  612  VELLKEKLAGVELAQEEANSLSNIVHSHNVRLEHDVAFLKAILDDTQKELYSTRGVLAGE  671

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV*SSIL  70
            RARAFQLQVEVFHLKQRLQSLENRAPTPRKP  + + +L
Sbjct  672  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPIQICNDVL  710



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 120/151 (79%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSALKS+Q+ EKKL D ++E++L
Sbjct  512  IYRLYETKIAALTRKNRVLEGQLAAAFIGREAAEKNVSSALKSRQEMEKKLVDTVREMEL  571

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  572  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  631

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  632  AFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  662



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++L
Sbjct  557  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVEL  616

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  617  LKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  676

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA T RKPFHV
Sbjct  677  AFQLQVEVFHLKQRLQSLENRAATHRKPFHV  707



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++L
Sbjct  566  IYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMEL  625

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  626  LREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  685

Query  177  AFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            AFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  686  AFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  717



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 140/154 (91%), Gaps = 2/154 (1%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE
Sbjct  481  PSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKE  538

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            +DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GE
Sbjct  539  MDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGE  598

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  599  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  632



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+K+  L+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E+KL+D  KE++ 
Sbjct  567  MYHYYESKMAXLIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEMERKLSDTAKEMEF  626

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  627  LKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  686

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  687  AFQLQVEVFHLKQRLQSMENRAPTPRKPF  715



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++L
Sbjct  567  IYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMEL  626

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  627  LREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  686

Query  177  AFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            AFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  687  AFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  718



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++L
Sbjct  591  IYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMEL  650

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  651  LREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  710

Query  177  AFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            AFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  711  AFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  742



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DA++++DL
Sbjct  550  VYQFHEAKMTALIRRNGVLEGQLEAALAGREAAERNVSVALRSKQETDKKLSDALRDVDL  609

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+EL+Q+EANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERAR
Sbjct  610  LKEKLTGLELSQDEANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERAR  669

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  670  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  700



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   200 bits (509),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  689  AFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  719



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score =   200 bits (509),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 125/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E++L
Sbjct  556  IYQLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMEL  615

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  616  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  675

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENR  TPRKPF V
Sbjct  676  AFQLQVEVFHLKQRLQSMENRTSTPRKPFRV  706



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   200 bits (508),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  689  AFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  719



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+++KKL+DA+++++L
Sbjct  524  VYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQESDKKLSDALRDVEL  583

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+ELAQ+EANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERAR
Sbjct  584  LKEKLTGLELAQDEANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERAR  643

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  644  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  674



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ +EAK+ AL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DA+++++L
Sbjct  550  VYQFHEAKMTALIRRNGVLEGQLEAALAGREAAERNVSVALRSKQETDKKLSDALRDVEL  609

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKL G+EL+Q+EANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERAR
Sbjct  610  LKEKLTGLELSQDEANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERAR  669

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  670  AFQLQVEVFHLKQRLQSLENRAATPRKPFHV  700



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score =   198 bits (504),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 118/154 (77%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +Y  YE ++ AL RKNG+LE QL AA+ASR++ +++L+SALKSK++ EK+LAD +KE
Sbjct  552  PSSIY--YEMRMAALSRKNGILEVQLGAAMASRDSIERNLASALKSKEEMEKRLADTVKE  609

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            +DL+KEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  610  MDLVKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  669

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  670  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  703



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            + Q Y+ K+ +L+RKNG+LEGQLAAALA++EA +KS SS LKSKQ+ +KKLAD MKE+++
Sbjct  546  ICQLYKTKIDSLIRKNGILEGQLAAALANQEATEKSFSSILKSKQEVDKKLADTMKEMEV  605

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLA +E+ QEEANSL+NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  606  LKEKLADLEVTQEEANSLNNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  665

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
             FQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  666  TFQLQVEVFHLKQRLQSIENRAPTPRKPFHV  696



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score =   197 bits (502),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 117/154 (76%), Positives = 140/154 (91%), Gaps = 2/154 (1%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE
Sbjct  555  PSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKE  612

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            +DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GE
Sbjct  613  MDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGE  672

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  673  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  706



>ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=610

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE K+ +L+RK G+LE QL AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+L
Sbjct  460  IYDYYETKVSSLIRKFGILEAQLLAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIEL  519

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG ELAQE+A++LSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERAR
Sbjct  520  LREKLAGAELAQEDASNLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERAR  579

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  580  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  610



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 141/152 (93%), Gaps = 4/152 (3%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE     L+RKNG+LEGQLAAALASREAA+K+LSSALKS+Q+ EKKLAD+ KE
Sbjct  562  PSSMYQYYEK----LIRKNGVLEGQLAAALASREAAEKNLSSALKSRQEIEKKLADSGKE  617

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            I+LLK+KLAGVELAQEEAN+LS+IVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  618  IELLKDKLAGVELAQEEANNLSSIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  677

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  678  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  709



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE K+ +L+RK G+LE QL AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+L
Sbjct  559  IYDYYETKVSSLIRKFGILEAQLLAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIEL  618

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG ELAQE+A++LSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERAR
Sbjct  619  LREKLAGAELAQEDASNLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERAR  678

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  679  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  709



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE K+ +L+ K G+LE QLAA+LAS+EAA+K+L+SA KSKQ+ +K +AD ++EI+L
Sbjct  548  IYNYYETKVSSLITKFGILEAQLAASLASKEAAEKNLASAFKSKQEMDKTMADTLQEIEL  607

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKL G ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  608  LREKLVGAELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  667

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  668  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  698



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE K+ +L+ K G+LE QLAA+LAS+EAA+K+L+SA KSKQ+ +K +AD ++EI+L
Sbjct  613  IYNYYETKVSSLITKFGILEAQLAASLASKEAAEKNLASAFKSKQEMDKTMADTLQEIEL  672

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKL G ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  673  LREKLVGAELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  732

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  733  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  763



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   196 bits (497),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P G+YQ  EAKL +L+RKNG+LEGQLAAALA+REAA+K+LS+A++S+ + EKKL +AMKE
Sbjct  549  PPGVYQVSEAKLASLMRKNGILEGQLAAALAAREAAEKNLSAAIRSRLEMEKKLGEAMKE  608

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            +++L+EK+  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  609  MEMLREKVTSVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  668

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
              RAFQLQVEVFHLKQRLQSLE RAPTPRKP+HV
Sbjct  669  HGRAFQLQVEVFHLKQRLQSLEPRAPTPRKPYHV  702



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+K+ +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLADA KE++L
Sbjct  557  VYHYYESKVASLIRKNGILEGQLAASLASKEAAEKSLTSVLKSRQEMERKLADAHKEMEL  616

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKLA +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  617  MREKLASLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  676

Query  177  AFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  85
            AFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  677  AFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  708



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE K  +L RKN LLE QL AA  SRE A+++LS  ++ KQD E+KLADA++E
Sbjct  580  PTDVYQVYETKTASLTRKNVLLEEQLKAATTSREIAERNLSCTVERKQDRERKLADALRE  639

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            ++LLK+K+AG+E+AQEEAN LSNI HSDNVRLEHDVAFLKA+L+DTQKELHSTRG+L GE
Sbjct  640  VELLKDKVAGMEVAQEEANGLSNIGHSDNVRLEHDVAFLKAILEDTQKELHSTRGVLAGE  699

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS ++RAPTPRKPF +
Sbjct  700  RARAFQLQVEVFHLKQRLQSGDHRAPTPRKPFQM  733



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLA++ KE++L
Sbjct  556  VYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLASVLKSRQEMERKLAESHKEMEL  615

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  616  MREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  675

Query  177  AFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  85
            AFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  676  AFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  707



>gb|KHN47303.1| hypothetical protein glysoja_020171 [Glycine soja]
Length=261

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++L
Sbjct  111  IHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMEL  170

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER R
Sbjct  171  LREKLVNAELAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTR  230

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            A QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  231  ALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  261



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLA++ KE++L
Sbjct  584  VYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLASVLKSRQEMERKLAESHKEMEL  643

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  644  MREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  703

Query  177  AFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  85
            AFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  704  AFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  735



>gb|EPS74438.1| hypothetical protein M569_00314, partial [Genlisea aurea]
Length=449

