BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006B12

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773275.1|  PREDICTED: hippocampus abundant transcript-l...    273   3e-86   Nicotiana sylvestris
ref|XP_009773274.1|  PREDICTED: hippocampus abundant transcript-l...    273   3e-85   Nicotiana sylvestris
ref|XP_006361454.1|  PREDICTED: hippocampus abundant transcript-l...    268   3e-83   Solanum tuberosum [potatoes]
ref|XP_010312533.1|  PREDICTED: hippocampus abundant transcript-l...    266   2e-82   
ref|XP_010067148.1|  PREDICTED: hippocampus abundant transcript-l...    265   3e-82   Eucalyptus grandis [rose gum]
emb|CDP20482.1|  unnamed protein product                                257   3e-79   Coffea canephora [robusta coffee]
ref|XP_007214409.1|  hypothetical protein PRUPE_ppa026350mg             256   5e-79   
ref|XP_008232010.1|  PREDICTED: hippocampus abundant transcript-l...    256   6e-79   Prunus mume [ume]
ref|XP_011469316.1|  PREDICTED: hippocampus abundant transcript-l...    254   7e-79   Fragaria vesca subsp. vesca
ref|XP_004308556.1|  PREDICTED: hippocampus abundant transcript-l...    254   5e-78   Fragaria vesca subsp. vesca
gb|KDP35836.1|  hypothetical protein JCGZ_10317                         254   5e-78   Jatropha curcas
ref|XP_010681374.1|  PREDICTED: hippocampus abundant transcript-l...    251   1e-77   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP20480.1|  unnamed protein product                                250   2e-77   Coffea canephora [robusta coffee]
ref|XP_006485218.1|  PREDICTED: hippocampus abundant transcript-l...    249   6e-77   Citrus sinensis [apfelsine]
ref|XP_006589383.1|  PREDICTED: hippocampus abundant transcript-l...    249   8e-77   Glycine max [soybeans]
ref|XP_010681373.1|  PREDICTED: hippocampus abundant transcript-l...    250   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681372.1|  PREDICTED: hippocampus abundant transcript-l...    250   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007010349.1|  Major facilitator superfamily protein isoform 3    248   2e-76   
ref|XP_011076925.1|  PREDICTED: hippocampus abundant transcript-l...    247   3e-76   
gb|KHN37831.1|  Hippocampus abundant transcript-like protein 1          248   7e-76   Glycine soja [wild soybean]
ref|XP_003535506.2|  PREDICTED: hippocampus abundant transcript-l...    249   8e-76   Glycine max [soybeans]
ref|XP_006436628.1|  hypothetical protein CICLE_v10031562mg             248   8e-76   Citrus clementina [clementine]
ref|XP_010032091.1|  PREDICTED: hippocampus abundant transcript-l...    245   2e-75   Eucalyptus grandis [rose gum]
ref|XP_011076924.1|  PREDICTED: hippocampus abundant transcript-l...    247   3e-75   Sesamum indicum [beniseed]
ref|XP_007010347.1|  Major facilitator superfamily protein isoform 1    247   2e-74   
ref|XP_010244469.1|  PREDICTED: hippocampus abundant transcript-l...    244   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010032090.1|  PREDICTED: hippocampus abundant transcript-l...    244   3e-74   Eucalyptus grandis [rose gum]
ref|XP_007143808.1|  hypothetical protein PHAVU_007G103300g             243   9e-74   Phaseolus vulgaris [French bean]
ref|XP_010032089.1|  PREDICTED: hippocampus abundant transcript-l...    244   9e-74   
ref|XP_002266084.1|  PREDICTED: hippocampus abundant transcript-l...    243   9e-74   Vitis vinifera
ref|XP_007143809.1|  hypothetical protein PHAVU_007G103300g             243   1e-73   Phaseolus vulgaris [French bean]
gb|KCW51480.1|  hypothetical protein EUGRSUZ_J00999                     244   2e-73   Eucalyptus grandis [rose gum]
ref|XP_010681370.1|  PREDICTED: hippocampus abundant transcript-l...    242   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007010348.1|  Major facilitator superfamily protein isoform 2    242   2e-73   
ref|XP_010681371.1|  PREDICTED: hippocampus abundant transcript-l...    242   3e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003591772.1|  Hippocampus abundant transcript-like protein       239   3e-72   Medicago truncatula
emb|CDO99890.1|  unnamed protein product                                230   4e-71   Coffea canephora [robusta coffee]
ref|XP_002524989.1|  Hippocampus abundant transcript 1 protein, p...    235   1e-70   Ricinus communis
gb|EYU19784.1|  hypothetical protein MIMGU_mgv1a006484mg                232   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_009594349.1|  PREDICTED: hippocampus abundant transcript-l...    230   5e-69   Nicotiana tomentosiformis
ref|XP_011024229.1|  PREDICTED: hippocampus abundant transcript-l...    226   5e-68   Populus euphratica
ref|XP_011032840.1|  PREDICTED: hippocampus abundant transcript-l...    224   3e-67   Populus euphratica
gb|AFK40263.1|  unknown                                                 226   4e-67   Medicago truncatula
ref|XP_003591771.1|  Hippocampus abundant transcript-like protein       226   4e-67   Medicago truncatula
gb|KCW51478.1|  hypothetical protein EUGRSUZ_J00997                     223   5e-67   Eucalyptus grandis [rose gum]
emb|CDO99892.1|  unnamed protein product                                219   6e-67   Coffea canephora [robusta coffee]
ref|XP_010032087.1|  PREDICTED: hippocampus abundant transcript-l...    223   6e-67   
ref|XP_011024228.1|  PREDICTED: hippocampus abundant transcript-l...    225   1e-66   Populus euphratica
ref|XP_010032085.1|  PREDICTED: hippocampus abundant transcript-l...    223   2e-66   
ref|XP_011032839.1|  PREDICTED: hippocampus abundant transcript-l...    223   5e-66   Populus euphratica
ref|XP_010032083.1|  PREDICTED: hippocampus abundant transcript-l...    221   3e-65   Eucalyptus grandis [rose gum]
ref|XP_004169983.1|  PREDICTED: hippocampus abundant transcript-l...    221   3e-65   
ref|XP_004140989.1|  PREDICTED: hippocampus abundant transcript-l...    221   4e-65   Cucumis sativus [cucumbers]
ref|XP_009416863.1|  PREDICTED: hippocampus abundant transcript-l...    219   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788255.1|  PREDICTED: hippocampus abundant transcript-l...    219   1e-64   Phoenix dactylifera
ref|XP_002311018.2|  hypothetical protein POPTR_0008s02280g             218   3e-64   
gb|KEH43442.1|  hippocampus abundant transcript-like protein            218   4e-64   Medicago truncatula
ref|XP_002315443.2|  hypothetical protein POPTR_0010s24380g             222   9e-64   
ref|XP_008456592.1|  PREDICTED: hippocampus abundant transcript-l...    217   9e-64   Cucumis melo [Oriental melon]
ref|XP_002524988.1|  Hippocampus abundant transcript 1 protein, p...    214   2e-62   
ref|XP_010907145.1|  PREDICTED: hippocampus abundant transcript-l...    214   2e-62   Elaeis guineensis
ref|XP_010312534.1|  PREDICTED: hippocampus abundant transcript-l...    211   3e-62   Solanum lycopersicum
ref|XP_006361453.1|  PREDICTED: hippocampus abundant transcript-l...    211   2e-61   Solanum tuberosum [potatoes]
ref|XP_004250476.1|  PREDICTED: hippocampus abundant transcript-l...    210   3e-61   Solanum lycopersicum
gb|EPS69092.1|  hypothetical protein M569_05672                         209   7e-61   Genlisea aurea
ref|XP_010088768.1|  Hippocampus abundant transcript-like protein 1     214   2e-60   
gb|KGN46030.1|  hypothetical protein Csa_6G045090                       207   4e-60   Cucumis sativus [cucumbers]
ref|XP_009407351.1|  PREDICTED: uncharacterized protein LOC103990...    203   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407349.1|  PREDICTED: hippocampus abundant transcript-l...    203   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006851495.1|  hypothetical protein AMTR_s00040p00148020          202   3e-58   
gb|KCW51477.1|  hypothetical protein EUGRSUZ_J00997                     202   7e-58   Eucalyptus grandis [rose gum]
ref|XP_002450280.1|  hypothetical protein SORBIDRAFT_05g003130          197   3e-56   
ref|XP_006662736.1|  PREDICTED: hippocampus abundant transcript-l...    195   4e-55   Oryza brachyantha
ref|XP_004978692.1|  PREDICTED: hippocampus abundant transcript-l...    194   9e-55   Setaria italica
ref|NP_001140664.1|  uncharacterized protein LOC100272739 precursor     193   1e-54   Zea mays [maize]
gb|EEE51661.1|  hypothetical protein OsJ_32986                          192   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|AAX94836.1|  Major Facilitator Superfamily, putative                 200   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67684.1|  hypothetical protein OsI_35133                          192   2e-54   Oryza sativa Indica Group [Indian rice]
ref|NP_001065767.2|  Os11g0151500                                       192   2e-54   
ref|XP_003577048.1|  PREDICTED: uncharacterized protein LOC100833620    187   4e-52   Brachypodium distachyon [annual false brome]
gb|KEH43443.1|  hippocampus abundant transcript-like protein            178   1e-49   Medicago truncatula
gb|KDO42036.1|  hypothetical protein CISIN_1g0164181mg                  170   4e-49   Citrus sinensis [apfelsine]
ref|XP_003577047.1|  PREDICTED: uncharacterized protein LOC100833312    178   9e-49   Brachypodium distachyon [annual false brome]
ref|XP_010032084.1|  PREDICTED: hippocampus abundant transcript-l...    174   1e-47   
gb|EMS64155.1|  Hippocampus abundant transcript-like protein 1          171   3e-46   Triticum urartu
ref|XP_010682914.1|  PREDICTED: hippocampus abundant transcript-l...    169   2e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT19766.1|  Hippocampus abundant transcript-like protein 1          167   3e-43   
gb|EPS63270.1|  hypothetical protein M569_11515                         148   7e-41   Genlisea aurea
emb|CAN74055.1|  hypothetical protein VITISV_026070                     156   1e-40   Vitis vinifera
ref|XP_002965935.1|  hypothetical protein SELMODRAFT_167756             147   3e-37   
ref|XP_004953398.1|  PREDICTED: hippocampus abundant transcript 1...    143   6e-36   Setaria italica
ref|NP_001047681.1|  Os02g0667500                                       136   3e-35   
gb|AFW72716.1|  hypothetical protein ZEAMMB73_747947                    140   6e-35   
ref|NP_001144256.1|  uncharacterized protein LOC100277128 precursor     140   6e-35   Zea mays [maize]
ref|XP_006648918.1|  PREDICTED: hippocampus abundant transcript 1...    138   5e-34   Oryza brachyantha
ref|XP_010266910.1|  PREDICTED: hippocampus abundant transcript 1...    137   6e-34   Nelumbo nucifera [Indian lotus]
ref|XP_002454504.1|  hypothetical protein SORBIDRAFT_04g032320          137   7e-34   Sorghum bicolor [broomcorn]
ref|XP_006655183.1|  PREDICTED: hippocampus abundant transcript 1...    137   1e-33   
ref|XP_011458696.1|  PREDICTED: uncharacterized protein LOC101295...    136   1e-33   Fragaria vesca subsp. vesca
ref|XP_008347370.1|  PREDICTED: hippocampus abundant transcript 1...    135   1e-33   
ref|XP_002968361.1|  hypothetical protein SELMODRAFT_169638             136   2e-33   
ref|XP_004290751.1|  PREDICTED: uncharacterized protein LOC101295...    136   3e-33   Fragaria vesca subsp. vesca
gb|EEE57537.1|  hypothetical protein OsJ_07859                          134   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008357148.1|  PREDICTED: hippocampus abundant transcript 1...    135   5e-33   
gb|EAY87003.1|  hypothetical protein OsI_08398                          135   5e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_009334544.1|  PREDICTED: uncharacterized protein LOC103927348    134   6e-33   
ref|XP_011083420.1|  PREDICTED: hippocampus abundant transcript 1...    133   2e-32   Sesamum indicum [beniseed]
gb|KCW68015.1|  hypothetical protein EUGRSUZ_F01701                     132   3e-32   Eucalyptus grandis [rose gum]
ref|XP_004291324.1|  PREDICTED: uncharacterized protein LOC101296167    132   4e-32   Fragaria vesca subsp. vesca
ref|XP_010061115.1|  PREDICTED: hippocampus abundant transcript-l...    132   4e-32   Eucalyptus grandis [rose gum]
ref|XP_003570066.1|  PREDICTED: hippocampus abundant transcript 1...    132   4e-32   Brachypodium distachyon [annual false brome]
ref|XP_008788273.1|  PREDICTED: hippocampus abundant transcript-l...    131   4e-32   
ref|XP_010061116.1|  PREDICTED: hippocampus abundant transcript-l...    132   5e-32   Eucalyptus grandis [rose gum]
ref|XP_008788264.1|  PREDICTED: hippocampus abundant transcript-l...    131   5e-32   
dbj|BAJ86597.1|  predicted protein                                      131   6e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008791950.1|  PREDICTED: hippocampus abundant transcript-l...    132   6e-32   Phoenix dactylifera
ref|XP_008387898.1|  PREDICTED: hippocampus abundant transcript 1...    131   9e-32   Malus domestica [apple tree]
emb|CDY02382.1|  BnaA02g22910D                                          131   1e-31   
ref|XP_011034953.1|  PREDICTED: uncharacterized protein LOC105132...    130   1e-31   Populus euphratica
ref|XP_010918153.1|  PREDICTED: hippocampus abundant transcript-l...    130   1e-31   Elaeis guineensis
gb|EYU17555.1|  hypothetical protein MIMGU_mgv1a006533mg                130   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_011003093.1|  PREDICTED: uncharacterized protein LOC105109921    130   2e-31   Populus euphratica
ref|XP_011034952.1|  PREDICTED: uncharacterized protein LOC105132...    130   2e-31   Populus euphratica
ref|XP_010918152.1|  PREDICTED: hippocampus abundant transcript-l...    130   2e-31   Elaeis guineensis
ref|XP_011034951.1|  PREDICTED: uncharacterized protein LOC105132...    130   2e-31   Populus euphratica
ref|XP_006422528.1|  hypothetical protein CICLE_v10028321mg             130   2e-31   Citrus clementina [clementine]
gb|KDO68185.1|  hypothetical protein CISIN_1g011514mg                   130   3e-31   Citrus sinensis [apfelsine]
ref|XP_006486681.1|  PREDICTED: hippocampus abundant transcript 1...    130   3e-31   Citrus sinensis [apfelsine]
ref|XP_004292638.2|  PREDICTED: uncharacterized protein LOC101306...    130   3e-31   Fragaria vesca subsp. vesca
ref|XP_007201037.1|  hypothetical protein PRUPE_ppa005784mg             130   3e-31   Prunus persica
ref|XP_003523261.1|  PREDICTED: hippocampus abundant transcript-l...    129   4e-31   Glycine max [soybeans]
ref|XP_006435264.1|  hypothetical protein CICLE_v10001166mg             129   5e-31   Citrus clementina [clementine]
gb|KHN20137.1|  Hippocampus abundant transcript-like protein 1          129   5e-31   Glycine soja [wild soybean]
ref|XP_010028772.1|  PREDICTED: uncharacterized protein LOC104418982    129   6e-31   Eucalyptus grandis [rose gum]
ref|XP_003527649.1|  PREDICTED: hippocampus abundant transcript-l...    129   8e-31   Glycine max [soybeans]
ref|XP_009400334.1|  PREDICTED: hippocampus abundant transcript-l...    129   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785091.1|  PREDICTED: hippocampus abundant transcript-l...    128   9e-31   Phoenix dactylifera
ref|XP_002306959.1|  hypothetical protein POPTR_0005s26720g             129   9e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010943478.1|  PREDICTED: hippocampus abundant transcript 1...    128   9e-31   Elaeis guineensis
ref|XP_008382447.1|  PREDICTED: hippocampus abundant transcript 1...    128   1e-30   
gb|KJB14353.1|  hypothetical protein B456_002G120900                    127   1e-30   Gossypium raimondii
gb|KCW55587.1|  hypothetical protein EUGRSUZ_I01458                     129   1e-30   Eucalyptus grandis [rose gum]
gb|KJB32683.1|  hypothetical protein B456_005G255500                    127   1e-30   Gossypium raimondii
ref|XP_007017916.1|  Major facilitator superfamily protein isoform 2    128   2e-30   Theobroma cacao [chocolate]
gb|EYU37985.1|  hypothetical protein MIMGU_mgv1a006613mg                128   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_004497200.1|  PREDICTED: hippocampus abundant transcript 1...    128   2e-30   Cicer arietinum [garbanzo]
ref|NP_199036.2|  major facilitator protein                             125   2e-30   
ref|XP_006386158.1|  hypothetical protein POPTR_0002s01760g             127   2e-30   Populus trichocarpa [western balsam poplar]
gb|KJB14351.1|  hypothetical protein B456_002G120900                    127   2e-30   Gossypium raimondii
ref|XP_007017915.1|  Major facilitator superfamily protein isoform 1    128   2e-30   
ref|XP_006342707.1|  PREDICTED: hippocampus abundant transcript-l...    127   2e-30   Solanum tuberosum [potatoes]
ref|XP_002301947.2|  hypothetical protein POPTR_0002s01760g             127   2e-30   
gb|KJB32681.1|  hypothetical protein B456_005G255500                    127   3e-30   Gossypium raimondii
gb|KJB32680.1|  hypothetical protein B456_005G255500                    127   3e-30   Gossypium raimondii
gb|KJB14354.1|  hypothetical protein B456_002G120900                    127   3e-30   Gossypium raimondii
ref|XP_002284761.1|  PREDICTED: hippocampus abundant transcript 1...    127   4e-30   Vitis vinifera
ref|XP_009124113.1|  PREDICTED: hippocampus abundant transcript-l...    127   4e-30   Brassica rapa
emb|CDY54428.1|  BnaCnng26960D                                          126   5e-30   Brassica napus [oilseed rape]
ref|XP_010539088.1|  PREDICTED: hippocampus abundant transcript-l...    126   5e-30   Tarenaya hassleriana [spider flower]
gb|KJB58029.1|  hypothetical protein B456_009G190900                    126   6e-30   Gossypium raimondii
emb|CBX25325.1|  hypothetical_protein                                   125   6e-30   Oryza brachyantha
ref|XP_008236069.1|  PREDICTED: hippocampus abundant transcript-l...    126   6e-30   Prunus mume [ume]
gb|KDP36870.1|  hypothetical protein JCGZ_08161                         125   7e-30   Jatropha curcas
ref|XP_009121175.1|  PREDICTED: uncharacterized protein LOC103846...    125   8e-30   Brassica rapa
emb|CDY12985.1|  BnaC02g29920D                                          126   1e-29   Brassica napus [oilseed rape]
ref|XP_009620054.1|  PREDICTED: uncharacterized protein LOC104111941    125   1e-29   Nicotiana tomentosiformis
ref|XP_009767684.1|  PREDICTED: uncharacterized protein LOC104218795    125   1e-29   Nicotiana sylvestris
gb|KDP33282.1|  hypothetical protein JCGZ_13069                         125   1e-29   Jatropha curcas
ref|XP_009121174.1|  PREDICTED: uncharacterized protein LOC103846...    125   2e-29   Brassica rapa
ref|XP_004500907.1|  PREDICTED: hippocampus abundant transcript-l...    125   2e-29   
ref|XP_011088646.1|  PREDICTED: hippocampus abundant transcript 1...    125   2e-29   Sesamum indicum [beniseed]
gb|KDO68186.1|  hypothetical protein CISIN_1g011514mg                   125   2e-29   Citrus sinensis [apfelsine]
ref|XP_007136127.1|  hypothetical protein PHAVU_009G020100g             125   2e-29   Phaseolus vulgaris [French bean]
ref|XP_009121172.1|  PREDICTED: uncharacterized protein LOC103846...    125   2e-29   Brassica rapa
ref|XP_002865558.1|  hypothetical protein ARALYDRAFT_917583             122   2e-29   
gb|KFK32943.1|  hypothetical protein AALP_AA6G309500                    124   2e-29   Arabis alpina [alpine rockcress]
ref|XP_006828835.1|  hypothetical protein AMTR_s00001p00146610          120   4e-29   
gb|KHG18467.1|  Hippocampus abundant transcript 1                       124   5e-29   Gossypium arboreum [tree cotton]
ref|XP_008445315.1|  PREDICTED: hippocampus abundant transcript-l...    123   5e-29   Cucumis melo [Oriental melon]
ref|XP_006280482.1|  hypothetical protein CARUB_v10026419mg             123   5e-29   Capsella rubella
ref|XP_003603840.1|  Hippocampus abundant transcript-like protein       123   6e-29   
gb|AES74091.2|  MFS transporter                                         123   6e-29   Medicago truncatula
gb|KEH44398.1|  MFS transporter                                         123   6e-29   Medicago truncatula
ref|XP_007017917.1|  Major facilitator superfamily protein isoform 3    123   7e-29   
ref|XP_010442182.1|  PREDICTED: hippocampus abundant transcript-l...    123   8e-29   Camelina sativa [gold-of-pleasure]
emb|CDY07888.1|  BnaC03g47340D                                          122   8e-29   Brassica napus [oilseed rape]
ref|NP_001151277.1|  tetracycline transporter protein                   120   1e-28   
ref|XP_004142991.1|  PREDICTED: hippocampus abundant transcript 1...    122   2e-28   Cucumis sativus [cucumbers]
gb|EYU37988.1|  hypothetical protein MIMGU_mgv1a006415mg                122   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_004144923.1|  PREDICTED: tetracycline resistance protein, ...    122   2e-28   Cucumis sativus [cucumbers]
ref|XP_007142795.1|  hypothetical protein PHAVU_007G017500g             122   2e-28   Phaseolus vulgaris [French bean]
gb|EYU37986.1|  hypothetical protein MIMGU_mgv1a006358mg                122   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_004253206.1|  PREDICTED: uncharacterized protein LOC101250386    122   2e-28   Solanum lycopersicum
ref|XP_009136358.1|  PREDICTED: uncharacterized protein LOC103860...    121   2e-28   Brassica rapa
gb|KHN11509.1|  Tetracycline resistance protein, class A                118   2e-28   Glycine soja [wild soybean]
ref|XP_010690317.1|  PREDICTED: hippocampus abundant transcript 1...    122   2e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73404.1|  hypothetical protein M569_01349                         122   2e-28   Genlisea aurea
ref|XP_009136351.1|  PREDICTED: uncharacterized protein LOC103860...    121   2e-28   Brassica rapa
ref|XP_009136353.1|  PREDICTED: uncharacterized protein LOC103860...    121   2e-28   
ref|XP_002510601.1|  tetracycline transporter, putative                 122   2e-28   Ricinus communis
emb|CDY02224.1|  BnaA03g39430D                                          122   2e-28   
gb|KJB15873.1|  hypothetical protein B456_002G200900                    122   2e-28   Gossypium raimondii
ref|XP_009136350.1|  PREDICTED: uncharacterized protein LOC103860...    121   2e-28   Brassica rapa
gb|KDP33281.1|  hypothetical protein JCGZ_13068                         121   3e-28   Jatropha curcas
ref|XP_007041737.1|  Major facilitator superfamily protein, putat...    121   3e-28   
ref|XP_009136349.1|  PREDICTED: uncharacterized protein LOC103860...    121   3e-28   Brassica rapa
ref|XP_011046630.1|  PREDICTED: hippocampus abundant transcript-l...    121   3e-28   Populus euphratica
ref|XP_004500909.1|  PREDICTED: hippocampus abundant transcript-l...    121   3e-28   
ref|XP_004500906.1|  PREDICTED: hippocampus abundant transcript-l...    121   4e-28   
ref|XP_010539087.1|  PREDICTED: hippocampus abundant transcript-l...    121   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_008445313.1|  PREDICTED: hippocampus abundant transcript 1...    120   5e-28   Cucumis melo [Oriental melon]
ref|XP_006409366.1|  hypothetical protein EUTSA_v10022689mg             120   6e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010494156.1|  PREDICTED: hippocampus abundant transcript-l...    120   6e-28   
ref|XP_006342087.1|  PREDICTED: hippocampus abundant transcript-l...    120   7e-28   Solanum tuberosum [potatoes]
ref|XP_004983781.1|  PREDICTED: hippocampus abundant transcript 1...    119   8e-28   
ref|XP_008447920.1|  PREDICTED: hippocampus abundant transcript 1...    120   9e-28   Cucumis melo [Oriental melon]
ref|XP_009124112.1|  PREDICTED: hippocampus abundant transcript-l...    119   9e-28   Brassica rapa
emb|CDY31390.1|  BnaA07g03250D                                          120   1e-27   Brassica napus [oilseed rape]
ref|XP_002313691.1|  hypothetical protein POPTR_0009s14090g             120   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_007222153.1|  hypothetical protein PRUPE_ppa005755mg             120   1e-27   