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 8/154 (5%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            YE K+ AL++K G+LEGQLAAA A+REAA+K+ +SA +S+Q+ EKKL D +KEIDLLKEK
Sbjct  296  YEEKIAALMKKTGILEGQLAAATAAREAAEKNSASATRSRQEMEKKLVDTLKEIDLLKEK  355

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK--------ELHSTRGLLGG  190
            L+ VE++QEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK        ELHSTRG+L G
Sbjct  356  LSSVEISQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKASWKQKRLELHSTRGVLAG  415

Query  189  ERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            ERARAFQLQVEVFHLKQRLQSLE RAPTPRK FH
Sbjct  416  ERARAFQLQVEVFHLKQRLQSLETRAPTPRKQFH  449



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+  KKLAD +KE++L
Sbjct  560  IHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMGKKLADTLKEMEL  619

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER R
Sbjct  620  LSEKLVSAELAQEEANNLSNLVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTR  679

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  680  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  710



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 140/153 (92%), Gaps = 2/153 (1%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+KL +L+RKNG+LEGQLAA++AS+EAA+KSL+S LKS+Q+ ++KL ++ KE++L
Sbjct  562  VYYYYESKLASLIRKNGILEGQLAASIASKEAAEKSLTSVLKSRQEMDRKLTESEKEMEL  621

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKLAG+ELAQEE N+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  622  MREKLAGLELAQEETNNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  681

Query  177  AFQLQVEVFHLKQRLQSLE-NRAP-TPRKPFHV  85
            AFQLQ EVFHLKQRLQS+E NRA  TPRKPFHV
Sbjct  682  AFQLQYEVFHLKQRLQSMEKNRASTTPRKPFHV  714



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            ++  YE K+ +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++L
Sbjct  561  IHHYYETKVASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMEL  620

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKL   EL QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER R
Sbjct  621  LREKLVSAELVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTR  680

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+E RAPTPRKPF V
Sbjct  681  AFQLQVEVFHLKQRLQSMEKRAPTPRKPFQV  711



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            ++  YE K+ +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++L
Sbjct  565  IHHYYETKVASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMEL  624

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKL   EL QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER R
Sbjct  625  LREKLVSAELVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTR  684

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQVEVFHLKQRLQS+E RAPTPRKPF V
Sbjct  685  AFQLQVEVFHLKQRLQSMEKRAPTPRKPFQV  715



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++L
Sbjct  560  IHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMEL  619

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER R
Sbjct  620  LREKLVNAELAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTR  679

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            A QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  680  ALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  710



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++L
Sbjct  549  IHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMEL  608

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER R
Sbjct  609  LREKLVNAELAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTR  668

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            A QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  669  ALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  699



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 9/152 (6%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++L
Sbjct  567  IYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMEL  626

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  627  LREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  686

Query  177  AFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            AFQL        QRLQS+ENR + TPRKPFHV
Sbjct  687  AFQL--------QRLQSMENRTSTTPRKPFHV  710



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 9/152 (6%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++L
Sbjct  591  IYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMEL  650

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            L+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERAR
Sbjct  651  LREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERAR  710

Query  177  AFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            AFQL        QRLQS+ENR + TPRKPFHV
Sbjct  711  AFQL--------QRLQSMENRTSTTPRKPFHV  734



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+++ AL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++
Sbjct  539  IYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEV  598

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER R
Sbjct  599  MREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGR  658

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  659  AFQLQCEAFHLNQRLQSMENQASTPRKPFHV  689



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+++ AL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++
Sbjct  631  IYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEV  690

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER R
Sbjct  691  MREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGR  750

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  751  AFQLQCEAFHLNQRLQSMENQASTPRKPFHV  781



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+++ AL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++
Sbjct  625  IYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEV  684

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER R
Sbjct  685  MREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGR  744

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  745  AFQLQCEAFHLNQRLQSMENQASTPRKPFHV  775



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y  YE+++ AL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++
Sbjct  565  IYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEV  624

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            ++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER R
Sbjct  625  MREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGR  684

Query  177  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            AFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  685  AFQLQCEAFHLNQRLQSMENQASTPRKPFHV  715



>ref|XP_006855461.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
 gb|ERN16928.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
Length=692

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P   +Q YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKKL++++KE
Sbjct  539  PANSHQEYEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKKLSESLKE  598

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  187
            +++L EKLA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL STRG+L GE
Sbjct  599  MEVLSEKLAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQSTRGVLAGE  658

Query  186  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  659  RARAFQLQVEVFHLKQRLQSVENRAPTPRKPYHI  692



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   174 bits (442),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  555  YQLPIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  376
            +  P  +YQ YE ++ AL+RKNG+LEGQLAAALASREAA+K++SS LKS+Q+TEKKL D 
Sbjct  552  FSAPSSIYQLYETRMAALIRKNGMLEGQLAAALASREAAEKNVSSVLKSRQETEKKLVDT  611

Query  375  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  196
             KE++LLKEKL G+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L
Sbjct  612  GKELELLKEKLGGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGML  671

Query  195  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
              ERARAFQLQVEVFHLKQRLQSLENR  TPRKPF V
Sbjct  672  ANERARAFQLQVEVFHLKQRLQSLENRTATPRKPFQV  708



>ref|NP_001068393.1| Os11g0657000 [Oryza sativa Japonica Group]
 dbj|BAF28756.1| Os11g0657000, partial [Oryza sativa Japonica Group]
Length=530

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  384  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  443

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  444  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  503

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  504  QVEVFHLKQRLQTMEGRSPTPRKP  527



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  658

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  538  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  597

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  598  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  657

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFHV  85
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  658  QLEVFHLKQRLQTMEGRSPTPRKPLNL  684



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  544  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  603

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  604  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  663

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFHV  85
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  664  QLEVFHLKQRLQTMEGRSPTPRKPLNL  690



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LA+  +E++ LKEK+ G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQKEL
Sbjct  582  EKRLAERDREVEALKEKVTGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQKEL  641

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTRG+L GERARAFQLQVEVFHLKQR+Q++E R+PTPRKP
Sbjct  642  HSTRGVLAGERARAFQLQVEVFHLKQRVQTMEGRSPTPRKP  682



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  536  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  595

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  596  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  655

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  656  QVEVFHLKQRLPTMDGRSPTPRKP  679



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  539  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  598

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  659  QVEVFHLKQRLPTMDGRSPTPRKP  682



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LA+  +E++ L+EK  G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKEL
Sbjct  591  EKRLAEKDREVEALREKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKEL  650

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKP  94
            HSTRG+L GERARAFQLQVEVFHLKQRLQ++E R+P  PRKP
Sbjct  651  HSTRGVLAGERARAFQLQVEVFHLKQRLQTMEGRSPAAPRKP  692



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y +K+  L+R+N  LE QLAAALAS++ A+K+LS  + S++  EK+LA+  KE +LLKEK
Sbjct  547  YNSKITDLIRRNAALEDQLAAALASKDQAEKNLSLVINSREQLEKRLANKGKEAELLKEK  606

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            ++G+ELAQEE+N++SN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  607  ISGLELAQEESNNISNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  666

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ +E RA TPRKP
Sbjct  667  QVEVFHLKQRLQLVEGRAGTPRKP  690



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   150 bits (380),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  177  AFQLQV  160
            AFQLQ+
Sbjct  689  AFQLQL  694



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   150 bits (380),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  537  LYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  358
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  357  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  177  AFQLQV  160
            AFQLQ+
Sbjct  689  AFQLQL  694



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKDKEAEVLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P 
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQMVEGRAGTPKNPL  698



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LA   +E +LLKEK+AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+
Sbjct  587  EKRLASRGEEAELLKEKIAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEM  646

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTR  L GE++RAFQLQVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  647  HSTRRALAGEQSRAFQLQVEVFHLKQRLQTAEGRSLTPRKP  687



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LA   +E +LLKEK+AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+
Sbjct  587  EKRLASRGEEAELLKEKIAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEM  646

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTR  L GE++RAFQLQVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  647  HSTRRALAGEQSRAFQLQVEVFHLKQRLQTAEGRSLTPRKP  687



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score =   146 bits (369),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 93/149 (62%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  543  IGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  364
            +G    Y  K+  L+R+N  LE QLA ALAS++  DKSL+S + S+   EK LA+  KE 
Sbjct  539  VGQSHLYNTKIADLIRRNTTLEDQLATALASKDQLDKSLASVIHSRGQLEKMLANKDKEA  598