ref|XP_010467437.1|  PREDICTED: uncharacterized protein LOC104747497    119   1e-27   
ref|XP_002521243.1|  tetracycline transporter, putative                 119   1e-27   
ref|XP_002280708.1|  PREDICTED: hippocampus abundant transcript-l...    119   1e-27   Vitis vinifera
ref|XP_009124111.1|  PREDICTED: hippocampus abundant transcript-l...    119   2e-27   Brassica rapa
ref|XP_009124108.1|  PREDICTED: hippocampus abundant transcript-l...    119   2e-27   
ref|XP_010489312.1|  PREDICTED: uncharacterized protein LOC104767...    119   2e-27   
ref|XP_004983779.1|  PREDICTED: hippocampus abundant transcript 1...    119   2e-27   Setaria italica
gb|KHN37382.1|  Hippocampus abundant transcript 1 protein               119   2e-27   Glycine soja [wild soybean]
ref|XP_004238394.1|  PREDICTED: uncharacterized protein LOC101248671    119   2e-27   Solanum lycopersicum
ref|XP_003535759.1|  PREDICTED: hippocampus abundant transcript 1...    119   2e-27   Glycine max [soybeans]
ref|XP_010467445.1|  PREDICTED: uncharacterized protein LOC104747...    119   2e-27   
gb|EYU37987.1|  hypothetical protein MIMGU_mgv1a019548mg                119   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_010489311.1|  PREDICTED: uncharacterized protein LOC104767...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004143076.1|  PREDICTED: uncharacterized protein LOC101213676    120   4e-27   
ref|XP_010494154.1|  PREDICTED: hippocampus abundant transcript-l...    118   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009355593.1|  PREDICTED: hippocampus abundant transcript 1...    118   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_010467435.1|  PREDICTED: uncharacterized protein LOC104747...    118   5e-27   Camelina sativa [gold-of-pleasure]
gb|AFW72717.1|  hypothetical protein ZEAMMB73_747947                    118   5e-27   
gb|EYU40457.1|  hypothetical protein MIMGU_mgv1a021568mg                117   5e-27   Erythranthe guttata [common monkey flower]
ref|XP_008445314.1|  PREDICTED: hippocampus abundant transcript-l...    117   6e-27   Cucumis melo [Oriental melon]
ref|XP_010467431.1|  PREDICTED: uncharacterized protein LOC104747...    117   6e-27   
ref|XP_007041738.1|  Major facilitator superfamily protein, putat...    117   7e-27   
ref|XP_010467430.1|  PREDICTED: uncharacterized protein LOC104747...    117   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004161094.1|  PREDICTED: uncharacterized protein LOC101225919    120   8e-27   
gb|KHG11074.1|  Hippocampus abundant transcript 1                       117   9e-27   Gossypium arboreum [tree cotton]
ref|XP_003555206.1|  PREDICTED: hippocampus abundant transcript 1...    117   9e-27   Glycine max [soybeans]
ref|XP_008221200.1|  PREDICTED: hippocampus abundant transcript 1...    117   1e-26   Prunus mume [ume]
ref|XP_011088648.1|  PREDICTED: hippocampus abundant transcript-l...    116   1e-26   
ref|XP_010494158.1|  PREDICTED: hippocampus abundant transcript-l...    116   2e-26   
gb|EMS58246.1|  Tetracycline resistance protein, class A                117   2e-26   Triticum urartu
ref|XP_011088647.1|  PREDICTED: hippocampus abundant transcript 1...    116   2e-26   Sesamum indicum [beniseed]
ref|XP_002305536.2|  hypothetical protein POPTR_0004s18510g             115   2e-26   
ref|XP_010515758.1|  PREDICTED: uncharacterized protein LOC104791538    116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009112410.1|  PREDICTED: hippocampus abundant transcript 1...    115   2e-26   Brassica rapa
ref|NP_001130498.1|  tetracycline transporter protein                   116   3e-26   Zea mays [maize]
ref|XP_009112409.1|  PREDICTED: hippocampus abundant transcript 1...    115   3e-26   Brassica rapa
ref|XP_002862511.1|  predicted protein                                  112   4e-26   
gb|EMT20897.1|  Hippocampus abundant transcript 1 protein               115   4e-26   
ref|XP_010548123.1|  PREDICTED: uncharacterized protein LOC104819660    115   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_006299533.1|  hypothetical protein CARUB_v10015705mg             114   5e-26   
ref|XP_006297712.1|  hypothetical protein CARUB_v10013741mg             114   6e-26   Capsella rubella
ref|XP_006409364.1|  hypothetical protein EUTSA_v10022688mg             114   7e-26   Eutrema salsugineum [saltwater cress]
ref|XP_008668533.1|  PREDICTED: tetracycline transporter protein ...    115   7e-26   
ref|XP_002465000.1|  hypothetical protein SORBIDRAFT_01g030220          114   7e-26   Sorghum bicolor [broomcorn]
ref|XP_006299583.1|  hypothetical protein CARUB_v10015760mg             114   9e-26   
emb|CDY47483.1|  BnaA09g08920D                                          114   9e-26   Brassica napus [oilseed rape]
ref|NP_973476.1|  major facilitator protein                             114   1e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00204.1|  putative tetracycline transporter protein              114   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489313.1|  PREDICTED: uncharacterized protein LOC104767002    114   2e-25   Camelina sativa [gold-of-pleasure]
gb|EMT05362.1|  Hippocampus abundant transcript 1 protein               113   2e-25   
ref|XP_011458697.1|  PREDICTED: uncharacterized protein LOC101306...    113   2e-25   Fragaria vesca subsp. vesca
emb|CDY26792.1|  BnaC09g09190D                                          113   3e-25   Brassica napus [oilseed rape]
gb|KFK40086.1|  hypothetical protein AALP_AA3G328800                    115   3e-25   Arabis alpina [alpine rockcress]
gb|KFK40087.1|  hypothetical protein AALP_AA3G328800                    115   3e-25   Arabis alpina [alpine rockcress]
ref|XP_010494157.1|  PREDICTED: hippocampus abundant transcript-l...    112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006299476.1|  hypothetical protein CARUB_v10015641mg             112   3e-25   Capsella rubella
tpg|DAA46148.1|  TPA: hypothetical protein ZEAMMB73_581598              112   4e-25   
ref|XP_002865555.1|  hypothetical protein ARALYDRAFT_331182             112   5e-25   
gb|EEC78948.1|  hypothetical protein OsI_19397                          111   7e-25   Oryza sativa Indica Group [Indian rice]
gb|EEE63183.1|  hypothetical protein OsJ_17992                          111   7e-25   
ref|XP_004167746.1|  PREDICTED: hippocampus abundant transcript 1...    111   1e-24   
ref|XP_006422527.1|  hypothetical protein CICLE_v10028321mg             111   1e-24   
gb|KDO68183.1|  hypothetical protein CISIN_1g011514mg                   111   1e-24   
ref|XP_006297657.1|  hypothetical protein CARUB_v10013679mg             110   3e-24   
emb|CDP07341.1|  unnamed protein product                                109   4e-24   
ref|XP_009802650.1|  PREDICTED: hippocampus abundant transcript-l...    109   4e-24   
gb|KJB47709.1|  hypothetical protein B456_008G037600                    109   4e-24   
ref|XP_010482015.1|  PREDICTED: hippocampus abundant transcript 1...    109   4e-24   
gb|KHG05703.1|  Hippocampus abundant transcript-like protein 1          109   4e-24   
ref|XP_009802649.1|  PREDICTED: hippocampus abundant transcript-l...    109   4e-24   
gb|AAM15009.1|  putative tetracycline transporter protein               109   4e-24   
ref|XP_010467434.1|  PREDICTED: uncharacterized protein LOC104747...    108   6e-24   
ref|XP_009588093.1|  PREDICTED: hippocampus abundant transcript-l...    108   6e-24   
ref|NP_179289.4|  tetracycline transporter-like protein 1               108   6e-24   
ref|XP_009624104.1|  PREDICTED: solute carrier family 46 member 3...    108   7e-24   
ref|XP_002884030.1|  tetracycline transporter                           108   7e-24   
ref|XP_009776326.1|  PREDICTED: solute carrier family 46 member 3...    108   7e-24   
ref|XP_009588092.1|  PREDICTED: hippocampus abundant transcript-l...    108   9e-24   
ref|XP_010086842.1|  Hippocampus abundant transcript 1 protein          108   1e-23   
gb|KJB47711.1|  hypothetical protein B456_008G037600                    108   1e-23   
ref|XP_010467432.1|  PREDICTED: uncharacterized protein LOC104747...    108   1e-23   
ref|XP_010490360.1|  PREDICTED: uncharacterized protein LOC104768128    108   1e-23   
ref|XP_010100117.1|  Hippocampus abundant transcript 1 protein          107   2e-23   
ref|XP_009775454.1|  PREDICTED: hippocampus abundant transcript 1...    107   2e-23   
ref|XP_006360887.1|  PREDICTED: hippocampus abundant transcript-l...    107   3e-23   
ref|XP_004248636.1|  PREDICTED: hippocampus abundant transcript-l...    107   3e-23   
ref|XP_010515850.1|  PREDICTED: uncharacterized protein LOC104791...    106   4e-23   
ref|XP_010327393.1|  PREDICTED: uncharacterized protein LOC101267...    107   4e-23   
ref|XP_006364509.1|  PREDICTED: hippocampus abundant transcript-l...    106   7e-23   
ref|XP_010515842.1|  PREDICTED: hippocampus abundant transcript 1...    106   7e-23   
ref|XP_002884027.1|  hypothetical protein ARALYDRAFT_480580             106   7e-23   
ref|XP_010515790.1|  PREDICTED: uncharacterized protein LOC104791...    105   9e-23   
ref|XP_010467443.1|  PREDICTED: uncharacterized protein LOC104747...    105   1e-22   
ref|XP_010467438.1|  PREDICTED: uncharacterized protein LOC104747...    105   1e-22   
ref|XP_010515782.1|  PREDICTED: uncharacterized protein LOC104791...    105   1e-22   
ref|XP_011045660.1|  PREDICTED: hippocampus abundant transcript-l...    104   3e-22   
ref|XP_004500908.1|  PREDICTED: hippocampus abundant transcript-l...    103   6e-22   
gb|AAC64231.1|  putative tetracycline transporter protein               103   7e-22   
ref|XP_006486682.1|  PREDICTED: hippocampus abundant transcript 1...    102   1e-21   
ref|NP_179291.2|  major facilitator protein                             102   1e-21   
ref|XP_010482011.1|  PREDICTED: hippocampus abundant transcript 1...    102   1e-21   
gb|KDO84973.1|  hypothetical protein CISIN_1g013411mg                   100   5e-21   
gb|AAQ22617.1|  At2g16980                                             98.6    4e-20   
ref|XP_008348929.1|  PREDICTED: uncharacterized protein LOC103412...  94.0    5e-20   
ref|XP_004500910.1|  PREDICTED: hippocampus abundant transcript-l...  97.1    7e-20   
ref|XP_008358359.1|  PREDICTED: uncharacterized protein LOC103422103  90.1    1e-18   
ref|XP_009783816.1|  PREDICTED: hippocampus abundant transcript-l...  92.8    3e-18   
ref|XP_009617453.1|  PREDICTED: hippocampus abundant transcript 1...  92.8    3e-18   
ref|XP_009121173.1|  PREDICTED: uncharacterized protein LOC103846...  92.4    4e-18   
emb|CAN64703.1|  hypothetical protein VITISV_038996                   92.0    4e-18   
emb|CDP20481.1|  unnamed protein product                              87.0    6e-18   
gb|KGN62272.1|  hypothetical protein Csa_2G347110                     91.3    1e-17   
ref|XP_011458698.1|  PREDICTED: uncharacterized protein LOC101306...  91.3    1e-17   
ref|XP_010918154.1|  PREDICTED: uncharacterized protein LOC105042...  87.8    1e-16   
gb|KGN62274.1|  hypothetical protein Csa_2G347130                     86.7    1e-16   
ref|XP_009783815.1|  PREDICTED: hippocampus abundant transcript 1...  87.0    4e-16   
ref|XP_009617452.1|  PREDICTED: hippocampus abundant transcript 1...  87.0    4e-16   
ref|XP_010467439.1|  PREDICTED: uncharacterized protein LOC104747...  85.9    8e-16   
ref|NP_179290.3|  major facilitator protein                           85.9    8e-16   
ref|XP_004242975.1|  PREDICTED: hippocampus abundant transcript-l...  85.5    1e-15   
gb|KDO42035.1|  hypothetical protein CISIN_1g0164182mg                82.0    4e-15   
gb|KGN62271.1|  hypothetical protein Csa_2G347100                     83.2    5e-15   
ref|XP_011045668.1|  PREDICTED: hippocampus abundant transcript-l...  81.3    3e-14   
emb|CAN70291.1|  hypothetical protein VITISV_019346                   77.8    5e-13   
gb|KEH44396.1|  MFS transporter                                       74.7    4e-12   
gb|KJB58030.1|  hypothetical protein B456_009G190900                  74.7    5e-12   
ref|XP_006362772.1|  PREDICTED: uncharacterized protein LOC102586357  73.2    1e-11   
tpg|DAA46150.1|  TPA: hypothetical protein ZEAMMB73_581598            72.8    2e-11   
ref|XP_008447923.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
gb|KDO68187.1|  hypothetical protein CISIN_1g011514mg                 71.2    7e-11   
gb|KEH44397.1|  MFS transporter                                       70.9    9e-11   
ref|XP_009136357.1|  PREDICTED: uncharacterized protein LOC103860...  70.5    1e-10   
emb|CAH59449.1|  tetracycline transporter-like protein 1              64.7    5e-10   
ref|XP_008447922.1|  PREDICTED: hippocampus abundant transcript-l...  68.6    7e-10   
gb|EPS69924.1|  hypothetical protein M569_04837                       66.2    3e-09   
gb|KHN00908.1|  Glycine-rich RNA-binding protein 2, mitochondrial     66.6    4e-09   
ref|XP_010484915.1|  PREDICTED: uncharacterized protein LOC104763206  63.5    5e-09   
ref|XP_010467440.1|  PREDICTED: uncharacterized protein LOC104747...  64.7    1e-08   
ref|XP_010515798.1|  PREDICTED: uncharacterized protein LOC104791...  64.7    1e-08   
ref|XP_002884029.1|  predicted protein                                63.9    2e-08   
gb|KHG15483.1|  DNA replication and repair recF                       63.2    3e-08   
ref|XP_010467449.1|  PREDICTED: uncharacterized protein LOC104747...  63.2    4e-08   
ref|XP_010315397.1|  PREDICTED: hippocampus abundant transcript-l...  62.0    9e-08   
ref|XP_010315396.1|  PREDICTED: hippocampus abundant transcript-l...  61.6    1e-07   
ref|WP_040764789.1|  MFS transporter                                  60.8    2e-07   
gb|EMI21342.1|  tetracycline-efflux transporter                       60.8    3e-07   
ref|XP_004231065.1|  PREDICTED: hippocampus abundant transcript-l...  59.7    5e-07   
gb|KJB47710.1|  hypothetical protein B456_008G037600                  59.3    8e-07   
ref|XP_002179669.1|  predicted protein                                58.9    1e-06   
ref|WP_027841961.1|  hypothetical protein                             57.8    2e-06   
ref|WP_014075534.1|  MFS transporter                                  57.4    3e-06   
gb|KDP35841.1|  hypothetical protein JCGZ_10322                       56.6    4e-06   
ref|XP_006409365.1|  hypothetical protein EUTSA_v10022688mg           57.0    4e-06   
gb|KJB25475.1|  hypothetical protein B456_004G193600                  53.5    6e-06   
ref|WP_028758324.1|  MFS transporter                                  56.6    6e-06   
ref|WP_006338170.1|  Major facilitator superfamily MFS_1              56.6    7e-06   
ref|WP_043949533.1|  hypothetical protein                             56.6    7e-06   
ref|WP_008334823.1|  tetracycline resistance protein                  55.8    1e-05   
ref|XP_009043957.1|  hypothetical protein LOTGIDRAFT_228011           55.8    1e-05   
ref|WP_043919555.1|  MFS transporter                                  55.8    1e-05   
gb|ABI67313.1|  major facilitator superfamily MFS_1                   55.5    2e-05   
ref|WP_011454783.1|  MFS transporter                                  55.1    2e-05   
ref|WP_009098766.1|  tetracycline-efflux transporter                  54.7    3e-05   
ref|XP_003761376.1|  PREDICTED: hippocampus abundant transcript-l...  54.7    3e-05   
ref|WP_016554646.1|  transporter permease                             54.7    3e-05   
ref|WP_003593156.1|  MFS transporter                                  54.7    3e-05   
ref|XP_010467436.1|  PREDICTED: uncharacterized protein LOC104747...  53.9    5e-05   
ref|WP_029873333.1|  MFS transporter                                  53.1    9e-05   
gb|AAI68629.1|  Unknown (protein for MGC:186277)                      53.1    9e-05   
ref|WP_007824269.1|  MFS transporter                                  53.1    9e-05   
ref|NP_001135533.1|  uncharacterized protein LOC100216076             53.1    1e-04   
ref|WP_022714262.1|  MFS transporter                                  53.1    1e-04   
ref|WP_037099918.1|  MFS transporter                                  53.1    1e-04   
ref|WP_026792140.1|  hypothetical protein                             53.1    1e-04   
ref|XP_004983780.1|  PREDICTED: hippocampus abundant transcript 1...  52.8    1e-04   
ref|WP_008233484.1|  MFS transporter                                  52.8    1e-04   
ref|WP_037526116.1|  MFS transporter                                  52.8    1e-04   
ref|WP_040590283.1|  hypothetical protein                             52.8    1e-04   
ref|WP_033180221.1|  MFS transporter                                  52.8    1e-04   
ref|WP_031352361.1|  MFS transporter                                  52.8    1e-04   
ref|WP_006467271.1|  MFS transporter                                  52.8    1e-04   
ref|WP_025090515.1|  MULTISPECIES: MFS transporter                    52.8    1e-04   
gb|ERI13861.1|  MFS transporter                                       52.4    2e-04   
gb|ERM03595.1|  MFS transporter                                       52.4    2e-04   
ref|WP_039845444.1|  MFS transporter                                  52.4    2e-04   
ref|WP_013158570.1|  major facilitator superfamily protein            52.4    2e-04   
ref|WP_037058554.1|  MFS transporter                                  52.4    2e-04   
ref|WP_018467192.1|  hypothetical protein                             52.4    2e-04   
ref|WP_025290721.1|  MFS transporter                                  52.4    2e-04   
ref|WP_027892700.1|  MFS transporter                                  52.4    2e-04   
gb|ENY81121.1|  major facilitator superfamily transporter             52.4    2e-04   
ref|XP_004803163.1|  PREDICTED: hippocampus abundant transcript-l...  52.4    2e-04   
ref|WP_039017842.1|  MFS transporter                                  52.0    2e-04   
ref|WP_011118169.1|  MFS transporter                                  52.0    2e-04   
ref|WP_027664160.1|  MFS transporter                                  52.0    3e-04   
ref|WP_007329687.1|  MFS transporter                                  52.0    3e-04   
ref|WP_007331127.1|  MFS transporter                                  52.0    3e-04   
ref|XP_004766222.1|  PREDICTED: hippocampus abundant transcript-l...  52.0    3e-04   
ref|WP_014222643.1|  MFS transporter                                  51.6    3e-04   
ref|WP_036170230.1|  MFS transporter                                  51.6    3e-04   
ref|XP_006742552.1|  PREDICTED: hippocampus abundant transcript-l...  52.0    3e-04   
ref|WP_011909208.1|  MFS transporter                                  51.6    3e-04   
ref|WP_039747139.1|  MFS transporter                                  51.6    3e-04   
ref|WP_041638002.1|  MFS transporter                                  51.6    3e-04   
ref|WP_029964086.1|  MFS transporter                                  51.6    3e-04   
ref|WP_018495425.1|  MFS transporter                                  51.6    3e-04   
ref|XP_005616057.1|  PREDICTED: hippocampus abundant transcript-l...  51.6    3e-04   
ref|WP_029929093.1|  MULTISPECIES: MFS transporter                    51.6    3e-04   
gb|EMI26495.1|  tetracycline-efflux transporter                       51.6    4e-04   
ref|WP_029376060.1|  MFS transporter                                  51.2    4e-04   
ref|WP_018074027.1|  MFS transporter                                  51.2    4e-04   
ref|WP_037251597.1|  MFS transporter                                  51.2    4e-04   
ref|WP_018484577.1|  MFS transporter                                  51.2    4e-04   
ref|XP_007951192.1|  PREDICTED: hippocampus abundant transcript-l...  51.2    4e-04   
ref|WP_027683628.1|  MFS transporter                                  51.2    4e-04   
ref|WP_027508465.1|  MFS transporter                                  51.2    4e-04   
ref|XP_004393640.1|  PREDICTED: hippocampus abundant transcript-l...  51.2    5e-04   
ref|XP_004322713.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  50.8    5e-04   
ref|WP_002719408.1|  MFS transporter                                  50.8    5e-04   
ref|WP_018097681.1|  MFS transporter                                  50.8    5e-04   
gb|AIA11185.1|  Tetracycline_Resistance_MFS_Efflux_Pump               50.8    6e-04   
ref|WP_018897439.1|  MFS transporter                                  50.8    6e-04   
ref|WP_031528898.1|  MFS transporter                                  50.8    6e-04   
ref|XP_008155111.1|  PREDICTED: hippocampus abundant transcript-l...  50.8    6e-04   
ref|WP_024317066.1|  MULTISPECIES: MFS transporter                    50.8    6e-04   
ref|XP_533564.3|  PREDICTED: hippocampus abundant transcript-like...  50.8    6e-04   
ref|WP_007631171.1|  MFS transporter                                  50.8    6e-04   
ref|WP_024319568.1|  MFS transporter                                  50.8    6e-04   
ref|XP_007182462.1|  PREDICTED: hippocampus abundant transcript-l...  50.8    6e-04   
ref|XP_007182461.1|  PREDICTED: hippocampus abundant transcript-l...  50.4    6e-04   
ref|XP_007182460.1|  PREDICTED: hippocampus abundant transcript-l...  50.4    6e-04   
ref|WP_012758390.1|  MFS transporter                                  50.4    7e-04   
ref|XP_008591367.1|  PREDICTED: hippocampus abundant transcript-l...  50.4    7e-04   
ref|XP_008689077.1|  PREDICTED: hippocampus abundant transcript-l...  50.8    7e-04   
ref|XP_007529249.1|  PREDICTED: hippocampus abundant transcript-l...  50.8    7e-04   
ref|WP_004672783.1|  MFS transporter                                  50.4    7e-04   
ref|XP_003795084.1|  PREDICTED: hippocampus abundant transcript-l...  50.8    7e-04   
ref|XP_003468440.1|  PREDICTED: hippocampus abundant transcript-l...  50.8    7e-04   
ref|WP_012484611.1|  MULTISPECIES: MFS transporter                    50.4    7e-04   
ref|XP_004276872.1|  PREDICTED: hippocampus abundant transcript-l...  50.4    7e-04   
gb|ELW72272.1|  Hippocampus abundant transcript-like protein 1        50.4    7e-04   
gb|AIA15394.1|  Tetracycline_Resistance_MFS_Efflux_Pump               50.4    7e-04   
ref|XP_006140634.1|  PREDICTED: hippocampus abundant transcript-l...  50.4    7e-04   
ref|WP_012091700.1|  MFS transporter                                  50.4    7e-04   
ref|XP_007097412.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  50.4    8e-04   
ref|XP_008053481.1|  PREDICTED: hippocampus abundant transcript-l...  50.4    8e-04   
ref|XP_010124610.1|  PREDICTED: hippocampus abundant transcript-l...  49.3    8e-04   
ref|XP_001369811.2|  PREDICTED: hippocampus abundant transcript-l...  50.4    8e-04   
ref|XP_007462843.1|  PREDICTED: hippocampus abundant transcript-l...  50.4    8e-04   
ref|XP_007122354.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  50.4    9e-04   
ref|WP_039333420.1|  hypothetical protein                             50.1    9e-04   
emb|CBJ26362.1|  Hippocampus abundant transcript 1 protein (Putat...  50.4    9e-04   
gb|AIA15919.1|  Tetracycline_Resistance_MFS_Efflux_Pump               50.1    9e-04   
ref|WP_040482734.1|  MFS transporter                                  50.1    9e-04   
ref|WP_006200036.1|  MFS transporter                                  50.1    9e-04   
ref|WP_024899477.1|  MFS transporter                                  50.1    0.001   
ref|WP_039538591.1|  MFS transporter                                  50.1    0.001   
ref|XP_003995350.2|  PREDICTED: hippocampus abundant transcript-l...  50.1    0.001   



>ref|XP_009773275.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Nicotiana sylvestris]
Length=382

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+AFGF+KNQ SE+LM+VGVG+IVSQIVVLPL+NP  GEKVILC+ALL
Sbjct  192  MSGISSVLLYYLKSAFGFNKNQFSEILMMVGVGSIVSQIVVLPLINPLFGEKVILCMALL  251

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +SIAY++LYG AWA WVPYLS SFGVIYILV P+TYAVIS+A+ S DQGKAQGF+AGVQ+
Sbjct  252  SSIAYAMLYGLAWAPWVPYLSASFGVIYILVKPSTYAVISKAALSADQGKAQGFIAGVQS  311

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            +ASLLSPI M+PLT+WFLS +APF+CKGF I+CASLCMV++L  ACMLK++AP+KK+ ++
Sbjct  312  VASLLSPIVMSPLTSWFLSRDAPFNCKGFSILCASLCMVVSLYYACMLKVEAPSKKTFDE  371

Query  218  DAESIEAPLLS  186
            +AE+IEAPLL+
Sbjct  372  NAENIEAPLLA  382



>ref|XP_009773274.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Nicotiana sylvestris]
Length=441

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+AFGF+KNQ SE+LM+VGVG+IVSQIVVLPL+NP  GEKVILC+ALL
Sbjct  251  MSGISSVLLYYLKSAFGFNKNQFSEILMMVGVGSIVSQIVVLPLINPLFGEKVILCMALL  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +SIAY++LYG AWA WVPYLS SFGVIYILV P+TYAVIS+A+ S DQGKAQGF+AGVQ+
Sbjct  311  SSIAYAMLYGLAWAPWVPYLSASFGVIYILVKPSTYAVISKAALSADQGKAQGFIAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            +ASLLSPI M+PLT+WFLS +APF+CKGF I+CASLCMV++L  ACMLK++AP+KK+ ++
Sbjct  371  VASLLSPIVMSPLTSWFLSRDAPFNCKGFSILCASLCMVVSLYYACMLKVEAPSKKTFDE  430

Query  218  DAESIEAPLLS  186
            +AE+IEAPLL+
Sbjct  431  NAENIEAPLLA  441



>ref|XP_006361454.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=441

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLK+AFGF+KNQ SE+LM+VGVG+IVSQIVVLPL+NP  GEKVILC+ALL
Sbjct  251  MSGISGVLLYYLKSAFGFNKNQFSEILMMVGVGSIVSQIVVLPLINPLFGEKVILCMALL  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +SIAY++LYG AWA WVPYLS SFGVIYILV P+TYAVIS+A+ S DQGKAQGFVAG+Q+
Sbjct  311  SSIAYAMLYGLAWAPWVPYLSASFGVIYILVKPSTYAVISKAALSADQGKAQGFVAGIQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            +ASLLSPI M+PLT+WFLS +APF+CKGF I+CASLCMV++LC A  LK++AP +++ ++
Sbjct  371  VASLLSPIVMSPLTSWFLSRDAPFNCKGFSILCASLCMVVSLCYASTLKVEAPRERTFDE  430

Query  218  DAESIEAPLLS  186
            +AE+IEAPLL+
Sbjct  431  NAENIEAPLLT  441



>ref|XP_010312533.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Solanum 
lycopersicum]
Length=441

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLK+AFGF+KNQ SE+LM+VGVG+IVSQIVVLPL+NP  GEKVILC+ALL
Sbjct  251  MSGISGVLLYYLKSAFGFNKNQFSEILMMVGVGSIVSQIVVLPLINPLFGEKVILCLALL  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +SIAY++LYG AWA WVPYLS SFGVIYILV P+TYAVIS+A+ S DQGKAQGFVAG+Q+
Sbjct  311  SSIAYAMLYGLAWAPWVPYLSASFGVIYILVKPSTYAVISKAALSADQGKAQGFVAGIQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            +ASLLSPI M+PLT+WFLS +APF+CKGF I+CASLCMV++LC A  LK++AP +++ ++
Sbjct  371  VASLLSPIVMSPLTSWFLSRDAPFNCKGFSILCASLCMVVSLCYASTLKVEAPRERTFDE  430

Query  218  DAESIEAPLLS  186
             AE+IEAPLL+
Sbjct  431  IAENIEAPLLT  441



>ref|XP_010067148.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Eucalyptus 
grandis]
 gb|KCW65211.1| hypothetical protein EUGRSUZ_G02698 [Eucalyptus grandis]
Length=459

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKAAFG++KNQ SE+LM+VG+G+IVSQ+VVLPLV P VGEKVILC ALL
Sbjct  263  MSGISSVLLYYLKAAFGYNKNQFSEILMMVGIGSIVSQVVVLPLVIPLVGEKVILCAALL  322

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +SIAY+LLYGFAWA WVPYLS SFGVIYILV P+TYA+IS+AS+S DQGKAQGF+AGVQ+
Sbjct  323  SSIAYALLYGFAWAPWVPYLSASFGVIYILVKPSTYAIISKASTSADQGKAQGFIAGVQS  382

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WF+S +APFDCKGF I+CAS+CMVIALC ACMLK +   ++ + D
Sbjct  383  IASLLSPLAMSPLTSWFISKSAPFDCKGFSIVCASICMVIALCYACMLKPEESPRQDTPD  442

Query  218  DAESIEAPLL  189
              +++EAPLL
Sbjct  443  PEDNLEAPLL  452



>emb|CDP20482.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGID+VLL+YLKAAFGFDKNQ SE+LMVVGVG+I+SQ++VLP +NP VGEKVILC ALL
Sbjct  251  MSGIDSVLLYYLKAAFGFDKNQFSEILMVVGVGSIISQLLVLPSINPIVGEKVILCAALL  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +S+AY+LLYG AWAAWVPYL+ SFGV+ ILV PATYA+IS+ASSSTDQGK QGFVAGVQA
Sbjct  311  SSVAYALLYGLAWAAWVPYLAASFGVVNILVKPATYALISKASSSTDQGKTQGFVAGVQA  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+SLLSP+ MTPLT  FLS NAPF+CKGF ++CAS+ + I+L  A MLK + P+ ++SE+
Sbjct  371  ISSLLSPLAMTPLTNLFLSRNAPFNCKGFSLVCASISVAISLIFAWMLKRN-PSNQTSEN  429

Query  218  DAESIEAPLLS  186
            D E+IEAPLLS
Sbjct  430  DEENIEAPLLS  440



>ref|XP_007214409.1| hypothetical protein PRUPE_ppa026350mg [Prunus persica]
 gb|EMJ15608.1| hypothetical protein PRUPE_ppa026350mg [Prunus persica]
Length=436

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 163/191 (85%), Gaps = 7/191 (4%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKAAFGFDKNQ SE+LM+VG+G+I SQI+VLPL NP VGEKVIL  ALL
Sbjct  251  MSGISSVLLYYLKAAFGFDKNQFSEILMMVGIGSIFSQILVLPLANPLVGEKVILSSALL  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AWA WVPYLS SFGVIYILV P+T+A+ISRA+ ST+QGK QGF+AGVQ+
Sbjct  311  ASIAYALLYGLAWAPWVPYLSASFGVIYILVKPSTFAIISRATCSTNQGKVQGFIAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+SLLSP+ M+PLT+WFLS NAPF+CKGF IICAS+CM++A C AC LKL    ++SSED
Sbjct  371  ISSLLSPVAMSPLTSWFLSSNAPFNCKGFSIICASICMMVAFCIACKLKL---VERSSED  427

Query  218  DAESIEAPLLS  186
                IE PLL+
Sbjct  428  ----IETPLLT  434



>ref|XP_008232010.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Prunus 
mume]
Length=439

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 163/191 (85%), Gaps = 7/191 (4%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKAAFGFDKNQ SE+LM+VG+G+I SQI+VLPLVNP VGEKVIL  ALL
Sbjct  254  MSGISSVLLYYLKAAFGFDKNQFSEILMMVGIGSIFSQILVLPLVNPLVGEKVILSSALL  313

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AWA WVPYLS SFGVIY+LV P+T+A+ISRA+ ST+QGK QGF+AGVQ+
Sbjct  314  ASIAYALLYGLAWAPWVPYLSASFGVIYVLVKPSTFAIISRATCSTNQGKVQGFIAGVQS  373

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+SLLSP+ M+PLT+WFLS NAPF+CKGF IICAS+CM++A C AC LK   P ++S ED
Sbjct  374  ISSLLSPVAMSPLTSWFLSSNAPFNCKGFSIICASICMMVAFCIACKLK---PVERSPED  430

Query  218  DAESIEAPLLS  186
                IE PLL+
Sbjct  431  ----IETPLLT  437



>ref|XP_011469316.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=371

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 165/191 (86%), Gaps = 7/191 (4%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI AVLL+YLKA FGFDKNQ SE+ M+VG+G+IVSQ++VLPLVNP VGEKVILCI+L 
Sbjct  186  MSGISAVLLYYLKATFGFDKNQFSEIQMMVGIGSIVSQMLVLPLVNPLVGEKVILCISLC  245

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY++LYG AWA+WVPYLS SFGVIY+LV P+T+A+IS+ASS +DQGK QGF+AGVQ+
Sbjct  246  ASIAYAVLYGLAWASWVPYLSASFGVIYVLVKPSTFAIISKASSLSDQGKVQGFIAGVQS  305

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+SLLSPI M+PLT+WFLS NAPFDCKGF IICAS+CMVI+LC AC L  D+     S+D
Sbjct  306  ISSLLSPIAMSPLTSWFLSSNAPFDCKGFSIICASICMVISLCYACKLNPDS----CSKD  361

Query  218  DAESIEAPLLS  186
            DA   EAPLL+
Sbjct  362  DA---EAPLLT  369



>ref|XP_004308556.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=444

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 165/191 (86%), Gaps = 7/191 (4%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI AVLL+YLKA FGFDKNQ SE+ M+VG+G+IVSQ++VLPLVNP VGEKVILCI+L 
Sbjct  259  MSGISAVLLYYLKATFGFDKNQFSEIQMMVGIGSIVSQMLVLPLVNPLVGEKVILCISLC  318

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY++LYG AWA+WVPYLS SFGVIY+LV P+T+A+IS+ASS +DQGK QGF+AGVQ+
Sbjct  319  ASIAYAVLYGLAWASWVPYLSASFGVIYVLVKPSTFAIISKASSLSDQGKVQGFIAGVQS  378

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+SLLSPI M+PLT+WFLS NAPFDCKGF IICAS+CMVI+LC AC L  D+     S+D
Sbjct  379  ISSLLSPIAMSPLTSWFLSSNAPFDCKGFSIICASICMVISLCYACKLNPDS----CSKD  434

Query  218  DAESIEAPLLS  186
            DA   EAPLL+
Sbjct  435  DA---EAPLLT  442



>gb|KDP35836.1| hypothetical protein JCGZ_10317 [Jatropha curcas]
Length=444

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 164/191 (86%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI AVLL+YLK+ FGF KNQ SE+L++VG+G I SQIVVLPLVNP VGEKVILC++LL
Sbjct  255  MSGISAVLLYYLKSVFGFSKNQYSEILLMVGIGEIFSQIVVLPLVNPLVGEKVILCLSLL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ LYG AWA+WVPY+S SFG IY+LV PATYA+IS+ASSS +QGKAQGFVAGVQ+
Sbjct  315  ASIAYAFLYGLAWASWVPYMSASFGAIYVLVKPATYAIISKASSSMNQGKAQGFVAGVQS  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WFLS N PF+CKGF II ASLC+++ALC AC+L+ +    +SSE+
Sbjct  375  IASLLSPLAMSPLTSWFLSSNPPFNCKGFSIIVASLCIIVALCYACLLQPEQHEPRSSEE  434

Query  218  DAESIEAPLLS  186
            D   +EAPLLS
Sbjct  435  D---MEAPLLS  442



>ref|XP_010681374.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=375

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKAAFGF+KNQ SE+LMVVGVG+I+SQI +LPL+NP VGEK ILC ALL
Sbjct  185  MSGISYVLLYYLKAAFGFNKNQFSEILMVVGVGSIISQIWMLPLINPLVGEKAILCGALL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YGFAWA WVPYLS SFGVIY+LV P+TYA+IS+ SS TDQGKAQGFVAGVQ+
Sbjct  245  ASIAYALFYGFAWAYWVPYLSASFGVIYVLVKPSTYAIISKGSSPTDQGKAQGFVAGVQS  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLT+WFLS+NAPFDCKGF IIC+SL +++AL  A   + ++  +   +D
Sbjct  305  IASFLSPLVMSPLTSWFLSENAPFDCKGFSIICSSLSLIVALIIALGSRFESKYEDKHQD  364

Query  218  DAESIEAPLLS  186
            D + +E+PLLS
Sbjct  365  DLDKLESPLLS  375



>emb|CDP20480.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKAAFGFDKNQ SE+LMVVGVG+I+SQ++V P +NP VGEKVILC ALL
Sbjct  184  MSGIATVLLYYLKAAFGFDKNQFSEILMVVGVGSIISQLLVFPSINPIVGEKVILCAALL  243

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +S+A  LLYG AWAAWVPYL+ S GV+ +LV PATYA+IS+ASSSTDQGK QGFVAGVQA
Sbjct  244  SSVADVLLYGLAWAAWVPYLAASMGVVNVLVKPATYALISQASSSTDQGKTQGFVAGVQA  303

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ MTPLT  FLS NAPF+CKGF ++CAS+ + I+L  A MLK + P+ ++SE+
Sbjct  304  IASLLSPLAMTPLTNLFLSRNAPFNCKGFSLVCASISVAISLVFAWMLKRN-PSNQTSEN  362

Query  218  DAESIEAPLLS  186
            D E+IEAPLLS
Sbjct  363  DEENIEAPLLS  373



>ref|XP_006485218.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Citrus sinensis]
 ref|XP_006485219.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X3 [Citrus sinensis]
Length=374

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 164/191 (86%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI AVLL YLKA FGF+KNQ SE+LM+VG+G+IVSQI+VLPL+NPFVGEKVILC+ALL
Sbjct  185  MSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVGEKVILCVALL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASI Y+L YG AWA+WVPYLS +FGVIY+LV P+TYA+IS+AS   +QGKAQGF+AGV++
Sbjct  245  ASIVYALFYGLAWASWVPYLSAAFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVKS  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+SLLSP+ M+PLT+WFLS +APF+CKGF II AS+C++++LCCACML  +   + S+ D
Sbjct  305  ISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLCCACMLDTE---ENSTND  361

Query  218  DAESIEAPLLS  186
            +   +E PL+S
Sbjct  362  ERGDLEEPLIS  372



>ref|XP_006589383.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Glycine max]
Length=375

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQ+++LP++NP VGEKVILC ALL
Sbjct  185  MSGISSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQMLLLPILNPLVGEKVILCSALL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ LYG AWA WVPYLS SFG+IY+LV PATYA+IS ASSST+QGKAQ F+AG Q+
Sbjct  245  ASIAYAWLYGLAWAPWVPYLSASFGIIYVLVKPATYAIISNASSSTNQGKAQTFIAGTQS  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+WFLS NAPF+CKGF IICAS+CM+I+LC AC+LK   PA  SS +
Sbjct  305  ISDLLSPIAMSPLTSWFLSSNAPFECKGFSIICASICMIISLCFACLLK---PADTSSSN  361

Query  218  DAE-SIEAPLLS  186
            D E S E PLL+
Sbjct  362  DIEGSQETPLLT  373



>ref|XP_010681373.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKAAFGF+KNQ SE+LMVVGVG+I+SQI +LPL+NP VGEK ILC ALL
Sbjct  245  MSGISYVLLYYLKAAFGFNKNQFSEILMVVGVGSIISQIWMLPLINPLVGEKAILCGALL  304

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YGFAWA WVPYLS SFGVIY+LV P+TYA+IS+ SS TDQGKAQGFVAGVQ+
Sbjct  305  ASIAYALFYGFAWAYWVPYLSASFGVIYVLVKPSTYAIISKGSSPTDQGKAQGFVAGVQS  364

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLT+WFLS+NAPFDCKGF IIC+SL +++AL  A   + ++  +   +D
Sbjct  365  IASFLSPLVMSPLTSWFLSENAPFDCKGFSIICSSLSLIVALIIALGSRFESKYEDKHQD  424

Query  218  DAESIEAPLLS  186
            D + +E+PLLS
Sbjct  425  DLDKLESPLLS  435



>ref|XP_010681372.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKAAFGF+KNQ SE+LMVVGVG+I+SQI +LPL+NP VGEK ILC ALL
Sbjct  255  MSGISYVLLYYLKAAFGFNKNQFSEILMVVGVGSIISQIWMLPLINPLVGEKAILCGALL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YGFAWA WVPYLS SFGVIY+LV P+TYA+IS+ SS TDQGKAQGFVAGVQ+
Sbjct  315  ASIAYALFYGFAWAYWVPYLSASFGVIYVLVKPSTYAIISKGSSPTDQGKAQGFVAGVQS  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLT+WFLS+NAPFDCKGF IIC+SL +++AL  A   + ++  +   +D
Sbjct  375  IASFLSPLVMSPLTSWFLSENAPFDCKGFSIICSSLSLIVALIIALGSRFESKYEDKHQD  434

Query  218  DAESIEAPLLS  186
            D + +E+PLLS
Sbjct  435  DLDKLESPLLS  445



>ref|XP_007010349.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 ref|XP_007010350.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY19159.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY19160.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=374

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 161/190 (85%), Gaps = 3/190 (2%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            SGI ++LL+YLKAAFGFDK+Q SE+LM+VG+G+I SQI+VLPL+NP VGEKVILCIALLA
Sbjct  186  SGITSILLYYLKAAFGFDKDQFSEILMMVGIGSIASQILVLPLINPLVGEKVILCIALLA  245

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            SIAY+L  G AWA WVPYL  SFGVIY+LV P+TYA+IS+ASS TDQG  QGF+AGVQA+
Sbjct  246  SIAYALFNGLAWAPWVPYLGASFGVIYVLVKPSTYAIISKASSVTDQGTVQGFIAGVQAM  305

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            ASLLSP+ M+PLT+WFLS NAPF+CKGF II AS+C+VI+LC AC+L+   P + S ++ 
Sbjct  306  ASLLSPLAMSPLTSWFLSSNAPFNCKGFSIIVASICLVISLCFACLLQ---PGENSIQET  362

Query  215  AESIEAPLLS  186
             E +EA LLS
Sbjct  363  EEDMEASLLS  372



>ref|XP_011076925.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011076926.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Sesamum indicum]
Length=375

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+ FGF+KNQLSE+LM+VGVG+I SQ++VLPL+NP VGEK+ILC  LL
Sbjct  185  MSGISSVLLYYLKSVFGFNKNQLSEILMMVGVGSIFSQMLVLPLLNPLVGEKLILCAGLL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG AWA WVPYLS SFGVIYILV P+TYAVIS+AS+S DQGKAQGF+AGVQ+
Sbjct  245  ASIAYGLLYGLAWAPWVPYLSASFGVIYILVKPSTYAVISKASNSADQGKAQGFIAGVQS  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLTTWFLS NAPF+CKGF II AS+ MVI+LCCA  LKLD P  K+ ED
Sbjct  305  IASLLSPLAMSPLTTWFLSSNAPFNCKGFSIIFASISMVISLCCAWTLKLDVPTNKNVED  364

Query  218  DAESIEAPLLS  186
              E IE PLLS
Sbjct  365  TREDIETPLLS  375



>gb|KHN37831.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=442

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQ+++LP++NP VGEKVILC ALL
Sbjct  252  MSGISSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQMLLLPILNPLVGEKVILCSALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ LYG AWA WVPYLS SFG+IY+LV PATYA+IS ASSST+QGKAQ F+AG Q+
Sbjct  312  ASIAYAWLYGLAWAPWVPYLSASFGIIYVLVKPATYAIISNASSSTNQGKAQTFIAGTQS  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+WFLS NAPF+CKGF IICAS+CM+I+LC AC+LK   PA  SS +
Sbjct  372  ISDLLSPIAMSPLTSWFLSSNAPFECKGFSIICASICMIISLCFACLLK---PADTSSSN  428

Query  218  DAE-SIEAPLLS  186
            D E S E PLL+
Sbjct  429  DIEGSQETPLLT  440



>ref|XP_003535506.2| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Glycine max]
Length=450

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQ+++LP++NP VGEKVILC ALL
Sbjct  260  MSGISSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQMLLLPILNPLVGEKVILCSALL  319

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ LYG AWA WVPYLS SFG+IY+LV PATYA+IS ASSST+QGKAQ F+AG Q+
Sbjct  320  ASIAYAWLYGLAWAPWVPYLSASFGIIYVLVKPATYAIISNASSSTNQGKAQTFIAGTQS  379

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+WFLS NAPF+CKGF IICAS+CM+I+LC AC+LK   PA  SS +
Sbjct  380  ISDLLSPIAMSPLTSWFLSSNAPFECKGFSIICASICMIISLCFACLLK---PADTSSSN  436

Query  218  DAE-SIEAPLLS  186
            D E S E PLL+
Sbjct  437  DIEGSQETPLLT  448



>ref|XP_006436628.1| hypothetical protein CICLE_v10031562mg [Citrus clementina]
 ref|XP_006485217.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Citrus sinensis]
 gb|ESR49868.1| hypothetical protein CICLE_v10031562mg [Citrus clementina]
Length=439

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 164/191 (86%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI AVLL YLKA FGF+KNQ SE+LM+VG+G+IVSQI+VLPL+NPFVGEKVILC+ALL
Sbjct  250  MSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVGEKVILCVALL  309

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASI Y+L YG AWA+WVPYLS +FGVIY+LV P+TYA+IS+AS   +QGKAQGF+AGV++
Sbjct  310  ASIVYALFYGLAWASWVPYLSAAFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVKS  369

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+SLLSP+ M+PLT+WFLS +APF+CKGF II AS+C++++LCCACML  +   + S+ D
Sbjct  370  ISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLCCACMLDTE---ENSTND  426

Query  218  DAESIEAPLLS  186
            +   +E PL+S
Sbjct  427  ERGDLEEPLIS  437



>ref|XP_010032091.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
Length=380

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQI+VLPLVNP VGEKVILC+ LL
Sbjct  185  MTGISNVLLYYLEAAFGFTKNQYSEILIVVEAGSIVSQILVLPLVNPLVGEKVILCVGLL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+ASSS DQGKAQGF+AG+QA
Sbjct  245  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISKASSSADQGKAQGFIAGIQA  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK-LDAPAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CA++CMV++   AC+LK  D  ++ S +
Sbjct  305  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQ  364

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  365  DNIEDQEAPLL  375



>ref|XP_011076924.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Sesamum indicum]
Length=436

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+ FGF+KNQLSE+LM+VGVG+I SQ++VLPL+NP VGEK+ILC  LL
Sbjct  246  MSGISSVLLYYLKSVFGFNKNQLSEILMMVGVGSIFSQMLVLPLLNPLVGEKLILCAGLL  305

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG AWA WVPYLS SFGVIYILV P+TYAVIS+AS+S DQGKAQGF+AGVQ+
Sbjct  306  ASIAYGLLYGLAWAPWVPYLSASFGVIYILVKPSTYAVISKASNSADQGKAQGFIAGVQS  365

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLTTWFLS NAPF+CKGF II AS+ MVI+LCCA  LKLD P  K+ ED
Sbjct  366  IASLLSPLAMSPLTTWFLSSNAPFNCKGFSIIFASISMVISLCCAWTLKLDVPTNKNVED  425

Query  218  DAESIEAPLLS  186
              E IE PLLS
Sbjct  426  TREDIETPLLS  436



>ref|XP_007010347.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY19157.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=509

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 161/190 (85%), Gaps = 3/190 (2%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            SGI ++LL+YLKAAFGFDK+Q SE+LM+VG+G+I SQI+VLPL+NP VGEKVILCIALLA
Sbjct  321  SGITSILLYYLKAAFGFDKDQFSEILMMVGIGSIASQILVLPLINPLVGEKVILCIALLA  380

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            SIAY+L  G AWA WVPYL  SFGVIY+LV P+TYA+IS+ASS TDQG  QGF+AGVQA+
Sbjct  381  SIAYALFNGLAWAPWVPYLGASFGVIYVLVKPSTYAIISKASSVTDQGTVQGFIAGVQAM  440

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            ASLLSP+ M+PLT+WFLS NAPF+CKGF II AS+C+VI+LC AC+L+   P + S ++ 
Sbjct  441  ASLLSPLAMSPLTSWFLSSNAPFNCKGFSIIVASICLVISLCFACLLQ---PGENSIQET  497

Query  215  AESIEAPLLS  186
             E +EA LLS
Sbjct  498  EEDMEASLLS  507



>ref|XP_010244469.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nelumbo 
nucifera]
Length=443

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 164/193 (85%), Gaps = 2/193 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+ FGF KNQ SE+LM+VG+G+IVSQI VLPL NP +GE+ ILCIALL
Sbjct  251  MSGISSVLLYYLKSVFGFSKNQFSEILMMVGIGSIVSQIFVLPLANPVLGERKILCIALL  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AWA WVPYLS SFGVIY+LV P+TYAVIS+A+SS DQ KAQGF+AGVQ+
Sbjct  311  ASIAYALLYGLAWAPWVPYLSASFGVIYVLVKPSTYAVISKATSSVDQAKAQGFIAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA--PAKKSS  225
            IASL+SPI M+PLT+WFLS  APF+CKGF +I AS+ MVIALC A + K DA  P+   +
Sbjct  371  IASLISPIIMSPLTSWFLSSKAPFNCKGFSLIFASVSMVIALCYAWLFKEDAARPSNCEA  430

Query  224  EDDAESIEAPLLS  186
            ED++E+IEAPLLS
Sbjct  431  EDNSETIEAPLLS  443



>ref|XP_010032090.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=450

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQI+VLPLVNP VGEKVILC+ LL
Sbjct  255  MTGISNVLLYYLEAAFGFTKNQYSEILIVVEAGSIVSQILVLPLVNPLVGEKVILCVGLL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+ASSS DQGKAQGF+AG+QA
Sbjct  315  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISKASSSADQGKAQGFIAGIQA  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK-LDAPAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CA++CMV++   AC+LK  D  ++ S +
Sbjct  375  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQ  434