Query  363  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  184
            ++LKEK+A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV  +TQKELHSTR +L GE+
Sbjct  599  EMLKEKIACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTGETQKELHSTRRVLAGEQ  658

Query  183  ARAFQLQVEVFHLKQRLQSLENRAPTPRK  97
            +RAFQLQVEVFHLKQRLQ LE R+ TP K
Sbjct  659  SRAFQLQVEVFHLKQRLQILEGRSGTPNK  687



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>ref|XP_002442260.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
 gb|EES16098.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
Length=620

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+  L+R+N  LE QL+ ALAS++  +KSLSS + S++  EK LA+  KE ++LKEK
Sbjct  475  YNTKIADLIRRNTTLEDQLSTALASKDQLEKSLSSVIHSREQLEKMLANKDKEAEMLKEK  534

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++RAFQL
Sbjct  535  IACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLAGEQSRAFQL  594

Query  165  QVEVFHLKQRLQSLENRAPTPRK  97
            QVEVFHLKQRLQ LE R+ TP K
Sbjct  595  QVEVFHLKQRLQILEGRSGTPTK  617



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 22/123 (18%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LA+  +E++ L+EK  G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKEL
Sbjct  591  EKRLAEKDREVEALREKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKEL  650

Query  216  HSTRGLLGGERARAFQL---------------------QVEVFHLKQRLQSLENRAP-TP  103
            HSTRG+L GERARAFQL                     QVEVFHLKQRLQ++E R+P  P
Sbjct  651  HSTRGVLAGERARAFQLQVRPYHARLSFFFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAP  710

Query  102  RKP  94
            RKP
Sbjct  711  RKP  713



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 23/124 (19%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LA+  +E++ L+EK  G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKEL
Sbjct  591  EKRLAEKDREVEALREKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKEL  650

Query  216  HSTRGLLGGERARAFQL----------------------QVEVFHLKQRLQSLENRAP-T  106
            HSTRG+L GERARAFQL                      QVEVFHLKQRLQ++E R+P  
Sbjct  651  HSTRGVLAGERARAFQLQVRPYHARLSFFLFFCSCLGLCQVEVFHLKQRLQTMEGRSPAA  710

Query  105  PRKP  94
            PRKP
Sbjct  711  PRKP  714



>dbj|BAK00043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EKKLA+  +E+  LKEK+ G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQKEL
Sbjct  176  EKKLAERDREVVALKEKVGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQKEL  235

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            H TRG+L GERARAFQLQVEVFHLKQRLQS++  +   RKP
Sbjct  236  HLTRGVLAGERARAFQLQVEVFHLKQRLQSMDGLSSAQRKP  276



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  541  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  600

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  601  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  660

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFH  88
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  661  QVEVFHLKQRLQILEGRSGTPTKQPH  686



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  548  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  607

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  608  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  667

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFH  88
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  668  QVEVFHLKQRLQILEGRSGTPTKQPH  693



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE ++ AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE
Sbjct  563  PSSIYQFYETRMAALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKE  622

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  196
            ++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L
Sbjct  623  MELLKEKLAGIELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVL  679



>gb|EMT26901.1| hypothetical protein F775_29769 [Aegilops tauschii]
Length=612

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 27/131 (21%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            ++ E++LA+  +E+  LKEK+ G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQ
Sbjct  479  EELERRLAERDREVVALKEKVGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQ  538

Query  225  K---------------------------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  127
            K                           ELHSTRG+L GERARAFQLQVEVFHLKQRLQS
Sbjct  539  KAKNNNIPVISNCTSVYAVVLTILPPKQELHSTRGVLAGERARAFQLQVEVFHLKQRLQS  598

Query  126  LENRAPTPRKP  94
            ++ R+PT RKP
Sbjct  599  MDGRSPTQRKP  609



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score =   129 bits (325),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  522  EAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  162  VEVFHLK  142
            V  +H +
Sbjct  669  VRPYHAR  675



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score =   129 bits (325),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE
Sbjct  579  PSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKE  638

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            ++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  639  VELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKSL  688