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  435  DNIEDQEAPLL  445



>ref|XP_007143808.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
 gb|ESW15802.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
Length=448

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQ+++LP++NP VGEKVILC ALL
Sbjct  259  MSGISSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQMLLLPILNPLVGEKVILCSALL  318

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ LYG AWA WVPYLS SFG+IY+LV PATYA+IS A+SST+QGKAQ F+AG Q+
Sbjct  319  ASIAYAWLYGLAWAPWVPYLSASFGIIYVLVKPATYAIISNATSSTNQGKAQTFIAGAQS  378

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+WFLS NAPF+CKGF I+CAS+CM+I+LC AC+LK   P    S D
Sbjct  379  ISDLLSPIAMSPLTSWFLSSNAPFECKGFSIVCASICMIISLCLACILK---PDSNWSND  435

Query  218  DAESIEAPLLS  186
               S E PLL+
Sbjct  436  IEGSTETPLLN  446



>ref|XP_010032089.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
Length=500

 Score =   244 bits (624),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQI+VLPLVNP VGEKVILC+ LL
Sbjct  305  MTGISNVLLYYLEAAFGFTKNQYSEILIVVEAGSIVSQILVLPLVNPLVGEKVILCVGLL  364

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+ASSS DQGKAQGF+AG+QA
Sbjct  365  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISKASSSADQGKAQGFIAGIQA  424

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK-LDAPAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CA++CMV++   AC+LK  D  ++ S +
Sbjct  425  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQ  484

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  485  DNIEDQEAPLL  495



>ref|XP_002266084.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Vitis 
vinifera]
 emb|CBI35249.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKAAFGF+KNQLSE+LM+VG+G+I SQ+++LPL+NP VGEK+ILC ALL
Sbjct  245  MSGISGVLLYYLKAAFGFNKNQLSEILMMVGIGSIFSQMLILPLINPLVGEKLILCTALL  304

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WVPYLS SFGV+Y+LV P+TYA+IS+ASSS++QGKAQGF+AG+Q+
Sbjct  305  ASIAYALFYGLAWASWVPYLSASFGVVYVLVKPSTYAIISKASSSSNQGKAQGFIAGIQS  364

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            +ASLLSP+ M+PLT+WFLS NAPF CKGF I+CASLCM+IALC A  LK D PA     +
Sbjct  365  VASLLSPLAMSPLTSWFLSSNAPFKCKGFSIVCASLCMMIALCYAVFLKQDEPANDELNN  424

Query  218  DAESIEAPLLS  186
            + + +EA LLS
Sbjct  425  NIDDMEAALLS  435



>ref|XP_007143809.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
 gb|ESW15803.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
Length=448

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQ+++LP++NP VGEKVILC ALL
Sbjct  259  MSGISSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQMLLLPILNPLVGEKVILCSALL  318

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ LYG AWA WVPYLS SFG+IY+LV PATYA+IS A+SST+QGKAQ F+AG Q+
Sbjct  319  ASIAYAWLYGLAWAPWVPYLSASFGIIYVLVKPATYAIISNATSSTNQGKAQTFIAGAQS  378

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+WFLS NAPF+CKGF I+CAS+CM+I+LC AC+LK   P    S D
Sbjct  379  ISDLLSPIAMSPLTSWFLSSNAPFECKGFSIVCASICMIISLCLACILK---PDSNWSND  435

Query  218  DAESIEAPLLS  186
               S E PLL+
Sbjct  436  IEGSTETPLLN  446



>gb|KCW51480.1| hypothetical protein EUGRSUZ_J00999 [Eucalyptus grandis]
Length=523

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQI+VLPLVNP VGEKVILC+ LL
Sbjct  328  MTGISNVLLYYLEAAFGFTKNQYSEILIVVEAGSIVSQILVLPLVNPLVGEKVILCVGLL  387

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+ASSS DQGKAQGF+AG+QA
Sbjct  388  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISKASSSADQGKAQGFIAGIQA  447

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK-LDAPAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CA++CMV++   AC+LK  D  ++ S +
Sbjct  448  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQ  507

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  508  DNIEDQEAPLL  518



>ref|XP_010681370.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKAAFGF+KNQ SE+LMVVG G+I+SQI+VLPL+NP VGEKVILC ALL
Sbjct  255  MSGISSVLLYYLKAAFGFNKNQFSEILMVVGSGSIISQILVLPLLNPLVGEKVILCAALL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YGFAWA WVPYLS SFGVIY+LV PATYA+IS+ SSS+DQGKAQGF+AGVQ+
Sbjct  315  ASIAYALFYGFAWAYWVPYLSASFGVIYVLVKPATYAIISKGSSSSDQGKAQGFIAGVQS  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WFLS++APFDCKGF I+C+SL MV+AL  A   + ++ ++   +D
Sbjct  375  IASLLSPLAMSPLTSWFLSEDAPFDCKGFSIVCSSLSMVVALIIALGSRFESQSEHKHKD  434

Query  218  DAESIEAPLLS  186
            D +SIEAPLLS
Sbjct  435  DLDSIEAPLLS  445



>ref|XP_007010348.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY19158.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=447

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 161/191 (84%), Gaps = 4/191 (2%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            SGI ++LL+YLKAAFGFDK+Q SE+LM+VG+G+I SQI+VLPL+NP VGEKVILCIALLA
Sbjct  258  SGITSILLYYLKAAFGFDKDQFSEILMMVGIGSIASQILVLPLINPLVGEKVILCIALLA  317

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQ-GKAQGFVAGVQA  399
            SIAY+L  G AWA WVPYL  SFGVIY+LV P+TYA+IS+ASS TDQ G  QGF+AGVQA
Sbjct  318  SIAYALFNGLAWAPWVPYLGASFGVIYVLVKPSTYAIISKASSVTDQQGTVQGFIAGVQA  377

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            +ASLLSP+ M+PLT+WFLS NAPF+CKGF II AS+C+VI+LC AC+L+   P + S ++
Sbjct  378  MASLLSPLAMSPLTSWFLSSNAPFNCKGFSIIVASICLVISLCFACLLQ---PGENSIQE  434

Query  218  DAESIEAPLLS  186
              E +EA LLS
Sbjct  435  TEEDMEASLLS  445



>ref|XP_010681371.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKAAFGFDKNQ+SE++MVVG  +I+SQI+VLPL+NP VG+KVILC+ALL
Sbjct  255  MSGIVSVLLYYLKAAFGFDKNQISEIMMVVGAASIISQILVLPLINPLVGDKVILCVALL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIA++L YG AWA WVPYLS SFG+I++LV P+TYA+IS+ SSS DQGKAQGFVAGVQ+
Sbjct  315  ASIAFALFYGLAWAHWVPYLSASFGIIFVLVKPSTYAIISKGSSSDDQGKAQGFVAGVQS  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+ FLS++APFDCKGF I+C+S  +++AL  A   + ++  K   +D
Sbjct  375  IASLLSPLAMSPLTSLFLSEDAPFDCKGFSIVCSSFSLMVALIIALGSRFESHFKNEQKD  434

Query  218  DAESIEAPLLS  186
            D  +IE+PLLS
Sbjct  435  DLATIESPLLS  445



>ref|XP_003591772.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
 gb|AES62023.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=441

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQIV+LP++NP VGEKVILC ALL
Sbjct  252  MSGITTVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVLLPILNPLVGEKVILCSALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ L G AWA WVPYLS SFG+IY+LV PATYA+ISRASSST+QGKAQ F+AG Q+
Sbjct  312  ASIAYAWLSGLAWAPWVPYLSASFGIIYVLVKPATYAIISRASSSTNQGKAQTFIAGAQS  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+ FLS +APF+CKGF I+CAS+CM+I+L  ACML  + P   SS D
Sbjct  372  ISDLLSPIVMSPLTSLFLSSDAPFECKGFSILCASVCMMISLIFACMLNPNTP---SSYD  428

Query  218  DAESIEAPLLS  186
              ++IE PLL+
Sbjct  429  LEDNIEDPLLN  439



>emb|CDO99890.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 153/191 (80%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSG+++ LL+YLKAAFGFDKNQ SE+LMVVGVG+I+SQ++VLP++ P VGE V+LC A +
Sbjct  63   MSGVNSTLLYYLKAAFGFDKNQFSEILMVVGVGSIISQLLVLPIITPLVGEHVVLCAACI  122

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +S  Y+LLYG AWA WVPY + S GV+ +LV P+++A+IS+A+SSTDQGKAQGF+  VQ+
Sbjct  123  SSAVYALLYGLAWAPWVPYFTASLGVVNVLVKPSSFALISKAASSTDQGKAQGFILAVQS  182

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IA LLSP+ MTPLT  FLS NAPFDCKGF  +CAS  + I+LC A MLK +  + + SE 
Sbjct  183  IAILLSPLAMTPLTNLFLSKNAPFDCKGFSFVCASFAVAISLCFASMLKPNT-SNQPSEV  241

Query  218  DAESIEAPLLS  186
            DAE+ EAP LS
Sbjct  242  DAENAEAPFLS  252



>ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
 gb|EEF37396.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
Length=443

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 4/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI+AVLL YLK+ FGF+KNQ SE+L++VG+G I SQI++LPLVNP VGEKVILC+ALL
Sbjct  255  MSGINAVLLFYLKSVFGFNKNQYSEILLMVGIGEIFSQILLLPLVNPLVGEKVILCLALL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+  YG AWA+WVPYLS SFG I++LVTP+TYA+IS+ASSS +QGKAQGFVAGVQ+
Sbjct  315  ASIAYAFFYGLAWASWVPYLSASFGAIFVLVTPSTYAIISKASSSMNQGKAQGFVAGVQS  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WFLS NAPFDCKGF II ASLCM++A C ACMLK +   K   ED
Sbjct  375  IASLLSPLAMSPLTSWFLSSNAPFDCKGFSIIVASLCMMVAFCYACMLKPEQETKNLEED  434

Query  218  DAESIEAPLLS  186
                IEAPL++
Sbjct  435  ----IEAPLIT  441



>gb|EYU19784.1| hypothetical protein MIMGU_mgv1a006484mg [Erythranthe guttata]
Length=442

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 4/192 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLK+AFGF+KNQLSE+LM+VGVG+I SQ+++LPL+NP +GEK+ILC ALL
Sbjct  254  MSGISGVLLYYLKSAFGFNKNQLSEILMMVGVGSIFSQMLLLPLLNPLIGEKLILCAALL  313

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY L YG AWA+WVPYLS SFGVIY+LV P+TYAVIS+ S+S +QGKAQGFVAGVQ+
Sbjct  314  ASIAYGLFYGLAWASWVPYLSASFGVIYVLVKPSTYAVISKGSTSANQGKAQGFVAGVQS  373

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKL-DAPAKKSSE  222
            IASLLSP+ M+PLTTWFLS NAPFDCKGF II ASL MV++ C AC L L DAP  K   
Sbjct  374  IASLLSPLAMSPLTTWFLSSNAPFDCKGFSIIFASLSMVVSFCFACTLNLEDAPPTKKGL  433

Query  221  DDAESIEAPLLS  186
            +D   IE PLLS
Sbjct  434  ED---IETPLLS  442



>ref|XP_009594349.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+AFGF+KNQ SE+LM+VGVG+IVSQI+VLPL+NP  GEKVIL +ALL
Sbjct  251  MSGISSVLLYYLKSAFGFNKNQFSEILMMVGVGSIVSQILVLPLINPLFGEKVILSMALL  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +SIAY++LYG AWA WVPYLS SFGVIYILV P+TYAVIS+++ S DQGKAQGFVAGVQ+
Sbjct  311  SSIAYAMLYGLAWAPWVPYLSASFGVIYILVKPSTYAVISKSALSADQGKAQGFVAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMV  282
            +ASLLSPI M+PLT+WFLS +APF+CKGF I+CASLCMV
Sbjct  371  VASLLSPIVMSPLTSWFLSRDAPFNCKGFSILCASLCMV  409



>ref|XP_011024229.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=374

 Score =   226 bits (576),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL YLKA FGF+KNQ SE+L VVG+GAI SQI+VLPL++P VGE VILC+ALL
Sbjct  185  MSGISSVLLFYLKAVFGFNKNQYSEILSVVGIGAIFSQILVLPLLSPLVGEGVILCLALL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG  WA+WVPYLS +FG IY+LV P TYAVIS+ SSS +QGK QGF+AGVQ+
Sbjct  245  ASIAYGLLYGLVWASWVPYLSAAFGAIYVLVKPVTYAVISKGSSSVNQGKVQGFIAGVQS  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WFLS +APF+CKGF II AS+ M+IALC AC+LK   PA+KS  D
Sbjct  305  IASLLSPLAMSPLTSWFLSSDAPFNCKGFSIIVASVSMMIALCFACLLK---PAEKSGHD  361

Query  218  DAESIEAPLL  189
              E IEAPLL
Sbjct  362  PEEEIEAPLL  371



>ref|XP_011032840.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=374

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL YLKA FGF+KNQ SE+L +VG+GAI SQI+VLPL+NP VGE  IL +ALL
Sbjct  185  MSGISSVLLFYLKAVFGFNKNQYSEILSMVGIGAIFSQILVLPLLNPLVGEGGILSLALL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG AWA+WVPYLS SFG IYILV PATYA+IS+ SSS +QGK QGFVAGVQ+
Sbjct  245  ASIAYGLLYGLAWASWVPYLSASFGAIYILVKPATYAIISKGSSSMNQGKTQGFVAGVQS  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLTTWFLS  APFDCKGF II AS+ M+IALC AC+LK   P +K S D
Sbjct  305  IASFLSPLAMSPLTTWFLSSTAPFDCKGFSIIVASVSMMIALCFACLLK---PDEKLSHD  361

Query  218  DAESIEAPLL  189
              + IEAPLL
Sbjct  362  PEDEIEAPLL  371



>gb|AFK40263.1| unknown [Medicago truncatula]
Length=442

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 155/192 (81%), Gaps = 4/192 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI +VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQIV+LP++NP VGEKVILC ALL
Sbjct  252  MTGIHSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVLLPILNPLVGEKVILCSALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ L G AWA WVPYL  SFG+IYIL  PATY +IS+ASSST+QGKAQ F+AG  +
Sbjct  312  ASIAYAWLSGLAWAPWVPYLGGSFGIIYILEKPATYGIISKASSSTNQGKAQTFIAGANS  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+ FLS +APF+CKGF IICAS+CM+I+L  ACML    P   S +D
Sbjct  372  ISGLLSPIVMSPLTSLFLSSDAPFECKGFSIICASVCMIISLIFACMLN---PNTGSRDD  428

Query  218  DAE-SIEAPLLS  186
            D E + + PLL+
Sbjct  429  DLEGNQQDPLLN  440



>ref|XP_003591771.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
 gb|AES62022.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=442

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 155/192 (81%), Gaps = 4/192 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI +VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQIV+LP++NP VGEKVILC ALL
Sbjct  252  MTGIHSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVLLPILNPLVGEKVILCSALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ L G AWA WVPYL  SFG+IYIL  PATY +IS+ASSST+QGKAQ F+AG  +
Sbjct  312  ASIAYAWLSGLAWAPWVPYLGGSFGIIYILEKPATYGIISKASSSTNQGKAQTFIAGANS  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I+ LLSPI M+PLT+ FLS +APF+CKGF IICAS+CM+I+L  ACML    P   S +D
Sbjct  372  ISGLLSPIVMSPLTSLFLSSDAPFECKGFSIICASVCMIISLIFACMLN---PNTGSRDD  428

Query  218  DAE-SIEAPLLS  186
            D E + + PLL+
Sbjct  429  DLEGNQQDPLLN  440



>gb|KCW51478.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=348

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQ++VLPLVNP VGEKV+LCI L+
Sbjct  153  MTGISNVLLYYLEAAFGFTKNQFSEILIVVEAGSIVSQLLVLPLVNPLVGEKVVLCIGLV  212

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+AS S DQGKAQGF+AG+QA
Sbjct  213  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISQASRSADQGKAQGFIAGIQA  272

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA-PAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CAS+CMV++   AC+LK +   ++ S +
Sbjct  273  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQ  332

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  333  DNIEEQEAPLL  343



>emb|CDO99892.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 152/191 (80%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSG  + LL+YLKAAFGFDKNQ SE+LMVV +GA++SQ++VLP++ P VGEK+ILC ALL
Sbjct  63   MSGATSTLLYYLKAAFGFDKNQFSEILMVVDIGAVISQLLVLPIITPLVGEKLILCAALL  122

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ++  Y+LL+G AWA WV Y   +FGV+ +LV P+++A+IS+A+SSTDQGKAQG + GVQ+
Sbjct  123  SNAVYALLFGLAWAPWVTYFIAAFGVVNVLVRPSSFALISKAASSTDQGKAQGIILGVQS  182

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
             +SLLSP+ MTPLT  FLS +APF+CKGF  +CASL + IALC A MLK +  +KK  E 
Sbjct  183  FSSLLSPLAMTPLTNLFLSRDAPFNCKGFSFVCASLSVAIALCFAFMLKPNT-SKKPLEV  241

Query  218  DAESIEAPLLS  186
            DAE  +APLLS
Sbjct  242  DAEHNKAPLLS  252



>ref|XP_010032087.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Eucalyptus grandis]
 ref|XP_010032088.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Eucalyptus grandis]
Length=361

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQ++VLPLVNP VGEKV+LCI L+
Sbjct  166  MTGISNVLLYYLEAAFGFTKNQFSEILIVVEAGSIVSQLLVLPLVNPLVGEKVVLCIGLV  225

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+AS S DQGKAQGF+AG+QA
Sbjct  226  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISQASRSADQGKAQGFIAGIQA  285

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA-PAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CAS+CMV++   AC+LK +   ++ S +
Sbjct  286  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQ  345

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  346  DNIEEQEAPLL  356



>ref|XP_011024228.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=456

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL YLKA FGF+KNQ SE+L VVG+GAI SQI+VLPL++P VGE VILC+ALL
Sbjct  267  MSGISSVLLFYLKAVFGFNKNQYSEILSVVGIGAIFSQILVLPLLSPLVGEGVILCLALL  326

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG  WA+WVPYLS +FG IY+LV P TYAVIS+ SSS +QGK QGF+AGVQ+
Sbjct  327  ASIAYGLLYGLVWASWVPYLSAAFGAIYVLVKPVTYAVISKGSSSVNQGKVQGFIAGVQS  386

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WFLS +APF+CKGF II AS+ M+IALC AC+LK   PA+KS  D
Sbjct  387  IASLLSPLAMSPLTSWFLSSDAPFNCKGFSIIVASVSMMIALCFACLLK---PAEKSGHD  443

Query  218  DAESIEAPLL  189
              E IEAPLL
Sbjct  444  PEEEIEAPLL  453



>ref|XP_010032085.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
 ref|XP_010032086.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
Length=380

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQ++VLPLVNP VGEKV+LCI L+
Sbjct  185  MTGISNVLLYYLEAAFGFTKNQFSEILIVVEAGSIVSQLLVLPLVNPLVGEKVVLCIGLV  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+AS S DQGKAQGF+AG+QA
Sbjct  245  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISQASRSADQGKAQGFIAGIQA  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA-PAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CAS+CMV++   AC+LK +   ++ S +
Sbjct  305  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQ  364

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  365  DNIEEQEAPLL  375



>ref|XP_011032839.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=444

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL YLKA FGF+KNQ SE+L +VG+GAI SQI+VLPL+NP VGE  IL +ALL
Sbjct  255  MSGISSVLLFYLKAVFGFNKNQYSEILSMVGIGAIFSQILVLPLLNPLVGEGGILSLALL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG AWA+WVPYLS SFG IYILV PATYA+IS+ SSS +QGK QGFVAGVQ+
Sbjct  315  ASIAYGLLYGLAWASWVPYLSASFGAIYILVKPATYAIISKGSSSMNQGKTQGFVAGVQS  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLTTWFLS  APFDCKGF II AS+ M+IALC AC+LK   P +K S D
Sbjct  375  IASFLSPLAMSPLTTWFLSSTAPFDCKGFSIIVASVSMMIALCFACLLK---PDEKLSHD  431

Query  218  DAESIEAPLL  189
              + IEAPLL
Sbjct  432  PEDEIEAPLL  441



>ref|XP_010032083.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW51476.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=450

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQ++VLPLVNP VGEKV+LCI L+
Sbjct  255  MTGISNVLLYYLEAAFGFTKNQFSEILIVVEAGSIVSQLLVLPLVNPLVGEKVVLCIGLV  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+AS S DQGKAQGF+AG+QA
Sbjct  315  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISQASRSADQGKAQGFIAGIQA  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA-PAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I+CAS+CMV++   AC+LK +   ++ S +
Sbjct  375  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQ  434

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  435  DNIEEQEAPLL  445



>ref|XP_004169983.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Cucumis sativus]
Length=444

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VL+ YLKA FGFDKNQ SE+LM+VG+G+I +Q++VLPL+NP +GE+ ILC+ +L
Sbjct  255  MTGITNVLMFYLKAVFGFDKNQNSEILMLVGIGSIFTQMLVLPLINPLIGEEAILCLGIL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY+L YG AWAAWV YL+ SF VIY+L  PA YA++S+ASSS++QGKAQGFVAGV++
Sbjct  315  ASVAYALFYGLAWAAWVAYLAASFKVIYVLARPAIYAIVSKASSSSNQGKAQGFVAGVES  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLT+WF+S +APFDCKGF I+CAS+C+VI+L   C L L A    S ED
Sbjct  375  IASFLSPLVMSPLTSWFISSDAPFDCKGFSIVCASICLVISLWHGCCL-LKAKEHGSKED  433

Query  218  DAESIEAPLLS  186
            D    E PLL+
Sbjct  434  DDP--EEPLLN  442



>ref|XP_004140989.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Cucumis sativus]
Length=444

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VL+ YLKA FGFDKNQ SE+LM+VG+G+I +Q++VLPL+NP +GE+ ILC+ +L
Sbjct  255  MTGITNVLMFYLKAVFGFDKNQNSEILMLVGIGSIFTQMLVLPLINPLIGEEAILCLGIL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY+L YG AWAAWV YL+ SF VIY+L  PA YA++S+ASSS++QGKAQGFVAGV++
Sbjct  315  ASVAYALFYGLAWAAWVAYLAASFKVIYVLARPAIYAIVSKASSSSNQGKAQGFVAGVES  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLT+WF+S +APFDCKGF I+CAS+C+VI+L   C L L A    S ED
Sbjct  375  IASFLSPLVMSPLTSWFISSDAPFDCKGFSIVCASICLVISLWHGCCL-LKAKEHGSKED  433

Query  218  DAESIEAPLLS  186
            D    E PLL+
Sbjct  434  DDP--EEPLLN  442



>ref|XP_009416863.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 158/195 (81%), Gaps = 4/195 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+AFGF+KNQ SE+L++V  G+I SQI+VLPL+NP +GEK +L IAL 
Sbjct  251  MSGISSVLLYYLKSAFGFNKNQFSEILLMVSFGSIFSQILVLPLINPLMGEKGVLLIALG  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY +LYG AWA WVPYLS SFGVIY+LV P+TYA+IS+A+ S+DQGKAQG +AGVQ+
Sbjct  311  ASIAYGMLYGLAWAPWVPYLSASFGVIYVLVKPSTYAIISKAAISSDQGKAQGLIAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAK----K  231
            +AS LSP+ M+PLT+ F+S  APF+CKGF I+ AS+ ++I+L  AC+L  + P K    +
Sbjct  371  VASFLSPLVMSPLTSLFISGKAPFNCKGFSILVASVSLIISLAHACLLNSENPDKPPEHE  430

Query  230  SSEDDAESIEAPLLS  186
            +S+   E++EAPLL+
Sbjct  431  TSQCGDETVEAPLLA  445



>ref|XP_008788255.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008779093.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Phoenix dactylifera]
Length=447

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 155/194 (80%), Gaps = 4/194 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLK+ FGF KNQ SE+LM+VG+G++ SQI+VLP++NP +GEK +LCIAL 
Sbjct  251  MSGISGVLLYYLKSVFGFSKNQFSEILMMVGIGSVFSQILVLPVINPLIGEKGVLCIALA  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            A IAY+LLYG AWA WVPYLS SFGVIY+L  P+TYA++S+A+ S DQGKAQGF+AGVQ+
Sbjct  311  AKIAYALLYGLAWAPWVPYLSASFGVIYVLAKPSTYAIVSKAAISMDQGKAQGFIAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAK----K  231
            IAS L+P+ M+PLT+ F+S  APF+CKGF I+ AS+ ++++L  A +L  D P K    +
Sbjct  371  IASFLAPMVMSPLTSLFISSKAPFNCKGFSILLASISLMLSLAHALLLNPDNPEKPPDFE  430

Query  230  SSEDDAESIEAPLL  189
            +++   ESIEAPLL
Sbjct  431  TTQTSDESIEAPLL  444



>ref|XP_002311018.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa]
 gb|EEE88385.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa]
Length=444

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL YLKA FGF+KNQ SE+L +VG+GAI SQI+VLPL+NP VG+  IL +A+L
Sbjct  255  MSGISSVLLFYLKAVFGFNKNQYSEILSMVGIGAIFSQILVLPLLNPLVGDGGILSLAIL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG AWA+WVPYLS SFG IYILV PATYA+IS+ S S +QGK QGFVAGVQ+
Sbjct  315  ASIAYGLLYGLAWASWVPYLSASFGAIYILVKPATYAIISKGSGSMNQGKTQGFVAGVQS  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IAS LSP+ M+PLT+WFLS  APFDCKGF II AS+ M+IALC AC+LK   P +K S D
Sbjct  375  IASFLSPLAMSPLTSWFLSSTAPFDCKGFSIIVASVSMMIALCFACLLK---PDEKLSHD  431

Query  218  DAESIEAPLL  189
              + IEAPLL
Sbjct  432  PEDEIEAPLL  441



>gb|KEH43442.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=436

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQIV+LP++NP VGEKVILC ALL
Sbjct  252  MSGITTVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVLLPILNPLVGEKVILCSALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ L G AWA WVPYLS SFG+IY+LV PATYA+ISRASSST+QGKAQ F+AG Q+
Sbjct  312  ASIAYAWLSGLAWAPWVPYLSASFGIIYVLVKPATYAIISRASSSTNQGKAQTFIAGAQS  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMV  282
            I+ LLSPI M+PLT+ FLS +APF+CKGF I+CAS+CMV
Sbjct  372  ISDLLSPIVMSPLTSLFLSSDAPFECKGFSILCASVCMV  410



>ref|XP_002315443.2| hypothetical protein POPTR_0010s24380g [Populus trichocarpa]
 gb|EEF01614.2| hypothetical protein POPTR_0010s24380g [Populus trichocarpa]
Length=668

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL YLKA FGF+KNQ SE+L  VG+GAI SQI+VLPL++P VGE VILC+ALL
Sbjct  224  MSGISSVLLFYLKAVFGFNKNQYSEILSAVGIGAIFSQILVLPLLSPLVGEGVILCLALL  283

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY LLYG AWA+WVPYLS +FG IY+LV PATY+VIS+ SSS +QGK QGF+AGVQ+
Sbjct  284  ASIAYGLLYGLAWASWVPYLSAAFGAIYVLVKPATYSVISKGSSSVNQGKVQGFIAGVQS  343

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WFLS +APF+CKGF II AS+ M+IALC AC+LK   PA+ S  D
Sbjct  344  IASLLSPLAMSPLTSWFLSSDAPFNCKGFSIIVASVSMMIALCFACLLK---PAEMSGHD  400

Query  218  DAESIEAPLL  189
              E IEAPLL
Sbjct  401  MEEEIEAPLL  410



>ref|XP_008456592.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=443

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 155/190 (82%), Gaps = 4/190 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI +VL+ YLKA FGFDKNQ SE+LM+VG+G+I +Q++VLPL+NP +GE+ ILC+A+L
Sbjct  255  MTGITSVLMFYLKAVFGFDKNQNSEILMLVGIGSIFTQMLVLPLLNPLIGEEAILCLAIL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY+L YG AWAAWV YL+ SF VIY+L  PA YA++S+ASSS++QGKAQGFVAGV++
Sbjct  315  ASVAYALFYGLAWAAWVAYLAASFKVIYVLARPAIYAIVSKASSSSNQGKAQGFVAGVES  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            IASLLSP+ M+PLT+WF+S +APFDCKGF I+CASL +VI+L   C L L A   +S E 
Sbjct  375  IASLLSPLVMSPLTSWFISSDAPFDCKGFSIVCASLFLVISLWHGCCL-LKARGHESKEV  433

Query  218  DAESIEAPLL  189
            D E    PLL
Sbjct  434  DPEE---PLL  440



>ref|XP_002524988.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
 gb|EEF37395.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
Length=442

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VL +YLKAAFGF KNQ SE+L +V +G I SQI+VLPL+NP VGEKVILCI LL
Sbjct  255  MSGISTVLFYYLKAAFGFSKNQYSEILSMVEIGEIFSQILVLPLINPLVGEKVILCIGLL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AWA WV YLS SFG I +LV P+TYA+IS+ASSST+QGKAQGFVAGVQA
Sbjct  315  ASIAYALLYGLAWAPWVAYLSASFGAIDVLVKPSTYAIISKASSSTNQGKAQGFVAGVQA  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVI  279
            IASLLSP+  +PLT+WFLS NAPF+CKGF II ASLCM+I
Sbjct  375  IASLLSPLATSPLTSWFLSSNAPFNCKGFSIIVASLCMLI  414



>ref|XP_010907145.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Elaeis 
guineensis]
Length=447

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 154/194 (79%), Gaps = 4/194 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+ FGF KNQ SE+LM+VG+G+I SQI+VLP++NP +GEK +LCIAL 
Sbjct  251  MSGISSVLLYYLKSVFGFSKNQFSEILMMVGIGSIFSQILVLPVINPIIGEKGVLCIALA  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            A IAY+LL G AWA WVPYLS SFGVIY+LV P+ YA++S+A+ S DQGKAQGF+AGVQ+
Sbjct  311  AKIAYALLCGLAWAPWVPYLSASFGVIYVLVKPSIYAIVSKAAISMDQGKAQGFIAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAK----K  231
            IAS L+P+ M+PLT+ F+S  APF+CKGF I+ AS+ ++++L  A +L  D P K    +
Sbjct  371  IASFLAPMVMSPLTSLFISSKAPFNCKGFSILLASISVMVSLAHAWLLNPDNPEKPPDFE  430

Query  230  SSEDDAESIEAPLL  189
             ++   ESIEAPL+
Sbjct  431  IAQTSDESIEAPLV  444



>ref|XP_010312534.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010312535.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010312536.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
Length=372

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VL++YLK+AF F+KNQ SE+LM+VGVG+I++Q++V PLVNP VGE+V+L IALL
Sbjct  185  MSGISSVLMYYLKSAFDFNKNQFSEILMMVGVGSIITQMLVFPLVNPLVGERVVLRIALL  244

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASI Y+LLYG AWA+WVPY    F ++YIL  P+T A++S+ASSS+DQGK QG VAG +A
Sbjct  245  ASITYALLYGLAWASWVPYFGALFRMVYILERPSTNALVSKASSSSDQGKTQGVVAGAEA  304

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I S L+P+ M+PLT+WFLS NAPF+CKGF +ICA+  + +A   A +L  +AP+  + E+
Sbjct  305  IGSFLAPLVMSPLTSWFLSSNAPFNCKGFSLICAAFALAMAFYFAWILP-EAPS--THEE  361

Query  218  DAESIEAPLLS  186
            + ES+E PLL+
Sbjct  362  NGESMETPLLA  372



>ref|XP_006361453.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=439

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VL++YLK+AF F+KNQ SE+LM+VGVG+I++Q++V PLVNP VGE+V+L IALL
Sbjct  252  MSGISSVLMYYLKSAFDFNKNQFSEILMMVGVGSIITQMLVFPLVNPLVGERVVLRIALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASI Y+LLYG AWA+WVPY    F ++Y+L  P+T A++S+ASSS+DQGK QG VAG +A
Sbjct  312  ASITYALLYGLAWASWVPYFGALFRMVYVLERPSTNAIVSKASSSSDQGKTQGLVAGAEA  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I S L+P+ M+PLT+WFLS NAPF+CKGF +ICA+  + +A   A +L  DAP+ +  E+
Sbjct  372  IGSFLAPLVMSPLTSWFLSSNAPFNCKGFSLICAAFALAMAFYFAWILP-DAPSTQ--EE  428

Query  218  DAESIEAPLLS  186
            + ES+EA LL+
Sbjct  429  NGESVEALLLA  439



>ref|XP_004250476.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Solanum lycopersicum]
Length=439

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VL++YLK+AF F+KNQ SE+LM+VGVG+I++Q++V PLVNP VGE+V+L IALL
Sbjct  252  MSGISSVLMYYLKSAFDFNKNQFSEILMMVGVGSIITQMLVFPLVNPLVGERVVLRIALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASI Y+LLYG AWA+WVPY    F ++YIL  P+T A++S+ASSS+DQGK QG VAG +A
Sbjct  312  ASITYALLYGLAWASWVPYFGALFRMVYILERPSTNALVSKASSSSDQGKTQGVVAGAEA  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            I S L+P+ M+PLT+WFLS NAPF+CKGF +ICA+  + +A   A +L  +AP+  + E+
Sbjct  372  IGSFLAPLVMSPLTSWFLSSNAPFNCKGFSLICAAFALAMAFYFAWILP-EAPS--THEE  428

Query  218  DAESIEAPLLS  186
            + ES+E PLL+
Sbjct  429  NGESMETPLLA  439



>gb|EPS69092.1| hypothetical protein M569_05672, partial [Genlisea aurea]
Length=441

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            S I++VL +YLK+ FGF+KNQLSE+ M+VGVG+I SQ+V+LPL+NP VGEK ILCIALLA
Sbjct  249  SAINSVLSYYLKSVFGFNKNQLSELNMMVGVGSIFSQLVLLPLLNPLVGEKAILCIALLA  308

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            SI + LL G AW++WVPYLS SFG+I+ILV PATYAVISR ++S DQGK QGFVAGVQ+I
Sbjct  309  SIGHGLLSGLAWSSWVPYLSSSFGIIFILVKPATYAVISRGTNSADQGKVQGFVAGVQSI  368

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKS---S  225
            A +LSP+ M+PLTTWFLS +APFDCKGF I+ AS+ MV++   A  L L   +KK     
Sbjct  369  ADMLSPLAMSPLTTWFLSSSAPFDCKGFSILLASMGMVVSFFLASTLNLRDSSKKKITGE  428

Query  224  EDDAESIEAPLLS  186
            ED +E+IEAPLL+
Sbjct  429  EDRSENIEAPLLA  441



>ref|XP_010088768.1| Hippocampus abundant transcript-like protein 1 [Morus notabilis]
 gb|EXB36951.1| Hippocampus abundant transcript-like protein 1 [Morus notabilis]
Length=793

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLKAAFGF+KNQ SE+LM+VG+G+I SQI+VLPL+NP VGEKVILCIALL
Sbjct  253  MSGISSVLLYYLKAAFGFNKNQFSELLMMVGIGSIASQILVLPLMNPLVGEKVILCIALL  312

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +SIAY+LLYG AWAAWVPYLS SFGVIY+LV P+TYA+IS+ASSS++QGKAQGF+AGVQ+
Sbjct  313  SSIAYALLYGLAWAAWVPYLSASFGVIYVLVKPSTYAIISKASSSSNQGKAQGFIAGVQS  372

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCM  285
            IASLLSP+ M+PLTTWFLS++APF+CKGF I+ AS+CM
Sbjct  373  IASLLSPLAMSPLTTWFLSEDAPFNCKGFSIVLASMCM  410



>gb|KGN46030.1| hypothetical protein Csa_6G045090 [Cucumis sativus]
Length=416

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VL+ YLKA FGFDKNQ SE+LM+VG+G+I +Q++VLPL+NP +GE+ ILC+ +L
Sbjct  255  MTGITNVLMFYLKAVFGFDKNQNSEILMLVGIGSIFTQMLVLPLINPLIGEEAILCLGIL  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY+L YG AWAAWV YL+ SF VIY+L  PA YA++S+ASSS++QGKAQGFVAGV++
Sbjct  315  ASVAYALFYGLAWAAWVAYLAASFKVIYVLARPAIYAIVSKASSSSNQGKAQGFVAGVES  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMV  282
            IAS LSP+ M+PLT+WF+S +APFDCKGF I+CAS+C+V
Sbjct  375  IASFLSPLVMSPLTSWFISSDAPFDCKGFSIVCASICLV  413



>ref|XP_009407351.1| PREDICTED: uncharacterized protein LOC103990047 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=372

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 4/195 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI ++LL+YLK+AFGF+KNQ SE+L++V  G+I SQI+VLP +N  +GEK +LCIAL+
Sbjct  176  MSGISSILLYYLKSAFGFNKNQFSEILLMVSFGSIFSQILVLPHINSLMGEKGVLCIALI  235

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY +LYG AWA WVPYLS SFGVIY+LV P+T A+IS+A  S+DQGKAQG +A VQ+
Sbjct  236  ASIAYGVLYGLAWAPWVPYLSASFGVIYVLVKPSTCAIISKAVISSDQGKAQGLIAAVQS  295

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA----PAKK  231
            +ASLLSP+ M+PLT+ F+S +APFDCKGF I+ AS+ ++I+L  A +L  +     P  +
Sbjct  296  VASLLSPVVMSPLTSLFISSDAPFDCKGFSILVASISLIISLGHASLLHSENSNKLPEHE  355

Query  230  SSEDDAESIEAPLLS  186
              +   E++EAPLL+
Sbjct  356  PGQYGDETVEAPLLT  370



>ref|XP_009407349.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 4/195 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI ++LL+YLK+AFGF+KNQ SE+L++V  G+I SQI+VLP +N  +GEK +LCIAL+
Sbjct  251  MSGISSILLYYLKSAFGFNKNQFSEILLMVSFGSIFSQILVLPHINSLMGEKGVLCIALI  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY +LYG AWA WVPYLS SFGVIY+LV P+T A+IS+A  S+DQGKAQG +A VQ+
Sbjct  311  ASIAYGVLYGLAWAPWVPYLSASFGVIYVLVKPSTCAIISKAVISSDQGKAQGLIAAVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA----PAKK  231
            +ASLLSP+ M+PLT+ F+S +APFDCKGF I+ AS+ ++I+L  A +L  +     P  +
Sbjct  371  VASLLSPVVMSPLTSLFISSDAPFDCKGFSILVASISLIISLGHASLLHSENSNKLPEHE  430

Query  230  SSEDDAESIEAPLLS  186
              +   E++EAPLL+
Sbjct  431  PGQYGDETVEAPLLT  445



>ref|XP_006851495.1| hypothetical protein AMTR_s00040p00148020 [Amborella trichopoda]
 gb|ERN13076.1| hypothetical protein AMTR_s00040p00148020 [Amborella trichopoda]
Length=424

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI +VLL+YLK+AFGF KNQ +E+LM+VG+G+I SQI+VLP++N  +GEK +LC+AL+
Sbjct  251  MSGISSVLLYYLKSAFGFSKNQFAEILMMVGIGSIFSQILVLPVINVLMGEKWVLCLALV  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            +S+ Y LLYG AWA WVPYL  SFGV+Y+LV P+TYA++S+A+SS DQGK QGFVAGVQ+
Sbjct  311  SSVCYGLLYGLAWAPWVPYLGASFGVVYVLVKPSTYAIVSQAASSNDQGKVQGFVAGVQS  370

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVI  279
             ASLLSP+ M+PLT+ FLS  APF+CKGF ++CAS+ MVI
Sbjct  371  TASLLSPLVMSPLTSLFLSSKAPFNCKGFSLVCASVSMVI  410



>gb|KCW51477.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=443

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 152/191 (80%), Gaps = 8/191 (4%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M+GI  VLL+YL+AAFGF KNQ SE+L+VV  G+IVSQ++VLPLVNP VGEKV+LCI L+
Sbjct  255  MTGISNVLLYYLEAAFGFTKNQFSEILIVVEAGSIVSQLLVLPLVNPLVGEKVVLCIGLV  314

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+AS S DQGKAQGF+AG+QA
Sbjct  315  ASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISQASRSADQGKAQGFIAGIQA  374

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA-PAKKSSE  222
            IAS LSP+ M+PLT WFLSDNAPF+CKGF I       V++   AC+LK +   ++ S +
Sbjct  375  IASFLSPLAMSPLTAWFLSDNAPFNCKGFSI-------VLSFVYACLLKPENWSSQNSDQ  427

Query  221  DDAESIEAPLL  189
            D+ E  EAPLL
Sbjct  428  DNIEEQEAPLL  438



>ref|XP_002450280.1| hypothetical protein SORBIDRAFT_05g003130 [Sorghum bicolor]
 gb|EES09268.1| hypothetical protein SORBIDRAFT_05g003130 [Sorghum bicolor]
Length=448

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 147/199 (74%), Gaps = 11/199 (6%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VL++YLK+ FGFDK+Q SE+LMVVGVG+I SQI+VLP ++  +GEK +LCI++L
Sbjct  248  MIGISDVLMYYLKSVFGFDKDQFSEILMVVGVGSIFSQILVLPFLSHIIGEKGVLCISIL  307

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AWA+WVPY S S G+IY+L  PA YA+IS    STDQGKAQGF+A VQ+
Sbjct  308  ASIAYALLYGVAWASWVPYFSSSLGIIYVLAKPAIYAIISGEVLSTDQGKAQGFIATVQS  367

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK----  231
            +A LL+P+ M+PLT++F+S+ APFDCKGF  I AS  +VI+ C A ML    P  K    
Sbjct  368  VAILLAPLFMSPLTSYFISEEAPFDCKGFSFIVASFFLVISFCLAWMLN---PGNKDKGT  424

Query  230  ----SSEDDAESIEAPLLS  186
                S   D E+ +APLL+
Sbjct  425  KSVVSDSPDEEAAQAPLLA  443



>ref|XP_006662736.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Oryza brachyantha]
Length=454

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 148/195 (76%), Gaps = 5/195 (3%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VL++YLK+ FGFDKNQ SE+LMVVG+G+I SQI+VLP++   VGEK +LC+ +L
Sbjct  256  MIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQILVLPVIINTVGEKGVLCVGIL  315

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY+LLYGFAW+ WVPY + S GVIY+LV PATYA+IS    S+DQGKAQGF++ V++
Sbjct  316  ASVAYALLYGFAWSYWVPYFTSSLGVIYVLVKPATYAIISGEVVSSDQGKAQGFISTVKS  375

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS--  225
             A LL+P+ M+PLT++F+S+ APF+CKGF    A   +VI+L  + MLK D  AK +   
Sbjct  376  TAVLLAPLFMSPLTSYFISEQAPFNCKGFSFFMAGFFLVISLGISLMLKPDCGAKCTRVA  435

Query  224  ---EDDAESIEAPLL  189
               + D E+++APLL
Sbjct  436  VPDQPDHEAVQAPLL  450



>ref|XP_004978692.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Setaria italica]
Length=455

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 145/194 (75%), Gaps = 3/194 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M  I  VL++YLK+ FGFDK+Q SE+LMVVGVG+I SQI++LP ++  +GEK +LCI++L
Sbjct  257  MIAISDVLMYYLKSVFGFDKDQFSEILMVVGVGSIFSQILILPFLSHIIGEKGVLCISIL  316

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AWA+WVPY S S GVIY+L  PA YA+IS    STDQGKAQGF+A VQ+
Sbjct  317  ASIAYALLYGVAWASWVPYFSSSLGVIYVLAKPAIYAIISGEVLSTDQGKAQGFIATVQS  376

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSE-  222
            +A LL+P+ M+PLT++F+S  APFDCKGF  I AS  + I+ C A  L  ++   K  + 
Sbjct  377  VAILLAPLFMSPLTSYFISPEAPFDCKGFSFIVASFFLAISFCLAWTLNPESKDDKRRKL  436

Query  221  --DDAESIEAPLLS  186
               D E+++APLL+
Sbjct  437  VVSDEEAVQAPLLA  450



>ref|NP_001140664.1| uncharacterized protein LOC100272739 precursor [Zea mays]
 gb|ACF84318.1| unknown [Zea mays]
Length=452

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 146/196 (74%), Gaps = 5/196 (3%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M  I  VL++YLK+ FGFDK+Q SE+LMVVGVG+I SQI+VLP ++  +GEK +LCI++L
Sbjct  252  MIAISDVLMYYLKSVFGFDKDQFSEILMVVGVGSIFSQILVLPFLSQIIGEKGVLCISIL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AWA+WVPY S S G+IY+L  PA YA+IS    STDQGKAQGF+A VQ+
Sbjct  312  ASIAYALLYGVAWASWVPYFSSSLGIIYVLAKPAIYAIISGEVLSTDQGKAQGFIATVQS  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK---LDAPAKKS  228
            +A LL+P+ M+PLT++F+S+ APFDCKGF  I AS  + I+ C A ML     D   K +
Sbjct  372  VAILLAPLFMSPLTSYFISEEAPFDCKGFSFIVASFFLAISFCLAWMLNPGMKDKGTKAA  431

Query  227  SED--DAESIEAPLLS  186
              D  D E+ +APLL+
Sbjct  432  VSDSTDEEAAQAPLLA  447



>gb|EEE51661.1| hypothetical protein OsJ_32986 [Oryza sativa Japonica Group]
 tpd|FAA00733.1| TPA: nicotianamine efflux transporter [Oryza sativa Japonica 
Group]
Length=436

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VL++YLK+ FGFDKNQ SE+LMVVG+G+I SQI+VLP++   VGEK +LC+ +L
Sbjct  241  MIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQILVLPVIINTVGEKGVLCVGIL  300

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY++LYG AW+ WVPYL+ S GVIY+LV PATYA+IS    S+DQGKAQGF++ V++
Sbjct  301  ASVAYAVLYGLAWSYWVPYLTSSLGVIYVLVKPATYAIISGEVDSSDQGKAQGFISTVKS  360

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS--  225
             A LL+P+ M+PLT++F+S+ APF+CKGF  + A   + I+L  + MLK +A   + +  
Sbjct  361  TAVLLAPLFMSPLTSYFISEQAPFNCKGFSFLVAGFFLAISLGISFMLKPEAKCTRVAVP  420

Query  224  -EDDAESIEAPLLS  186
             + D E+++APLL+
Sbjct  421  DQLDHEAVQAPLLA  434



>gb|AAX94836.1| Major Facilitator Superfamily, putative [Oryza sativa Japonica 
Group]
 gb|ABA91455.1| Major Facilitator Superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=1143

 Score =   200 bits (508),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 105/194 (54%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = -3

Query  758   MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
             M GI  VL++YLK+ FGFDKNQ SE+LMVVG+G+I SQI+VLP++   VGEK +LC+ +L
Sbjct  948   MIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQILVLPVIINTVGEKGVLCVGIL  1007

Query  578   asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
             AS+AY++LYG AW+ WVPYL+ S GVIY+LV PATYA+IS    S+DQGKAQGF++ V++
Sbjct  1008  ASVAYAVLYGLAWSYWVPYLTSSLGVIYVLVKPATYAIISGEVDSSDQGKAQGFISTVKS  1067

Query  398   IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS--  225
              A LL+P+ M+PLT++F+S+ APF+CKGF  + A   + I+L  + MLK +A   + +  
Sbjct  1068  TAVLLAPLFMSPLTSYFISEQAPFNCKGFSFLVAGFFLAISLGISFMLKPEAKCTRVAVP  1127

Query  224   -EDDAESIEAPLLS  186
              + D E+++APLL+
Sbjct  1128  DQLDHEAVQAPLLA  1141



>gb|EEC67684.1| hypothetical protein OsI_35133 [Oryza sativa Indica Group]
Length=436

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VL++YLK+ FGFDKNQ SE+LMVVG+G+I SQI+VLP++   VGEK +LC+ +L
Sbjct  241  MIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQILVLPVIINTVGEKGVLCVGIL  300

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY++LYG AW+ WVPYL+ S GVIY+LV PATYA+IS    S+DQGKAQGF++ V++
Sbjct  301  ASVAYAVLYGLAWSYWVPYLTSSLGVIYVLVKPATYAIISGLVDSSDQGKAQGFISTVKS  360

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS--  225
             A LL+P+ M+PLT++F+S+ APF+CKGF  + A   + I+L  + MLK +A   + +  
Sbjct  361  TAVLLAPLFMSPLTSYFISEQAPFNCKGFSFLVAGFFLAISLGISFMLKPEAKCTRVAVP  420

Query  224  -EDDAESIEAPLLS  186
             + D E+++APLL+
Sbjct  421  DQLDHEAVQAPLLA  434



>ref|NP_001065767.2| Os11g0151500 [Oryza sativa Japonica Group]
 dbj|BAF27612.2| Os11g0151500, partial [Oryza sativa Japonica Group]
Length=447

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VL++YLK+ FGFDKNQ SE+LMVVG+G+I SQI+VLP++   VGEK +LC+ +L
Sbjct  252  MIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQILVLPVIINTVGEKGVLCVGIL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY++LYG AW+ WVPYL+ S GVIY+LV PATYA+IS    S+DQGKAQGF++ V++
Sbjct  312  ASVAYAVLYGLAWSYWVPYLTSSLGVIYVLVKPATYAIISGEVDSSDQGKAQGFISTVKS  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS--  225
             A LL+P+ M+PLT++F+S+ APF+CKGF  + A   + I+L  + MLK +A   + +  
Sbjct  372  TAVLLAPLFMSPLTSYFISEQAPFNCKGFSFLVAGFFLAISLGISFMLKPEAKCTRVAVP  431

Query  224  -EDDAESIEAPLLS  186
             + D E+++APLL+
Sbjct  432  DQLDHEAVQAPLLA  445



>ref|XP_003577048.1| PREDICTED: uncharacterized protein LOC100833620 [Brachypodium 
distachyon]
Length=460