>gb|KDO75103.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=342

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE
Sbjct  212  PSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKE  271

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  223
            ++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  272  MELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  319



>ref|XP_002975032.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
 gb|EFJ23817.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
Length=652

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  225  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  127
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>ref|XP_002977452.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
 gb|EFJ21456.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
Length=652

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  225  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  127
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score =   124 bits (312),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 112/167 (67%), Gaps = 27/167 (16%)
 Frame = -1

Query  531  QSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
              ++ K+  L+R+N  LE +L+AA+AS++ A+K+LS  + +K++ EK+LA+  +E+  LK
Sbjct  672  HQHDTKIANLVRRNMALEEKLSAAMASKDEAEKNLSLVIDTKEELEKRLAERDREVVALK  731

Query  351  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK-----------------  223
            EK+ G+E A E+ N+ SN VH+DNVRLE +VAFLKAV+D+TQK                 
Sbjct  732  EKVGGLEQAHEDLNNASNTVHADNVRLEREVAFLKAVMDETQKAKKIKIPVISHCTSVYA  791

Query  222  ----------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRA  112
                      E +STRG+L GERARAFQLQVEVFHLKQRLQS++ R 
Sbjct  792  VALTILPPKQEFYSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRG  838



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  +YQ YE ++ AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE
Sbjct  568  PSSIYQFYETRMAALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKE  627

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            ++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  628  MELLKEKLAGIELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKVL  677



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   116 bits (290),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 84/108 (78%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  546  PIGLYQSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  367
            P  + Q YE K+  L+RKN +LEGQLAAA ASREA +K+LSSALKSKQ+ EKKLA+ MK 
Sbjct  561  PSSVSQFYETKITQLIRKNAILEGQLAAAFASREAVEKNLSSALKSKQEMEKKLAEMMKG  620

Query  366  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  223
            ++LLKEKLAGVELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  621  MELLKEKLAGVELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQK  668


 Score = 31.2 bits (69),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 18/28 (64%), Gaps = 1/28 (4%)
 Frame = -3

Query  625  QGSGNFPLDSDDFVFQESDCKFG-ISAP  545
            QGS N P+DS D VF  +D K G + AP
Sbjct  534  QGSANLPVDSSDSVFPVNDIKLGSVPAP  561



>ref|XP_001759823.1| predicted protein [Physcomitrella patens]
 gb|EDQ75327.1| predicted protein [Physcomitrella patens]
Length=1020

 Score =   116 bits (291),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -1

Query  531  QSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
            QS+E KL A +R+    EGQL   L  +E A+  L+SAL+++Q TE KLA A+ +   +K
Sbjct  863  QSFEIKLAAAVRRGEQAEGQLTTVLRGKEEAENRLASALQTRQQTESKLAVALTKQAEIK  922

Query  351  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  172
            E +AG E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ERA++ 
Sbjct  923  EAVAGAERAQEDSNNLCNLVHSENLRLEHDLAFLKAVLEDTQKELDSTREALATERAKSS  982

Query  171  QLQVEVFHLKQRL  133
            QLQ+EVF+L +RL
Sbjct  983  QLQMEVFNLNKRL  995



>gb|EMT25879.1| hypothetical protein F775_10881 [Aegilops tauschii]
Length=758

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 19/144 (13%)
 Frame = -1

Query  525  YEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+  L+R+N  LE QLAAAL S+E A+K+LS  + S++  EK+LA   KE +LLKEK
Sbjct  631  YNTKITDLIRRNAALEDQLAAALESKEQAEKNLSLVMSSREQLEKRLASRGKEAELLKEK  690

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  691  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  731

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  732  QVEVFHLKQRLQTAEGRSGTPRKP  755



>gb|EMS62709.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=641

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 19/101 (19%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LA   K+ +LLKEK+AG+ELAQEE+NSLSN VH+DN                   E+
Sbjct  557  EKRLASRGKDAELLKEKIAGLELAQEESNSLSNAVHADN-------------------EM  597

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTR +L GE++R FQLQVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  598  HSTRRVLAGEQSRTFQLQVEVFHLKQRLQTAEGRSVTPRKP  638



>ref|XP_001760924.1| predicted protein [Physcomitrella patens]
 gb|EDQ74313.1| predicted protein, partial [Physcomitrella patens]
Length=617