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 145/196 (74%), Gaps = 5/196 (3%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VLL+YLK  FGFDKNQ SE+LMVVG+G+I SQI VLP++   +GEK +LCI++L
Sbjct  263  MIGISDVLLYYLKLVFGFDKNQFSEILMVVGIGSIFSQIFVLPVLIHAIGEKGVLCISIL  322

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY+LLYG AW+ WVPY + S GVIY+LV PATYA+ISR   S DQGKAQGF A V++
Sbjct  323  ASVAYALLYGLAWSWWVPYFASSLGVIYVLVKPATYAIISREVISADQGKAQGFNATVKS  382

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAK-----  234
             A L++P+ M+PLT++F+SD APF+CKGF  + A   + I+L  A ML  ++  K     
Sbjct  383  AAILMAPLFMSPLTSYFISDEAPFNCKGFSFLIAGFFLAISLYFAWMLDPESKDKCTGVA  442

Query  233  KSSEDDAESIEAPLLS  186
             S + D E+++APLL+
Sbjct  443  ASGQLDQEAVQAPLLA  458



>gb|KEH43443.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=387

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLKA FGF+KNQ SE+LM+VG+G+I SQIV+LP++NP VGEKVILC ALL
Sbjct  252  MSGITTVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVLLPILNPLVGEKVILCSALL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+ L G AWA WVPYLS SFG+IY+LV PATYA+ISRASSST+QGKAQ F+AG Q+
Sbjct  312  ASIAYAWLSGLAWAPWVPYLSASFGIIYVLVKPATYAIISRASSSTNQGKAQTFIAGAQS  371

Query  398  IASLLSPIGMTPLT  357
            I+ LLSPI M+PLT
Sbjct  372  ISDLLSPIVMSPLT  385



>gb|KDO42036.1| hypothetical protein CISIN_1g0164181mg, partial [Citrus sinensis]
Length=132

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = -3

Query  551  GFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSPIG  372
            G AWA+WVPYLS SFGVIY+LV P+TYA+IS+AS   +QGKAQGF+AGVQ+I+SLLSP+ 
Sbjct  12   GLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLA  71

Query  371  MTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDAESIEAPL  192
            M+PLT+WFLS +APF+CKGF II AS+C++++L CACML  +   + S+ D+ E IE PL
Sbjct  72   MSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDTE---ENSTNDEREDIEEPL  128

Query  191  LS  186
            +S
Sbjct  129  IS  130



>ref|XP_003577047.1| PREDICTED: uncharacterized protein LOC100833312 [Brachypodium 
distachyon]
Length=451

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VLL+YLK  FGFDKNQ SE+ MVVG+G+I SQI++LP++   + EK +LCI++L
Sbjct  252  MEGISDVLLYYLKLVFGFDKNQFSEIRMVVGIGSIFSQILLLPVIIHAMAEKGVLCISIL  311

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            ASIAY+LLYG AW+ WVPY + S G+IY+LV P+TYA+ISR   S +QGKAQGFV+ VQ 
Sbjct  312  ASIAYALLYGLAWSWWVPYFASSLGIIYVLVKPSTYAMISREVVSANQGKAQGFVSTVQC  371

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKS---  228
             A L +P  M+PLT++F+S+ APF+CKGF  + A   +VI+L  A ML  ++  + +   
Sbjct  372  TAILFAPSFMSPLTSYFISEEAPFNCKGFSFLVAGFFLVISLGFAWMLDPESKNRCTGIA  431

Query  227  -SED--DAESIEAPLLS  186
             S+D  D E+++APLL+
Sbjct  432  VSDDQLDQEAVQAPLLA  448



>ref|XP_010032084.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=421

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -3

Query  611  GEKVilciallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQG  432
            GEKV+LCI L+ASIAY+L YG AWA+WV YLS SFGVIY LV PATYA+IS+AS S DQG
Sbjct  275  GEKVVLCIGLVASIAYALFYGLAWASWVAYLSASFGVIYALVDPATYAIISQASRSADQG  334

Query  431  KAQGFVAGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            KAQGF+AG+QAIAS LSP+ M+PLT WFLSDNAPF+CKGF I+CAS+CMV++   AC+LK
Sbjct  335  KAQGFIAGIQAIASFLSPLAMSPLTAWFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLK  394

Query  251  LDA-PAKKSSEDDAESIEAPLL  189
             +   ++ S +D+ E  EAPLL
Sbjct  395  PENWSSQNSDQDNIEEQEAPLL  416



>gb|EMS64155.1| Hippocampus abundant transcript-like protein 1 [Triticum urartu]
Length=447

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 142/213 (67%), Gaps = 22/213 (10%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VLL+YLK  FGFDKNQ SE+LMVVG+G+I SQI++LP+    +GEK +LCI++L
Sbjct  233  MIGISDVLLYYLKLVFGFDKNQFSEILMVVGIGSIFSQILILPVAIHAIGEKGVLCISIL  292

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY++LYG AW+ W PY + S G+IY LV PATYA+ISR   S DQGKAQGF+A V++
Sbjct  293  ASVAYAMLYGLAWSWWAPYFASSLGIIYCLVKPATYAIISREVVSADQGKAQGFIATVKS  352

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICA-----------------SLCMVIALC  270
             A L++P+ M+PLT++F+S+ APF+CKGF  + A                 +    ++L 
Sbjct  353  TAILMAPLFMSPLTSYFISEEAPFNCKGFSFLVAGFFLYVHKNVQQQISSTTFLQAVSLA  412

Query  269  CACMLKLDAPAKK-----SSEDDAESIEAPLLS  186
             A ML  ++  K        + D E+ +APLL+
Sbjct  413  FAWMLDPESKDKHIGVADQDQLDQEAAQAPLLA  445



>ref|XP_010682914.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=444

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 122/169 (72%), Gaps = 0/169 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI +VLL Y+K A   ++  +S  LM+V +G++ SQ++++P++N   GEK IL + LL
Sbjct  261  MCGISSVLLFYMKDALNMNEGNMSATLMIVQIGSVFSQMLIVPVINALTGEKAILSMGLL  320

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+ Y+  Y  AWA W+PY+SVS G+ Y  V P+  A+ISRASSS +QG+ QGF+A V +
Sbjct  321  ASVTYAFFYSVAWATWLPYISVSLGLAYGFVKPSICAIISRASSSNEQGRVQGFLAAVDS  380

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            IA  +SP+ MTPLT WFLS+NAPFDCKGF ++CA+  M++AL  A  LK
Sbjct  381  IAGFISPLIMTPLTQWFLSNNAPFDCKGFSLVCAAFSMMVALVIAMPLK  429



>gb|EMT19766.1| Hippocampus abundant transcript-like protein 1 [Aegilops tauschii]
Length=934

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VLL+YLK  FGFDKNQ SE+LMVVG+G+I SQI++LP+    +GEK +LCI++L
Sbjct  271  MIGISDVLLYYLKLVFGFDKNQFSEILMVVGIGSIFSQILILPVAIHAIGEKGVLCISIL  330

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
            AS+AY++LYG AW+ W PY + S G+IY LV PATYA+ISR   S DQGKAQGF+A V++
Sbjct  331  ASVAYAMLYGLAWSWWAPYFASSLGIIYCLVKPATYAIISREVVSADQGKAQGFIATVKS  390

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICA  297
             A L++P+ M+PLT++F+S+ APF+CKGF  + A
Sbjct  391  TAILMAPLFMSPLTSYFISEEAPFNCKGFSFLVA  424



>gb|EPS63270.1| hypothetical protein M569_11515, partial [Genlisea aurea]
Length=117

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = -3

Query  530  VPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSPIGMTPLTTW  351
            VPYLS SFGVI++LV PATYAVISR S S +QGK QGFVAGVQ+I+  LSP+ M+PLTTW
Sbjct  1    VPYLSASFGVIFVLVKPATYAVISRGSDSANQGKVQGFVAGVQSISDFLSPLAMSPLTTW  60

Query  350  FLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA--ESIEAPLLS  186
            FLS  APF+CKGF I+ ASL +VI+   A  L L A  KKS+ +D   E  EAPLLS
Sbjct  61   FLSSRAPFNCKGFSIVIASLGIVISFFLASTLNLQASPKKSAAEDRSEEDCEAPLLS  117



>emb|CAN74055.1| hypothetical protein VITISV_026070 [Vitis vinifera]
Length=467

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 140/234 (60%), Gaps = 56/234 (24%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQ-------------------IVV  636
            MSGI  VLL+YLKAAFGF+KNQLSE+LM+VG+G+I SQ                   +++
Sbjct  247  MSGISGVLLYYLKAAFGFNKNQLSEILMMVGIGSIFSQGKIMRYIXIKPSLVIIEGMMLI  306

Query  635  LPLVNPFVGEKVilciallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISR  456
            LPL+NP VGEK+ILC AL            A  A+VPYLS SFGV+Y+LV P+TYA+IS+
Sbjct  307  LPLINPLVGEKLILCTAL-----------LASIAYVPYLSASFGVVYVLVKPSTYAIISK  355

Query  455  ASSSTDQ------GKAQ----------GFVAGVQ--------AIASLLSPIGMTPLTTWF  348
            ASSS++Q      GK+            FV   +        +I  L   + ++P   WF
Sbjct  356  ASSSSNQIFNCYEGKSTRIHCWNPVRCKFVITTRNESTDIIISIVLLNHYVDVSP--AWF  413

Query  347  LSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDAESIEAPLLS  186
            LS NAPF CKGF I+CASLCM+IALC A  LK D PA     ++ + +EA LLS
Sbjct  414  LSSNAPFKCKGFSIVCASLCMMIALCYAVFLKQDEPANDELNNNIDDMEAALLS  467



>ref|XP_002965935.1| hypothetical protein SELMODRAFT_167756 [Selaginella moellendorffii]
 gb|EFJ33355.1| hypothetical protein SELMODRAFT_167756 [Selaginella moellendorffii]
Length=459

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 127/184 (69%), Gaps = 5/184 (3%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S   +G+   LL+YLKA FGF K+Q +E++++ G+ ++ SQ++++P+   F GEK++L 
Sbjct  258  SSLGEAGLQGSLLYYLKATFGFAKDQFAELMLINGLASVFSQLLIMPVFVHFFGEKIVLF  317

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            IA+ AS +++LLYG AWA WVPY+  SF + ++L  P   +++S+ +   +QGK QG +A
Sbjct  318  IAISASASHALLYGVAWADWVPYVCSSFSIFFVLSFPCIGSIVSKTAEPEEQGKFQGLIA  377

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACML-----KLD  246
            G+++ A++LSP+ ++PLT  FLS +APF+C GF +I A   MV+AL  A ML     +L 
Sbjct  378  GIRSFATILSPLAISPLTALFLSKDAPFNCPGFSLIVAGSVMVLALVQALMLQPIPPQLS  437

Query  245  APAK  234
             P+K
Sbjct  438  KPSK  441



>ref|XP_004953398.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Setaria 
italica]
Length=451

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 120/184 (65%), Gaps = 2/184 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL+YLKA FG+ K++ + +L++VG   ++SQ+ V+P++ P +GE+++L + LL  
Sbjct  268  GLQTALLYYLKAQFGYSKDEFANLLLIVGAAGMLSQLTVMPILAPILGEEILLIVGLLGG  327

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LYG AW+ WVPYLS +F ++   V P+    +S+  +S +QG AQG ++G+ +  
Sbjct  328  CTHVFLYGIAWSYWVPYLSAAFVILSAFVHPSIRTNVSKNVASNEQGIAQGCISGISSFG  387

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK--LDAPAKKSSED  219
            S+L P+  TPLT WFLS+  PF+ KGF I+CA LC +IA   +  ++    + +KKS+ +
Sbjct  388  SILGPLIFTPLTAWFLSETGPFNFKGFSILCAGLCTLIAFIISLRMRGAQSSASKKSTVE  447

Query  218  DAES  207
              ++
Sbjct  448  HEQA  451



>ref|NP_001047681.1| Os02g0667500 [Oryza sativa Japonica Group]
 dbj|BAD27788.1| tetracycline transporter protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD28125.1| tetracycline transporter protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF09595.1| Os02g0667500 [Oryza sativa Japonica Group]
 dbj|BAG87070.1| unnamed protein product [Oryza sativa Japonica Group]
Length=211

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL+YLKA FG+ K++ + +L++ G   ++SQ+ V+P++  FVGE ++L I LL  
Sbjct  27   GLQTALLYYLKAQFGYSKDEFANLLLIAGAAGMLSQLTVMPVLARFVGEDILLIIGLLGG  86

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LYG AW+ WVPYLS  F ++   V P+    +S++  S +QG AQG ++G+ + A
Sbjct  87   CTHVFLYGIAWSYWVPYLSAVFIILSAFVHPSIRTNVSKSVGSNEQGIAQGCISGISSFA  146

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSE  222
            S+L+P+  TPLT W LS+ APF  KGF I+CA  C +IA   +  +++ A    +SE
Sbjct  147  SILAPLIFTPLTAWVLSETAPFKFKGFSIMCAGFCTLIAFIIS--MRMRAGQSGASE  201



>gb|AFW72716.1| hypothetical protein ZEAMMB73_747947 [Zea mays]
Length=448

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 117/185 (63%), Gaps = 4/185 (2%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
             G+   LL+YLKA FG++K++ + +L++VG   ++SQ+ V+P++ P +GE+++L + LL 
Sbjct  264  HGLQTALLYYLKAQFGYNKDEFANLLLIVGAAGMLSQLTVMPILAPILGEEMLLIVGLLG  323

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
               +  LYG AW+ WVPY + +F ++   V P+    +S+   S +QG AQG ++G+ + 
Sbjct  324  GCTHVFLYGIAWSYWVPYFAAAFVILSAFVHPSIRTNVSKNVGSNEQGIAQGCISGISSF  383

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            AS+L P+  TPLT WFLS+  PF+ KGF I+CA  C +IA     ++ L  P  +SS   
Sbjct  384  ASILGPLIFTPLTAWFLSETEPFNFKGFSILCAGFCTLIAF----VISLRMPGARSSTCK  439

Query  215  AESIE  201
              +++
Sbjct  440  KTAVQ  444



>ref|NP_001144256.1| uncharacterized protein LOC100277128 precursor [Zea mays]
 gb|ACG39029.1| hypothetical protein [Zea mays]
Length=448

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 117/185 (63%), Gaps = 4/185 (2%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
             G+   LL+YLKA FG++K++ + +L++VG   ++SQ+ V+P++ P +GE+++L + LL 
Sbjct  264  HGLQTALLYYLKAQFGYNKDEFANLLLIVGAAGMLSQLTVMPILAPILGEEMLLIVGLLG  323

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
               +  LYG AW+ WVPY + +F ++   V P+    +S+   S +QG AQG ++G+ + 
Sbjct  324  GCTHVFLYGIAWSYWVPYFAAAFVILSAFVHPSIRTNVSKNVGSNEQGIAQGCISGISSF  383

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            AS+L P+  TPLT WFLS+  PF+ KGF I+CA  C +IA     ++ L  P  +SS   
Sbjct  384  ASILGPLIFTPLTAWFLSETEPFNFKGFSILCAGFCTLIAF----VISLRMPGARSSTCK  439

Query  215  AESIE  201
              +++
Sbjct  440  KTAVQ  444



>ref|XP_006648918.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Oryza 
brachyantha]
Length=456

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 117/184 (64%), Gaps = 4/184 (2%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL+YLKA FG+ K++ + ++++ G   ++SQ+ V+P++  FVGE ++L I LL  
Sbjct  272  GLQTALLYYLKARFGYSKDEFANLMLIAGAAGMLSQLTVMPVLARFVGEDILLIIGLLGG  331

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+  LYG AW+ WVPYLS +F ++   V P+    +S++  S +QG AQG ++G+ + A
Sbjct  332  CAHVFLYGIAWSYWVPYLSAAFIILSAFVHPSIRTNVSKSVGSNEQGIAQGCISGISSFA  391

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            S+L P+  TPLT W LS+ APF+ KGF I+CA  C +IA   +  ++    A +S   D 
Sbjct  392  SILGPLIFTPLTAWVLSETAPFNFKGFSIMCAGFCTLIAFVISMRMR----AGQSGARDK  447

Query  212  ESIE  201
             ++E
Sbjct  448  VAVE  451



>ref|XP_010266910.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Nelumbo 
nucifera]
Length=458

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 117/185 (63%), Gaps = 0/185 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            TS    G+   LL+YLKA+F F K+Q ++++++VG+    SQ+V++P + P +GE+ +L 
Sbjct  272  TSLAEGGLYTSLLYYLKASFHFSKDQFADLMLIVGIAGAFSQLVLMPTLAPAIGEEKLLA  331

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L AS  +  LYG +W++WVPY+S  F V+ +L  P   ++ S+     +QGKAQG ++
Sbjct  332  IGLFASCTHMFLYGISWSSWVPYVSAMFSVLGVLANPCIRSIASKQVGPNEQGKAQGCIS  391

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            G+ + A+++SP+  TPLT  FLS+NAPF   GF I+C    M++A   + M++    + K
Sbjct  392  GISSFANVVSPLAFTPLTALFLSENAPFHFPGFSIVCIGFAMMVAFIQSIMIRAPTASHK  451

Query  230  SSEDD  216
             S + 
Sbjct  452  ISSNS  456



>ref|XP_002454504.1| hypothetical protein SORBIDRAFT_04g032320 [Sorghum bicolor]
 gb|EES07480.1| hypothetical protein SORBIDRAFT_04g032320 [Sorghum bicolor]
Length=447

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 108/167 (65%), Gaps = 0/167 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G++  LL+YLKA FG+ K++ + +L++ G   ++SQ+ V+P++ P +GE+V+L + LL  
Sbjct  264  GLNTALLYYLKAQFGYSKDEFANLLLIAGAAGMLSQLTVMPILAPILGEEVLLIVGLLGG  323

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LYG AW+ WVPY + +F ++   V P+    +S+   S +QG AQG ++G+ +  
Sbjct  324  CTHVFLYGIAWSYWVPYFAAAFVILSAFVHPSIRTNVSKNVGSNEQGIAQGCISGISSFG  383

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            S+L P+  TPLT WFLS+  PFD KGF I+CA  C +IA   +  ++
Sbjct  384  SILGPLIFTPLTAWFLSETGPFDFKGFSILCAGFCTLIAFIISLRMR  430



>ref|XP_006655183.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Oryza 
brachyantha]
Length=439

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 114/168 (68%), Gaps = 0/168 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+   LL+YLKA F + KNQ + +L+V+G+   +SQ+V++P++ P +GE+ +L IALL 
Sbjct  263  TGLQTALLYYLKAQFHYTKNQYANLLLVIGIAGSLSQLVIMPMLAPKLGEQKLLIIALLG  322

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            S  + +LY  AW+ WVPYL  SF +I + V P   +++S+ +   +QG AQG + G+ + 
Sbjct  323  SCMHCVLYSIAWSPWVPYLGASFFIIGMSVNPCIRSIVSKRAGPFEQGMAQGCLTGISST  382

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            A+++SPI  TPLT WFLS+ APF+ KGF + CA   M+IAL  +  ++
Sbjct  383  ANVISPIVFTPLTAWFLSETAPFNFKGFSLACAGFAMLIALAVSINMR  430



>ref|XP_011458696.1| PREDICTED: uncharacterized protein LOC101295772 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=387

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 109/176 (62%), Gaps = 0/176 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +L++LKA F FDKNQ +++L++VG+   +SQ+V +PL+ P + E+ +L   LL S
Sbjct  210  GMQATVLYFLKARFQFDKNQFADILLLVGISGAISQMVFMPLLAPRIREESMLSFGLLLS  269

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   AWA WVPY +  F    +L  P   ++ S+    T+QGKAQG +AG+ + A
Sbjct  270  CISMFLNSVAWAPWVPYAATVFSSFGLLAQPTIRSIASKQVGPTEQGKAQGCMAGISSFA  329

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS  225
            +++SP+  +PLT  FLS++APF+  GF I+C  L  VIAL  + M++   P    S
Sbjct  330  NIVSPLVFSPLTALFLSEDAPFNFPGFSIMCLGLATVIALILSTMIRASPPISSHS  385



>ref|XP_008347370.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Malus 
domestica]
Length=391

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +L++LKA F F+KNQ ++++++ GV   VSQ+V++PL+ P +GE+ +L I LL S
Sbjct  206  GLHASMLYFLKARFHFNKNQFADLMVISGVAGTVSQLVLMPLLAPALGEERLLSIGLLFS  265

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 LYG AW+ WVPY +  F + Y+   P   +++S+    ++QGKAQG ++G+ ++A
Sbjct  266  CLQMFLYGIAWSFWVPYAAAMFSIFYVFAHPCMRSIVSKQVGPSEQGKAQGCISGICSLA  325

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP--AKKSSED  219
            +++SPI  +PLT  FLS+ APF+  GF +IC     +IA   + M++   P  +++ SE 
Sbjct  326  NVISPIAFSPLTALFLSEKAPFNFPGFSLICVGFAAMIAFMQSVMIRAAPPLSSRRVSES  385



>ref|XP_002968361.1| hypothetical protein SELMODRAFT_169638 [Selaginella moellendorffii]
 gb|EFJ30615.1| hypothetical protein SELMODRAFT_169638 [Selaginella moellendorffii]
Length=440

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 115/164 (70%), Gaps = 1/164 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S   +G+   LL+YLKA FGF K+Q +E++++ G+ ++ SQ++++P+   F GEK++L 
Sbjct  258  SSLGEAGLQGSLLYYLKATFGFAKDQFAELMLINGLASVFSQLLIMPVFVHFFGEKIVLF  317

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISR-ASSSTDQGKAQGFV  414
            IA+ AS +++LLYG AWA WVPY+  SF + ++L  P   +++S+ A     QGK QG +
Sbjct  318  IAISASASHALLYGVAWADWVPYVCSSFSIFFVLSFPCVRSIVSKTAEPEEQQGKFQGLI  377

Query  413  AGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMV  282
            AG+++ A++LSP+ ++PLT  FLS +APF+C GF +I A   MV
Sbjct  378  AGIRSFATILSPLAISPLTALFLSKDAPFNCPGFSLIVAGSVMV  421



>ref|XP_004290751.1| PREDICTED: uncharacterized protein LOC101295772 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 109/176 (62%), Gaps = 0/176 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +L++LKA F FDKNQ +++L++VG+   +SQ+V +PL+ P + E+ +L   LL S
Sbjct  285  GMQATVLYFLKARFQFDKNQFADILLLVGISGAISQMVFMPLLAPRIREESMLSFGLLLS  344

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   AWA WVPY +  F    +L  P   ++ S+    T+QGKAQG +AG+ + A
Sbjct  345  CISMFLNSVAWAPWVPYAATVFSSFGLLAQPTIRSIASKQVGPTEQGKAQGCMAGISSFA  404

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS  225
            +++SP+  +PLT  FLS++APF+  GF I+C  L  VIAL  + M++   P    S
Sbjct  405  NIVSPLVFSPLTALFLSEDAPFNFPGFSIMCLGLATVIALILSTMIRASPPISSHS  460



>gb|EEE57537.1| hypothetical protein OsJ_07859 [Oryza sativa Japonica Group]
Length=411

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL+YLKA FG+ K++ + +L++ G   ++SQ+ V+P++  FVGE ++L I LL  
Sbjct  227  GLQTALLYYLKAQFGYSKDEFANLLLIAGAAGMLSQLTVMPVLARFVGEDILLIIGLLGG  286

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LYG AW+ WVPYLS  F ++   V P+    +S++  S +QG AQG ++G+ + A
Sbjct  287  CTHVFLYGIAWSYWVPYLSAVFIILSAFVHPSIRTNVSKSVGSNEQGIAQGCISGISSFA  346

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSE  222
            S+L+P+  TPLT W LS+ APF  KGF I+CA  C +IA   +  +++ A    +SE
Sbjct  347  SILAPLIFTPLTAWVLSETAPFKFKGFSIMCAGFCTLIAFIIS--MRMRAGQSGASE  401



>ref|XP_008357148.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Malus 
domestica]
Length=480

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 117/179 (65%), Gaps = 2/179 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +L++LKA F F+KNQ ++++++ GV   VSQ+V++PL+ P +GE+ +L I LL S
Sbjct  295  GLHASMLYFLKARFHFNKNQFADLMVISGVAGTVSQLVLMPLLAPALGEERLLSIGLLFS  354

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 LYG AW+ WVPY +  F + Y+   P   +++S+    ++QGKAQG ++G+ ++A
Sbjct  355  CLQMFLYGIAWSFWVPYAAAMFSIFYVFAHPCMRSIVSKQVGPSEQGKAQGCISGICSLA  414

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP--AKKSSE  222
            +++SPI  +PLT  FLS+ APF+  GF +IC     +IA   + M++   P  +++ SE
Sbjct  415  NVISPIAFSPLTALFLSEKAPFNFPGFSLICVGFAAMIAFMQSVMIRAAPPLSSRRVSE  473



>gb|EAY87003.1| hypothetical protein OsI_08398 [Oryza sativa Indica Group]
Length=452

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL+YLKA FG+ K++ + +L++ G   ++SQ+ V+P++  FVGE ++L I LL  
Sbjct  268  GLQTALLYYLKAQFGYSKDEFANLLLIAGAAGMLSQLTVMPVLARFVGEDILLIIGLLGG  327