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -1

Query  531  QSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
            QS+E KL A +R+  L EGQL+ AL  +E A+KSL  ALK++Q  E KLA ++K    LK
Sbjct  481  QSFEMKLAAAVRRGELAEGQLSTALKGKEEAEKSLQLALKTRQHAEGKLAASLKGQMDLK  540

Query  351  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  172
            E++A  E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQ EL STR LL  ER R+F
Sbjct  541  ERVAAAERAQEDSNNLCNVVHSENLRLEHDLAFLKAVLEDTQMELQSTRELLATERTRSF  600

Query  171  QLQVEVFHLKQRLQSL  124
             LQV V HL   L +L
Sbjct  601  NLQVTVDHLPPLLHAL  616



>ref|XP_001751751.1| predicted protein [Physcomitrella patens]
 gb|EDQ83186.1| predicted protein [Physcomitrella patens]
Length=1071

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = -1

Query  357   LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  178
             LKE +A  E AQE++N+L ++VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ER++
Sbjct  973   LKETVAAAERAQEDSNNLCSVVHSENLRLEHDLAFLKAVLEDTQKELDSTREGLVTERSK  1032

Query  177   AFQLQVEVFHLKQR-LQSLENRAPTP  103
             +F+LQ+E+F LK++ L SL     TP
Sbjct  1033  SFKLQMEIFDLKKKTLLSLSEEDATP  1058



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -1

Query  531  QSYEAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
              Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LK
Sbjct  543  HQYDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLK  602

Query  351  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  223
            EK+ G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  603  EKVTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQK  645



>ref|XP_001761501.1| predicted protein [Physcomitrella patens]
 gb|EDQ73569.1| predicted protein [Physcomitrella patens]
Length=230

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -1

Query  390  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  211
            KLA ++K    L+E+ A  + AQE++N+L N++H +N+RLEHD+AF KAVL+DTQK+L S
Sbjct  141  KLAASLKGRMDLEERSAAAKRAQEDSNNLRNVIHLENLRLEHDLAFFKAVLEDTQKDLQS  200

Query  210  TRGLLGGERARAFQLQVEVFHLKQRLQSL  124
             R L+  +R R+F LQ+ V HL   L +L
Sbjct  201  NRELIATKRTRSFNLQLTVDHLPFLLPAL  229



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -1

Query  522  EAKLXALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            + ++  L+R+N  LE QL+AALAS++ A+K+LS  + SK + EK+LA+  +E++ LKEK 
Sbjct  548  DTRITTLIRRNMALEEQLSAALASKDEAEKNLSLVIDSKDELEKRLAEKDREVEALKEKA  607

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  223
             G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  608  TGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQK  647



>emb|CDY02611.1| BnaC02g08240D [Brassica napus]
 emb|CDY02612.1| BnaC02g08230D [Brassica napus]
Length=63

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  297  IVHSDNVRLEHDVAFLKAVLDDTQKE--LHSTRGLLGGERARAFQLQV  160
            +VH DNVRLEHDVA +K VLDD Q++  LHSTRG+L GERAR FQLQV
Sbjct  1    MVHFDNVRLEHDVALVKYVLDDKQRKMFLHSTRGVLAGERARMFQLQV  48



>gb|ABR25493.1| rangap1 interacting protein [Oryza sativa Indica Group]
Length=40

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  204  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            G+L GER+RAFQLQVEVFHLKQRLQ++E R+PTPRKP
Sbjct  1    GVLAGERSRAFQLQVEVFHLKQRLQTMEGRSPTPRKP  37



>ref|XP_001765510.1| predicted protein [Physcomitrella patens]
 gb|EDQ69771.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 24/101 (24%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            Q  E K A ++K   + KE++A  E AQE++N+L N+VHS N+RLEHD AFLKAVL+DTQ
Sbjct  290  QHAEGKFAASLKA-QIEKERVAVAERAQEDSNNLCNVVHSGNLRLEHDFAFLKAVLEDTQ  348

Query  225  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  103
                                 +EVF LK++L       PTP
Sbjct  349  --------------------NMEVFDLKKKLLPT---IPTP  366



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -1

Query  222  ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            ELHSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  506  ELHSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125