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LYG AW+ WVPYLS  F ++   V P+    +S++  S +QG AQG ++G+ + A
Sbjct  328  CTHVFLYGIAWSYWVPYLSAVFIILSAFVHPSIRTNVSKSVGSNEQGIAQGCISGISSFA  387

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSED  219
            S+L+P+  TPLT W LS+ APF  KGF I+CA  C +IA   +  +++ A    +SE 
Sbjct  388  SILAPLIFTPLTAWVLSETAPFKFKGFSIMCAGFCTLIAFIIS--MRMRAGQSGASEK  443



>ref|XP_009334544.1| PREDICTED: uncharacterized protein LOC103927348 [Pyrus x bretschneideri]
Length=445

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 118/181 (65%), Gaps = 1/181 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +++YLKA F F+K+Q ++++++ GV   VSQ+V++PL+ P +GE+ +L I L+ S
Sbjct  260  GLHASMMYYLKAQFHFNKDQFADLMVISGVAGTVSQLVLMPLLAPALGEERLLSIGLIFS  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+  LYG AW+ WVPY +  F + Y+   P   +++S+    ++QGKAQG ++G+ ++A
Sbjct  320  CAHMFLYGIAWSFWVPYAAAMFSIFYVFAQPCMRSIVSKQVGPSEQGKAQGCISGICSLA  379

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SPI  +PLT  FLS+ APF+  GF +IC     +IA   + M++  AP+  S  +  
Sbjct  380  NVISPIAFSPLTALFLSEKAPFNFPGFSLICVGFAAMIAFIQSVMIR-AAPSLSSQRNSG  438

Query  212  E  210
             
Sbjct  439  N  439



>ref|XP_011083420.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Sesamum 
indicum]
Length=444

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 119/189 (63%), Gaps = 1/189 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F+K+Q ++++++ G+   VSQ++++P++ P +GE+ +L + L  S
Sbjct  256  GLYASLMYYLKAQFHFNKDQFADLMIIAGIAGSVSQLIIMPILTPLMGEEKMLSLGLFFS  315

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+ +LY  AWA WVPY +    V+     P   ++ S+ +  ++QGKAQG + G+ + A
Sbjct  316  CAHMILYSIAWAPWVPYAAAMISVVATFALPCLRSIASKQTGPSEQGKAQGCITGICSFA  375

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK-LDAPAKKSSEDD  216
            +++SP+  +PLT  FLSDNAPF   GF I+C+ L  +IA   + M+K    PAK  S   
Sbjct  376  NIVSPLAFSPLTALFLSDNAPFHFPGFSIMCSGLAAMIAFLQSIMIKPPPCPAKNCSNIC  435

Query  215  AESIEAPLL  189
            + S   PL+
Sbjct  436  SSSTAEPLV  444



>gb|KCW68015.1| hypothetical protein EUGRSUZ_F01701 [Eucalyptus grandis]
Length=380

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 111/168 (66%), Gaps = 0/168 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +++YLKA F F+KNQ ++++++ G+   +SQ++++PL+ P +GE  +L IAL  +
Sbjct  198  GLHASMMYYLKAQFHFNKNQFADLMVISGIAGTISQLLIMPLLAPVIGEARLLSIALFFN  257

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + +LY  AWAAWVPY +  F V+++   P    ++S    S DQGKAQG ++G+  +A
Sbjct  258  CVHMILYSVAWAAWVPYAAAMFSVLFVFAHPCMRTIVSEQVGSCDQGKAQGCISGICQLA  317

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKL  249
            +++SP+  +PLT  FLSD+APF   GF I+C     +IA   + M+++
Sbjct  318  NVVSPLVFSPLTALFLSDSAPFHFPGFSIMCVGFASMIAFIQSVMMRV  365



>ref|XP_004291324.1| PREDICTED: uncharacterized protein LOC101296167 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 112/171 (65%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ GV + +SQ+V++PL+ P +GE+ +L I LL S
Sbjct  261  GLHASLLYYLKARFHFNKDQFADLMVISGVASTISQLVLMPLLAPVLGEERLLSIGLLFS  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+   YG AW+ WVPY +  F + ++   P   +++S+    ++QGKAQG ++G+ + A
Sbjct  321  CAHMFFYGLAWSFWVPYAAAMFSIFFVFAQPCMRSIVSKQVGPSEQGKAQGCISGICSFA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            +++SP   +PLT  FLS+ APF+  GF I+C     ++A   + M+K   P
Sbjct  381  NVISPFAFSPLTALFLSEKAPFNFPGFSIVCVGFAAMVAFIQSVMIKAAPP  431



>ref|XP_010061115.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW68014.1| hypothetical protein EUGRSUZ_F01701 [Eucalyptus grandis]
Length=443

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 111/168 (66%), Gaps = 0/168 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +++YLKA F F+KNQ ++++++ G+   +SQ++++PL+ P +GE  +L IAL  +
Sbjct  261  GLHASMMYYLKAQFHFNKNQFADLMVISGIAGTISQLLIMPLLAPVIGEARLLSIALFFN  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + +LY  AWAAWVPY +  F V+++   P    ++S    S DQGKAQG ++G+  +A
Sbjct  321  CVHMILYSVAWAAWVPYAAAMFSVLFVFAHPCMRTIVSEQVGSCDQGKAQGCISGICQLA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKL  249
            +++SP+  +PLT  FLSD+APF   GF I+C     +IA   + M+++
Sbjct  381  NVVSPLVFSPLTALFLSDSAPFHFPGFSIMCVGFASMIAFIQSVMMRV  428



>ref|XP_003570066.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Brachypodium 
distachyon]
Length=458

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 108/167 (65%), Gaps = 0/167 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL+YLKA FG+ K++ + +L++ G   ++SQ+ V+P+  P VGE+++L + LL  
Sbjct  274  GLQTALLYYLKAQFGYSKDEFANLLLIAGAAGMLSQLTVMPIFAPIVGEEMLLIVGLLGG  333

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LYG AW+ WVPY + +F ++   V P+    +S++  S +QG AQG ++G+ + A
Sbjct  334  CTHVFLYGIAWSYWVPYFAAAFVILSAFVHPSIRTNVSKSVGSNEQGIAQGCISGISSFA  393

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            S+L+P+  TPLT WFLS+  PF+ KGF I+ A  C +I+   +  ++
Sbjct  394  SILAPLIFTPLTAWFLSETKPFNFKGFSIMVAGFCTLISFVISIRMR  440



>ref|XP_008788273.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008779095.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Phoenix dactylifera]
Length=365

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLK+ FGF KNQ SE+LM+VG+G++ SQI+VLP++NP +GEK +LCIAL 
Sbjct  251  MSGISGVLLYYLKSVFGFSKNQFSEILMMVGIGSVFSQILVLPVINPLIGEKGVLCIALA  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKA-QGF  417
            A IAY+LLYG AWA WVPYLS SFGVIY+L  P+TYA++S+A+ S DQ    QGF
Sbjct  311  AKIAYALLYGLAWAPWVPYLSASFGVIYVLAKPSTYAIVSKAAISMDQHNGQQGF  365



>ref|XP_010061116.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=443

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 111/168 (66%), Gaps = 0/168 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +++YLKA F F+KNQ ++++++ G+   +SQ++++PL+ P +GE  +L IAL  +
Sbjct  261  GLHASMMYYLKAQFHFNKNQFADLMVISGIAGTISQLLIMPLLAPVIGEARLLSIALFFN  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + +LY  AWAAWVPY +  F V+++   P    ++S    S DQGKAQG ++G+  +A
Sbjct  321  CVHMILYSVAWAAWVPYAAAMFSVLFVFAHPCMRTIVSEQVGSCDQGKAQGCISGICQLA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKL  249
            +++SP+  +PLT  FLSD+APF   GF I+C     +IA   + M+++
Sbjct  381  NVVSPLVFSPLTALFLSDSAPFHFPGFSIMCVGFASMIAFIQSVMMRV  428



>ref|XP_008788264.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Phoenix dactylifera]
 ref|XP_008779094.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Phoenix dactylifera]
Length=382

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            MSGI  VLL+YLK+ FGF KNQ SE+LM+VG+G++ SQI+VLP++NP +GEK +LCIAL 
Sbjct  251  MSGISGVLLYYLKSVFGFSKNQFSEILMMVGIGSVFSQILVLPVINPLIGEKGVLCIALA  310

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQ  423
            A IAY+LLYG AWA WVPYLS SFGVIY+L  P+TYA++S+A+ S DQ   Q
Sbjct  311  AKIAYALLYGLAWAPWVPYLSASFGVIYVLAKPSTYAIVSKAAISMDQHNGQ  362



>dbj|BAJ86597.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 110/168 (65%), Gaps = 0/168 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+   LL++LKA F + KNQ + +L+++G+    SQ+ V+PL+ P +GEK +L +AL  
Sbjct  205  TGLQTALLYFLKAQFHYTKNQYANLLLIIGITGSFSQLTVMPLLAPKLGEKKLLVVALTG  264

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            S  +  LY  AW+ WVPYL+ S  ++ ILV+P   +++S+    ++QG  QG + G+ + 
Sbjct  265  SCVHGFLYSIAWSFWVPYLAASCVILSILVSPCIRSIVSKKVGPSEQGMVQGCITGISST  324

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            AS++SP+  TPLT WFLS+ APF+ KGF + CA    ++AL  +  ++
Sbjct  325  ASVISPLVFTPLTAWFLSETAPFNFKGFSLACAGFATLVALTMSINMR  372



>ref|XP_008791950.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Phoenix 
dactylifera]
Length=444

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 114/177 (64%), Gaps = 0/177 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S+  SG+ + LL++LKA F F K+Q +++L+++G+    SQ++++ L+ P + E+ +L 
Sbjct  254  NSFAESGVQSALLYFLKAQFQFSKDQFADLLLIIGIAGAFSQLLLMHLLIPTLDEEKLLN  313

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I LLAS A+  LY  AW+ WVPYL+  F V+ I + P   +++S+     +QG AQG + 
Sbjct  314  IGLLASCAHLFLYSIAWSYWVPYLAAIFVVLSIFIQPCIRSIVSKKVGPNEQGMAQGCIT  373

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            G+ + AS++SP   TPLT WFLS++APF  KGF I+CA    +IA   + M++   P
Sbjct  374  GISSFASIISPFIFTPLTAWFLSEDAPFKFKGFSIMCAGFASLIAFVLSIMMRAAPP  430



>ref|XP_008387898.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Malus 
domestica]
Length=445

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 118/181 (65%), Gaps = 1/181 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A ++++LKA F F+K+Q ++++++ GV   VSQ+V++PL+ P +GE+ +L I LL S
Sbjct  260  GLHASMMYFLKARFHFNKDQFADLMVISGVAGTVSQLVLMPLLAPALGEERLLSIGLLFS  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+  LYG AW+ WVPY +  F + ++   P   +++S+    ++QGKAQG ++G+ ++A
Sbjct  320  CAHMFLYGIAWSFWVPYAAAMFSIFFVFAQPCMRSIVSKQIGPSEQGKAQGCISGICSLA  379

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SPI  +PLT  FLS+ APF+  GF +IC     +IA   + M++  AP+  S  +  
Sbjct  380  NVISPIAFSPLTALFLSEKAPFNFPGFSLICVGFAAMIAFIQSVMIR-AAPSLSSQRNSG  438

Query  212  E  210
             
Sbjct  439  N  439



>emb|CDY02382.1| BnaA02g22910D [Brassica napus]
Length=438

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 114/177 (64%), Gaps = 0/177 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S   +G+ A  ++YLKA F F+K+Q ++++++ G+   VSQ++ +P++ P + E+ +L 
Sbjct  255  SSLSEAGLHASSMYYLKAKFHFNKDQFADLMIIFGIAGSVSQLLFMPILIPALKEEKLLS  314

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L    A+  L G AW+AWVPY++  F ++ I       +++S+  +S +QGKAQG ++
Sbjct  315  IGLFFGCAHMFLLGMAWSAWVPYMAAMFSLVSIFPQSCMRSIVSKQVTSYEQGKAQGIIS  374

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             + ++A+++SP+  +PLT WFLS+ APF+  GF ++CA   M IA   + M++   P
Sbjct  375  SICSLANVISPLAFSPLTGWFLSERAPFNFPGFSLMCAGFTMTIAFILSLMIRATTP  431



>ref|XP_011034953.1| PREDICTED: uncharacterized protein LOC105132907 isoform X3 [Populus 
euphratica]
Length=375

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 113/185 (61%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F K+Q ++++++ G+   VSQ+V++PL+ P +GE  +L + L  +
Sbjct  191  GLHASLMYYLKAQFHFSKDQFADLMVISGIAGTVSQLVIMPLLTPALGEARLLAVGLFFT  250

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW  WVPY++  F ++++   P   +++S+   S +QGKAQG ++G+ + A
Sbjct  251  CVHVFLYSIAWTFWVPYVASMFSLLFVFSQPCMRSIVSKQVGSYEQGKAQGCISGISSFA  310

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       +A
Sbjct  311  NVISPLVFSPLTALFLSERAPFPFPGFSIMCVGFASMIAFIQSLMMRTAPPIANQKVVNA  370

Query  212  ESIEA  198
              ++A
Sbjct  371  NYVDA  375



>ref|XP_010918153.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Elaeis guineensis]
Length=404

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 119/191 (62%), Gaps = 0/191 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S+  SG+   LL++LKA F F K+Q +++L++ G+    SQ+V++ L+ P + E+ +L 
Sbjct  214  NSFAESGVQCALLYFLKAQFQFSKDQFADLLLIGGIAGAFSQLVLMHLLIPTLDEEKLLN  273

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I LLAS A+  LY  AW+ WVPYL+  F ++ + + P   ++IS+    ++QG AQG + 
Sbjct  274  IGLLASCAHIFLYSIAWSYWVPYLAAIFILLSVFIQPCIRSIISKKVGPSEQGMAQGCIT  333

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            G+ + A+++SP+  TPLT WFLS++APF  KGF I+CA    +IA   + M++   P   
Sbjct  334  GIGSFATIMSPLLFTPLTAWFLSEDAPFKFKGFSIMCAGFASLIAFMLSIMMRAAPPTTS  393

Query  230  SSEDDAESIEA  198
                +A  ++A
Sbjct  394  QKLVNAVYVQA  404



>gb|EYU17555.1| hypothetical protein MIMGU_mgv1a006533mg [Erythranthe guttata]
Length=440

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 113/177 (64%), Gaps = 0/177 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F+KNQ ++++++ G+   +SQ++++P++ P +GE+ +L + L  S
Sbjct  255  GLHASLMYYLKAQFHFNKNQFADLMIIAGMAGSISQLILMPILTPLMGEEKMLSLGLFFS  314

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+ +LY  AWA WVPY +    V+     P   ++ S+ +  ++QGKAQG + G+ + +
Sbjct  315  FAHMILYSVAWAPWVPYAAAMISVLATFAIPCLRSIASKQTGPSEQGKAQGCITGICSFS  374

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSE  222
            +++SP+  +PLT  FLSDNAPF   GF I+C+ L  ++A   + M++   P  K S 
Sbjct  375  NIVSPLAFSPLTALFLSDNAPFYYPGFSIMCSGLAAMVAFVQSVMIRPPPPPAKDSS  431



>ref|XP_011003093.1| PREDICTED: uncharacterized protein LOC105109921 [Populus euphratica]
Length=447

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 115/185 (62%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ G+   +SQ+V++P++ P +GE  +L + L  +
Sbjct  263  GLHASLLYYLKARFHFNKDQFADLMVITGIAGTLSQLVLMPILAPALGEARLLAVGLFFT  322

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW  WVPY++  F V+++   P   +++S+   S +QGKAQG ++G+ + A
Sbjct  323  CVHVFLYSIAWTFWVPYVAAMFSVLFVFSQPCMRSIVSKQVGSCEQGKAQGCISGISSFA  382

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IA   + M+++  P       ++
Sbjct  383  NVISPLLFSPLTALFLSERAPFHFPGFSIMCVGFASMIAFIQSLMIRIAPPIANEKVCNS  442

Query  212  ESIEA  198
              ++A
Sbjct  443  NYVDA  447



>ref|XP_011034952.1| PREDICTED: uncharacterized protein LOC105132907 isoform X2 [Populus 
euphratica]
Length=450

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 113/185 (61%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F K+Q ++++++ G+   VSQ+V++PL+ P +GE  +L + L  +
Sbjct  266  GLHASLMYYLKAQFHFSKDQFADLMVISGIAGTVSQLVIMPLLTPALGEARLLAVGLFFT  325

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW  WVPY++  F ++++   P   +++S+   S +QGKAQG ++G+ + A
Sbjct  326  CVHVFLYSIAWTFWVPYVASMFSLLFVFSQPCMRSIVSKQVGSYEQGKAQGCISGISSFA  385

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       +A
Sbjct  386  NVISPLVFSPLTALFLSERAPFPFPGFSIMCVGFASMIAFIQSLMMRTAPPIANQKVVNA  445

Query  212  ESIEA  198
              ++A
Sbjct  446  NYVDA  450



>ref|XP_010918152.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Elaeis guineensis]
Length=445

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 119/191 (62%), Gaps = 0/191 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S+  SG+   LL++LKA F F K+Q +++L++ G+    SQ+V++ L+ P + E+ +L 
Sbjct  255  NSFAESGVQCALLYFLKAQFQFSKDQFADLLLIGGIAGAFSQLVLMHLLIPTLDEEKLLN  314

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I LLAS A+  LY  AW+ WVPYL+  F ++ + + P   ++IS+    ++QG AQG + 
Sbjct  315  IGLLASCAHIFLYSIAWSYWVPYLAAIFILLSVFIQPCIRSIISKKVGPSEQGMAQGCIT  374

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            G+ + A+++SP+  TPLT WFLS++APF  KGF I+CA    +IA   + M++   P   
Sbjct  375  GIGSFATIMSPLLFTPLTAWFLSEDAPFKFKGFSIMCAGFASLIAFMLSIMMRAAPPTTS  434

Query  230  SSEDDAESIEA  198
                +A  ++A
Sbjct  435  QKLVNAVYVQA  445



>ref|XP_011034951.1| PREDICTED: uncharacterized protein LOC105132907 isoform X1 [Populus 
euphratica]
Length=457

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 113/185 (61%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F K+Q ++++++ G+   VSQ+V++PL+ P +GE  +L + L  +
Sbjct  273  GLHASLMYYLKAQFHFSKDQFADLMVISGIAGTVSQLVIMPLLTPALGEARLLAVGLFFT  332

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW  WVPY++  F ++++   P   +++S+   S +QGKAQG ++G+ + A
Sbjct  333  CVHVFLYSIAWTFWVPYVASMFSLLFVFSQPCMRSIVSKQVGSYEQGKAQGCISGISSFA  392

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       +A
Sbjct  393  NVISPLVFSPLTALFLSERAPFPFPGFSIMCVGFASMIAFIQSLMMRTAPPIANQKVVNA  452

Query  212  ESIEA  198
              ++A
Sbjct  453  NYVDA  457



>ref|XP_006422528.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
 gb|ESR35768.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
Length=445

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 112/179 (63%), Gaps = 1/179 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A  L++LKA F F+KNQ ++++++ G+   +SQ++ +PL+ P +GE  +L + L A+
Sbjct  264  GMQASFLYFLKAQFHFNKNQFADLMLIAGLAGTISQLLFMPLLAPILGEAKLLSLGLFAA  323

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +   +W+AWVPY + +F V+ +  TP+  +++S+     +QGKAQG ++G+ + A
Sbjct  324  CINMFICSISWSAWVPYATTAFSVLVVFATPSFRSIVSKQVGPNEQGKAQGCISGISSFA  383

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            +++SP+  +PLT  FLS  APF+  GF I+C  L  ++A   + M+    PA   S++ 
Sbjct  384  NIVSPLIFSPLTALFLSKGAPFNFPGFSIMCIGLASMVAFIQSLMMS-HTPASSKSQNQ  441



>gb|KDO68185.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=444

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 112/179 (63%), Gaps = 1/179 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A  L++LKA F F+KNQ ++++++ G+   +SQ++ +PL+ P +GE  +L + L A+
Sbjct  263  GMQASFLYFLKAQFHFNKNQFADLMLIAGLAGTISQLLFMPLLAPILGEAKLLSLGLFAA  322

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +   +W+AWVPY + +F V+ +  TP+  +++S+     +QGKAQG ++G+ + A
Sbjct  323  CINMFICSISWSAWVPYATTAFSVLVVFATPSFRSIVSKQVGPNEQGKAQGCISGISSFA  382

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            +++SP+  +PLT  FLS  APF+  GF I+C  L  ++A   + M+    PA   S++ 
Sbjct  383  NIVSPLIFSPLTALFLSKGAPFNFPGFSIMCIGLASMVAFIQSLMMS-HTPASSKSQNQ  440



>ref|XP_006486681.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Citrus sinensis]
 gb|KDO68184.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=445

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 112/179 (63%), Gaps = 1/179 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A  L++LKA F F+KNQ ++++++ G+   +SQ++ +PL+ P +GE  +L + L A+
Sbjct  264  GMQASFLYFLKAQFHFNKNQFADLMLIAGLAGTISQLLFMPLLAPILGEAKLLSLGLFAA  323

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +   +W+AWVPY + +F V+ +  TP+  +++S+     +QGKAQG ++G+ + A
Sbjct  324  CINMFICSISWSAWVPYATTAFSVLVVFATPSFRSIVSKQVGPNEQGKAQGCISGISSFA  383

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            +++SP+  +PLT  FLS  APF+  GF I+C  L  ++A   + M+    PA   S++ 
Sbjct  384  NIVSPLIFSPLTALFLSKGAPFNFPGFSIMCIGLASMVAFIQSLMMS-HTPASSKSQNQ  441



>ref|XP_004292638.2| PREDICTED: uncharacterized protein LOC101306408 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 108/176 (61%), Gaps = 0/176 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   ++++LKA F FDKNQ S+++++VG+   +SQ++++P++ P + E+ +L   LL S
Sbjct  284  GMQVTVMYFLKARFQFDKNQFSDIMLLVGIAGAISQMILIPMLAPKIREEKMLSFGLLLS  343

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   AWA WVPY +  F    +L  P  +++ S+    T+QGKAQG +AG+ + A
Sbjct  344  CISMFLNSVAWAPWVPYAATVFSSFGLLAQPTIHSIASKQVGPTEQGKAQGCMAGISSFA  403

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS  225
            +++SP+  +PLT  FLS +AP +  GF I+C  L  VIAL  + M++   P    S
Sbjct  404  NIVSPLVFSPLTALFLSKDAPLNFPGFSIMCLGLATVIALIQSTMIRASPPISSHS  459



>ref|XP_007201037.1| hypothetical protein PRUPE_ppa005784mg [Prunus persica]
 gb|EMJ02236.1| hypothetical protein PRUPE_ppa005784mg [Prunus persica]
Length=444

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 106/167 (63%), Gaps = 0/167 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L+++LKA F F+KNQ ++++++VG+   VSQ++ +P++ P +GE+ +L I LL  
Sbjct  260  GLQASLMYFLKARFHFNKNQFADLMLIVGISGTVSQLLFMPMLAPVIGEEKLLSIGLLVG  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   +WA WVPY +  F     LV P+  ++ S+     +QGKAQG ++G+ + A
Sbjct  320  SFNMFLNSISWAVWVPYAATLFSAFGFLVQPSIRSIASKQVGPNEQGKAQGCISGISSFA  379

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            +++SP+  +PLT  FLS+ APF   GF I+C  L M+IA   + M++
Sbjct  380  NIVSPLIFSPLTALFLSEEAPFYFPGFSIMCIGLAMIIAFVQSTMIR  426



>ref|XP_003523261.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Glycine max]
 gb|KHN45961.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=432

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 109/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL++LKA F FDKNQ ++++++ G+   VSQ++++P++ P +GE  +L + L   
Sbjct  259  GLHGSLLYFLKAQFHFDKNQFADLMVISGIAGTVSQLLLMPILAPILGETRLLSVGLFFH  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW++ VPY S  F ++Y+   P   +++S+ +   +QGKAQG ++G+ +IA
Sbjct  319  CVHMFLYSMAWSSLVPYASAMFSILYVFSHPCIRSIVSKEAGPHEQGKAQGCISGICSIA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             ++SP+  +PLT  FLS+ APFD  GF I+C     +I+   + ML++  P
Sbjct  379  HIVSPLVFSPLTALFLSEKAPFDFPGFSIMCIGFASMISFVQSLMLRVAPP  429



>ref|XP_006435264.1| hypothetical protein CICLE_v10001166mg [Citrus clementina]
 ref|XP_006473723.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Citrus 
sinensis]
 gb|ESR48504.1| hypothetical protein CICLE_v10001166mg [Citrus clementina]
 gb|KDO84972.1| hypothetical protein CISIN_1g013411mg [Citrus sinensis]
Length=443

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 112/178 (63%), Gaps = 0/178 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+   +++YLKA F F+KNQ ++++++ G+   +SQ++++P++ P VGE  +L   LL 
Sbjct  256  AGLQGSMMYYLKAKFHFNKNQFADLMVIAGIAGTISQLIMMPVLAPTVGEARLLSFGLLF  315

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
               +  LY  AW++WVPY +  F ++ +   P    ++S+  +S +QGKAQG ++G+ + 
Sbjct  316  GCVHMFLYSVAWSSWVPYAAAVFSILSVFSHPCLRTIVSKQVASNEQGKAQGCISGICSF  375

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSE  222
            A+L+SP+  +PLT  FLSD APF+  GF I+C     + A   + M+++  P   SS+
Sbjct  376  ANLVSPLAFSPLTALFLSDRAPFNFPGFSIMCIGFVSMTAFIQSIMIRVAPPLPVSSQ  433



>gb|KHN20137.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=432

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL++LKA F FDKNQ ++++++ G+   VSQ++++P++ P +GE  +L + L   
Sbjct  259  GLHGSLLYFLKAQFHFDKNQFADLMVISGIAGTVSQLILMPILAPILGEARLLSVGLFFH  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW++ VPY S  F ++++   P   +++S+ +   +QGKAQG ++G+ +IA
Sbjct  319  CIHMFLYSIAWSSLVPYASAMFSILFVFSHPCIRSIVSKQAGPHEQGKAQGCISGICSIA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             ++SP+  +PLT  FLS+ APFD  GF I+C     +I+L  + ML++  P
Sbjct  379  HIVSPLVFSPLTALFLSERAPFDFPGFSIMCIGFASMISLVQSMMLRVVPP  429



>ref|XP_010028772.1| PREDICTED: uncharacterized protein LOC104418982 [Eucalyptus grandis]
Length=440

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL++LKA F F+K Q ++++++VGV   +SQ+V +PL+ P +GEK +L I L   
Sbjct  259  GLQTSLLYFLKARFHFNKTQFADLMLIVGVAGALSQLVFMPLLAPVLGEKRLLSIGLFVG  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             +   LY  AWAAWVPY +  F +  + V+P   ++ S+     +QGKAQG ++G+ + A
Sbjct  319  FSNMFLYSLAWAAWVPYATTVFSLFVVFVSPCIRSIASKQFGPFEQGKAQGCLSGISSFA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            +++SP+  +PLT  FLSD APF   GF ++C  L +++A   + M++
Sbjct  379  NIVSPLIFSPLTALFLSDEAPFPYPGFSLLCIGLALMVAFVQSLMIR  425



>ref|XP_003527649.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Glycine max]
Length=432

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL++LKA F FDKNQ ++++++ G+   VSQ++++P++ P +GE  +L + L   
Sbjct  259  GLHGSLLYFLKAQFHFDKNQFADLMVISGIAGTVSQLLLMPILAPILGEARLLSVGLFFH  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW++ VPY S  F ++++   P   +++S+ +   +QGKAQG ++G+ +IA
Sbjct  319  CIHMFLYSIAWSSLVPYASAMFSILFVFSHPCIRSIVSKQAGPHEQGKAQGCISGICSIA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             ++SP+  +PLT  FLS+ APFD  GF I+C     +I+L  + ML++  P
Sbjct  379  HIVSPLVFSPLTALFLSERAPFDFPGFSIMCIGFASMISLVQSMMLRVVPP  429



>ref|XP_009400334.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Musa 
acuminata subsp. malaccensis]
Length=434

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 106/161 (66%), Gaps = 0/161 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            SG  + LL+YLKA F F+K+Q +++L++ G     SQ++++P + P +GE+ +L + LLA
Sbjct  257  SGFQSALLYYLKAQFHFNKDQFADLLLIAGGAGAFSQLLLMPSLAPAIGEERLLNVGLLA  316

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            S  +  LY  AW+ WVPY + +F ++ + + P   +++S+   S +QG AQG + G+ + 
Sbjct  317  SCTHIFLYSIAWSYWVPYFASTFVILGVFIHPCIRSIVSKKVRSNEQGMAQGCITGIASF  376

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIAL  273
            AS+LSP+  TPLT  FLS+NAPF  KGF I+CA    ++A 
Sbjct  377  ASILSPLAFTPLTALFLSENAPFTFKGFSIMCAGFASLLAF  417



>ref|XP_008785091.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Phoenix 
dactylifera]
Length=418

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 114/178 (64%), Gaps = 0/178 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S   SG+   +L+YLKA F F K+Q +++L+++G+    SQ+ ++ L+ P +GE+ +L 
Sbjct  228  NSLAESGLQGAILYYLKAQFQFSKDQFADLLLILGIAGAFSQLFLMHLLIPTLGEEKLLN  287

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I LLAS A+  LY  +W+ WVPYL+  F V+ + + P   +++S+    ++QG AQG + 
Sbjct  288  IGLLASCAHIFLYSISWSYWVPYLAAVFVVLTVFMQPCIRSIVSKKVGPSEQGMAQGCIT  347

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPA  237
            GV + A+++SP+  TPLT WFLS++APF  KGF I+C     +IA   + M++   P+
Sbjct  348  GVSSFATIVSPLVFTPLTAWFLSEDAPFKFKGFSIMCVGFASLIAFMLSIMMRAAPPS  405



>ref|XP_002306959.1| hypothetical protein POPTR_0005s26720g [Populus trichocarpa]
 gb|EEE93955.1| hypothetical protein POPTR_0005s26720g [Populus trichocarpa]
Length=447

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 114/185 (62%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ G+   +SQ+V++P++ P +GE  +L + L  +
Sbjct  263  GLHASLLYYLKARFHFNKDQFADLMVITGIAGTLSQLVLMPILAPALGEARLLAVGLFFT  322

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW  WVPY++  F V+ +   P   +++S+   S +QGKAQG ++G+ + A
Sbjct  323  CVHVFLYSIAWTFWVPYVAAMFSVLIVFSQPCMRSIVSKQVGSCEQGKAQGCISGISSFA  382

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IA   + M+++  P       ++
Sbjct  383  NVISPLLFSPLTALFLSERAPFHFPGFSIMCVGFASMIAFIQSLMIRIAPPIANEKVCNS  442

Query  212  ESIEA  198
              ++A
Sbjct  443  NYVDA  447



>ref|XP_010943478.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Elaeis 
guineensis]
Length=443

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 115/183 (63%), Gaps = 1/183 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S   SG+ + LL+YLKA F F K+Q +++L+++G+    SQ+ ++ L+ P +GE+ +L 
Sbjct  253  NSLAESGLQSALLYYLKAQFQFSKDQFADLLLIIGIAGAFSQLFLMHLLIPTLGEEKLLN  312

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I LLAS A+  LY  AW+ WVPYL+  F V+ + + P   +++S+    ++QG  QG + 
Sbjct  313  IGLLASCAHIFLYSIAWSYWVPYLAAIFIVLSVFIQPCIRSIVSKKVGPSEQGMVQGCIT  372

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            G+ + A+++SP+  TPLT WFLS++AP   KGF I+C     +IA   + M++  AP   
Sbjct  373  GISSFAAIVSPLAFTPLTAWFLSEDAPIKFKGFSILCVGFVSLIAFMLSIMMR-SAPPST  431

Query  230  SSE  222
            S +
Sbjct  432  SQK  434



>ref|XP_008382447.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Malus domestica]
 ref|XP_008382448.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Malus domestica]
Length=442

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 110/182 (60%), Gaps = 1/182 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL++LKA F F+KNQ ++++++  V    SQ++ +P++ P +GE+ +L I LL  
Sbjct  261  GMQASLLYFLKARFHFNKNQFADLMLIFSVSGATSQLLFMPMLAPAIGEEKLLTIGLLMG  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   +WA WVPY +  F V   LV P+  +++S+     DQGKAQG + G+ + A
Sbjct  321  SICMFLNSISWAVWVPYAATLFNVFGYLVQPSIRSIVSKQVGPHDQGKAQGCILGISSFA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF+  GF I+C  L  +I    + M+K  +P K SS    
Sbjct  381  NIVSPLLFSPLTALFLSEEAPFNFPGFSIMCMGLAPMIGFVQSLMIK-ASPKKXSSNVCV  439

Query  212  ES  207
            ES
Sbjct  440  ES  441



>gb|KJB14353.1| hypothetical protein B456_002G120900 [Gossypium raimondii]
Length=364

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ G+   VSQ++++P++ P +GE  +L I L  +
Sbjct  184  GLHASLLYYLKARFHFNKDQFADLMVITGIAGTVSQLLLMPILAPVLGEAKLLSIGLFFN  243

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + +LY  AW+ WVPY +  F ++Y+   P   +++S+     +QGKAQGF++G+ + A
Sbjct  244  CVHMILYSIAWSFWVPYAAALFSLLYVFSQPCIRSIVSKQVGPCEQGKAQGFISGIGSFA  303

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++ SP+  +PLT  FLS+ APF+  GF I+C     +IA   + M++   P
Sbjct  304  NVASPLLFSPLTALFLSERAPFNFPGFSIMCVGFASMIAFVQSLMIRAFPP  354



>gb|KCW55587.1| hypothetical protein EUGRSUZ_I01458 [Eucalyptus grandis]
Length=517

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   LL++LKA F F+K Q ++++++VGV   +SQ+V +PL+ P +GEK +L I L   
Sbjct  336  GLQTSLLYFLKARFHFNKTQFADLMLIVGVAGALSQLVFMPLLAPVLGEKRLLSIGLFVG  395

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             +   LY  AWAAWVPY +  F +  + V+P   ++ S+     +QGKAQG ++G+ + A
Sbjct  396  FSNMFLYSLAWAAWVPYATTVFSLFVVFVSPCIRSIASKQFGPFEQGKAQGCLSGISSFA  455

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            +++SP+  +PLT  FLSD APF   GF ++C  L +++A   + M++
Sbjct  456  NIVSPLIFSPLTALFLSDEAPFPYPGFSLLCIGLALMVAFVQSLMIR  502



>gb|KJB32683.1| hypothetical protein B456_005G255500 [Gossypium raimondii]
Length=380

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 119/184 (65%), Gaps = 1/184 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F F+KNQ ++++++ G+ + VSQ+ ++PL+   +G+  +L I LL S
Sbjct  197  GMICSIMYYLKARFHFNKNQFADLMLIAGIISTVSQLFIMPLLVSPIGDGRLLSIGLLVS  256

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
               S+    AW+AWVPY + +  ++ +  TP+  ++IS+   +T+QGKAQG ++GV ++A
Sbjct  257  CLNSIFNSLAWSAWVPYATTALSIVMVFTTPSLRSIISKQVGTTEQGKAQGCISGVTSLA  316

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++++P+  +PLT  FLS+ APF   GF I+C ++ ++IA   +  +    P+    E+ +
Sbjct  317  NIIAPLIFSPLTALFLSEEAPFHFPGFSILCIAITLMIAFIQSLTIG-KTPSNSRDENCS  375

Query  212  ESIE  201
             S+E
Sbjct  376  NSME  379



>ref|XP_007017916.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY15141.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=443

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 112/185 (61%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ GV   +SQ++++P++ P +GE+ +L I L  S
Sbjct  259  GLHASLLYYLKARFHFNKDQFADLMVITGVAGTISQLLLMPVLAPALGEERLLAIGLFFS  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+   Y  AW+ WVPY +  F + Y+   P   +++S+     +QGKAQGF++G+ + A
Sbjct  319  CAHMFFYSIAWSVWVPYAAAVFSLFYVFSQPCIRSIVSKQVGPCEQGKAQGFISGIGSFA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++ SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       + 
Sbjct  379  NVASPLIFSPLTALFLSEGAPFYFPGFSIMCVGFASMIAFFQSLMIRAVPPISSQRVGNY  438

Query  212  ESIEA  198
              +EA
Sbjct  439  NCMEA  443



>gb|EYU37985.1| hypothetical protein MIMGU_mgv1a006613mg [Erythranthe guttata]
Length=437

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 107/182 (59%), Gaps = 0/182 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+   LL++LKA FGF K+Q ++VL++  +GA +S ++ +P + P +GE+ +L + L A
Sbjct  255  AGLQTCLLYFLKARFGFMKDQFADVLLIAYIGATISNMLFMPTLGPRIGEETLLSLGLFA  314

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
                      AWA WVPY S S G+   L  P   ++IS+     +QG AQG + G+ A 
Sbjct  315  GFLNMFFDSIAWAPWVPYASASMGLFLFLSAPNLRSIISKQVGPNEQGLAQGSILGITAF  374

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            A+++SP+  +PL+  FLS++APFD KGF I+C  L  +     + M+ + +  +K +   
Sbjct  375  ANVISPLMYSPLSALFLSEDAPFDFKGFSILCVGLAWLAGFFLSIMIPILSKRRKITHIS  434

Query  215  AE  210
             E
Sbjct  435  VE  436



>ref|XP_004497200.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cicer 
arietinum]
Length=445

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 111/171 (65%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ AVLL+YLKA F ++KNQ ++++M+ G+GA ++Q+ ++P++ P VGE+ +L   L  S
Sbjct  257  GLMAVLLYYLKARFQYNKNQFADLMMISGIGATLTQLFLMPILVPAVGEEKLLTTGLFVS  316

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +Y  +W+AWVPY    F V+ +LV P   ++ S+     +QG  QG ++G+ ++A
Sbjct  317  CINIFMYSISWSAWVPYALAGFSVLGVLVRPTITSIASKQVGPNEQGMVQGCLSGITSVA  376

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            +++SP+  +PLT  FLS++APF+  GF ++C  L ++ A   + M++   P
Sbjct  377  NIISPLIFSPLTALFLSEDAPFNFPGFSLMCLGLILMTAFFLSLMIRAPPP  427



>ref|NP_199036.2| major facilitator protein [Arabidopsis thaliana]
 gb|AED94780.1| major facilitator protein [Arabidopsis thaliana]
Length=282

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 113/177 (64%), Gaps = 0/177 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S   +G+ A  ++YLKA F F+K+Q ++++++VG    +SQ++ +P++ P + E+ +L 
Sbjct  99   SSLAEAGLHASSMYYLKAKFHFNKDQFADLMIIVGASGSISQLLFMPVLVPALKEERLLS  158

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L    A+  L   AW++WVPY++  F +  I  +    +++S+  +S +QGKAQG ++
Sbjct  159  IGLFFGCAHMFLLCVAWSSWVPYMAAIFALFSIFPSSCMRSIVSKQVASYEQGKAQGIIS  218

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             + ++A+++SP+  +PLT WFLS+ APF+  GF I+CA   M IA   + M++   P
Sbjct  219  SICSLANVISPLAFSPLTDWFLSERAPFNFPGFSIMCAGFAMTIAFIQSLMIRAATP  275



>ref|XP_006386158.1| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
 gb|ABK95031.1| unknown [Populus trichocarpa]
 gb|ERP63955.1| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
Length=450

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 112/185 (61%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F K+Q + ++++ G+   VSQ+V++PL+ P +GE  +L + L  +
Sbjct  266  GLHASLMYYLKAQFHFSKDQFAVLMVISGIAGTVSQLVIMPLLTPALGEARLLAVGLFFT  325

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW  WVPY++  F ++++   P   +++S+   S +QGKAQG ++G+ + A
Sbjct  326  CVHVFLYSIAWTFWVPYVASMFSLLFVFSQPCMRSIVSKQVGSCEQGKAQGCISGISSFA  385

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       ++
Sbjct  386  NVISPLVFSPLTALFLSERAPFPFPGFSIMCVGFASMIAFIQSLMMRTAPPIANQKVVNS  445

Query  212  ESIEA  198
              ++A
Sbjct  446  NYVDA  450



>gb|KJB14351.1| hypothetical protein B456_002G120900 [Gossypium raimondii]
 gb|KJB14352.1| hypothetical protein B456_002G120900 [Gossypium raimondii]
Length=439

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ G+   VSQ++++P++ P +GE  +L I L  +
Sbjct  259  GLHASLLYYLKARFHFNKDQFADLMVITGIAGTVSQLLLMPILAPVLGEAKLLSIGLFFN  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + +LY  AW+ WVPY +  F ++Y+   P   +++S+     +QGKAQGF++G+ + A
Sbjct  319  CVHMILYSIAWSFWVPYAAALFSLLYVFSQPCIRSIVSKQVGPCEQGKAQGFISGIGSFA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++ SP+  +PLT  FLS+ APF+  GF I+C     +IA   + M++   P
Sbjct  379  NVASPLLFSPLTALFLSERAPFNFPGFSIMCVGFASMIAFVQSLMIRAFPP  429



>ref|XP_007017915.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY15140.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=520

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 112/185 (61%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ GV   +SQ++++P++ P +GE+ +L I L  S
Sbjct  336  GLHASLLYYLKARFHFNKDQFADLMVITGVAGTISQLLLMPVLAPALGEERLLAIGLFFS  395

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+   Y  AW+ WVPY +  F + Y+   P   +++S+     +QGKAQGF++G+ + A
Sbjct  396  CAHMFFYSIAWSVWVPYAAAVFSLFYVFSQPCIRSIVSKQVGPCEQGKAQGFISGIGSFA  455

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++ SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       + 
Sbjct  456  NVASPLIFSPLTALFLSEGAPFYFPGFSIMCVGFASMIAFFQSLMIRAVPPISSQRVGNY  515

Query  212  ESIEA  198
              +EA
Sbjct  516  NCMEA  520



>ref|XP_006342707.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=440

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 117/186 (63%), Gaps = 1/186 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+D+ LL++LKA F F+KNQ +++L++ G+   +SQ++++P++ P +GE+ +L + L  S
Sbjct  256  GLDSSLLYFLKAQFHFNKNQFADLLIISGIAGSISQLLLMPILVPALGEEKLLSVGLFFS  315

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY  AW++WVPY S    V+ I V P   ++ S+     +QGK QG + G+ + A
Sbjct  316  CVHILLYSIAWSSWVPYASALISVMSIFVMPCLKSIASKQVGPNEQGKVQGCITGICSFA  375

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            S++SP+  +PLT  FLSD+APF   GFG+ CA+  ++IA   + M+    P    S  ++
Sbjct  376  SVVSPLIFSPLTALFLSDHAPFHFPGFGLTCAAFALMIAFIESFMISSACPVIDCSLSNS  435

Query  212  ESIEAP  195
            +  E P
Sbjct  436  D-FEQP  440



>ref|XP_002301947.2| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
 gb|EEE81220.2| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
Length=474

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 112/185 (61%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F K+Q + ++++ G+   VSQ+V++PL+ P +GE  +L + L  +
Sbjct  290  GLHASLMYYLKAQFHFSKDQFAVLMVISGIAGTVSQLVIMPLLTPALGEARLLAVGLFFT  349

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW  WVPY++  F ++++   P   +++S+   S +QGKAQG ++G+ + A
Sbjct  350  CVHVFLYSIAWTFWVPYVASMFSLLFVFSQPCMRSIVSKQVGSCEQGKAQGCISGISSFA  409

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       ++
Sbjct  410  NVISPLVFSPLTALFLSERAPFPFPGFSIMCVGFASMIAFIQSLMMRTAPPIANQKVVNS  469

Query  212  ESIEA  198
              ++A
Sbjct  470  NYVDA  474



>gb|KJB32681.1| hypothetical protein B456_005G255500 [Gossypium raimondii]
Length=443

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 119/184 (65%), Gaps = 1/184 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F F+KNQ ++++++ G+ + VSQ+ ++PL+   +G+  +L I LL S
Sbjct  260  GMICSIMYYLKARFHFNKNQFADLMLIAGIISTVSQLFIMPLLVSPIGDGRLLSIGLLVS  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
               S+    AW+AWVPY + +  ++ +  TP+  ++IS+   +T+QGKAQG ++GV ++A
Sbjct  320  CLNSIFNSLAWSAWVPYATTALSIVMVFTTPSLRSIISKQVGTTEQGKAQGCISGVTSLA  379

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++++P+  +PLT  FLS+ APF   GF I+C ++ ++IA   +  +    P+    E+ +
Sbjct  380  NIIAPLIFSPLTALFLSEEAPFHFPGFSILCIAITLMIAFIQSLTIG-KTPSNSRDENCS  438

Query  212  ESIE  201
             S+E
Sbjct  439  NSME  442



>gb|KJB32680.1| hypothetical protein B456_005G255500 [Gossypium raimondii]
 gb|KJB32682.1| hypothetical protein B456_005G255500 [Gossypium raimondii]
Length=444

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 119/184 (65%), Gaps = 1/184 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F F+KNQ ++++++ G+ + VSQ+ ++PL+   +G+  +L I LL S
Sbjct  261  GMICSIMYYLKARFHFNKNQFADLMLIAGIISTVSQLFIMPLLVSPIGDGRLLSIGLLVS  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
               S+    AW+AWVPY + +  ++ +  TP+  ++IS+   +T+QGKAQG ++GV ++A
Sbjct  321  CLNSIFNSLAWSAWVPYATTALSIVMVFTTPSLRSIISKQVGTTEQGKAQGCISGVTSLA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++++P+  +PLT  FLS+ APF   GF I+C ++ ++IA   +  +    P+    E+ +
Sbjct  381  NIIAPLIFSPLTALFLSEEAPFHFPGFSILCIAITLMIAFIQSLTIG-KTPSNSRDENCS  439

Query  212  ESIE  201
             S+E
Sbjct  440  NSME  443



>gb|KJB14354.1| hypothetical protein B456_002G120900 [Gossypium raimondii]
Length=501

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ G+   VSQ++++P++ P +GE  +L I L  +
Sbjct  321  GLHASLLYYLKARFHFNKDQFADLMVITGIAGTVSQLLLMPILAPVLGEAKLLSIGLFFN  380

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + +LY  AW+ WVPY +  F ++Y+   P   +++S+     +QGKAQGF++G+ + A
Sbjct  381  CVHMILYSIAWSFWVPYAAALFSLLYVFSQPCIRSIVSKQVGPCEQGKAQGFISGIGSFA  440

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++ SP+  +PLT  FLS+ APF+  GF I+C     +IA   + M++   P
Sbjct  441  NVASPLLFSPLTALFLSERAPFNFPGFSIMCVGFASMIAFVQSLMIRAFPP  491



>ref|XP_002284761.1| PREDICTED: hippocampus abundant transcript 1 protein [Vitis vinifera]
 emb|CBI18912.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 110/185 (59%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   L++YLKA F F+K+Q ++++M+ G+   +SQ+V++P++ P +GE+ +L I LL S
Sbjct  258  GLHTSLMYYLKARFHFNKHQFADLMMISGIAGTISQLVLMPILAPTIGEEKLLAIGLLFS  317

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             ++  LY  AW+ WVPY +  F ++ +   P   ++ S+    ++QGK QG ++G+ + A
Sbjct  318  CSHMFLYSIAWSFWVPYAAAMFSILIVFAPPCIRSIASKQVGPSEQGKVQGCISGISSFA  377

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
             L+SP+  TPLT  FLSD APF+  GF I+C     +IA   +  ++   P       + 
Sbjct  378  HLVSPLAFTPLTALFLSDGAPFNFPGFSIMCIGFASMIAFLQSLTIRAAPPISNKKVGNC  437

Query  212  ESIEA  198
               EA
Sbjct  438  SYTEA  442



>ref|XP_009124113.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Brassica rapa]
Length=445

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -3

Query  731  HYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallasiaysllY  552
            +YLKA F F+K+Q ++++++ G+   VSQ++ +P++ P + E+ +L I L    A+  L 
Sbjct  275  YYLKAKFHFNKDQFADLMIIFGIAGSVSQLLFMPILIPALKEEKLLSIGLFFGCAHMFLL  334

Query  551  GFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSPIG  372
            G AW+AWVPY++  F ++ I       +++S+  +S +QGKAQG ++ + ++A+++SP+ 
Sbjct  335  GMAWSAWVPYMAAMFSLVSIFPQSCMRSIVSKQVTSYEQGKAQGIISSICSLANVISPLA  394

Query  371  MTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             +PLT WFLS+ APF+  GF ++CA   M IA   + M++   P
Sbjct  395  FSPLTGWFLSERAPFNFPGFSLMCAGFTMTIAFILSLMIRATTP  438



>emb|CDY54428.1| BnaCnng26960D [Brassica napus]
Length=423

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 111/190 (58%), Gaps = 0/190 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA FGFDKNQ +++++++ +   +SQ+ VLP     +GE+ +L 
Sbjct  232  SSFSDSGMQSAFLYFLKARFGFDKNQFADLMLLITIVGSISQLFVLPRFASTIGERKLLS  291

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    +LV P+   + SR   S +QGK QG ++
Sbjct  292  AGLFMEFTNMAVVSISWAPWVPYLTTLFVPGAMLVMPSVCGIASRQVGSGEQGKVQGCIS  351

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C SL  +     + M+K   P++ 
Sbjct  352  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCISLSSMFGFLQSLMIKDVPPSQL  411

Query  230  SSEDDAESIE  201
            + E ++ S E
Sbjct  412  NKEINSTSRE  421



>ref|XP_010539088.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Tarenaya hassleriana]
Length=438

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 108/172 (63%), Gaps = 0/172 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ A  ++YLKA F F+K+Q ++++++ G    +SQ++ +P++   +GE+++L I L  
Sbjct  260  AGLQASTMYYLKAKFHFNKDQFADLMVIYGAAGSISQLLFMPILVHGLGEEIMLSIGLFF  319

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
              A   L   AW+AWVPY S +F V  IL  P+  +++S+  ++ +QGKAQG ++ + + 
Sbjct  320  GCANMFLLSVAWSAWVPYTSAAFSVFSILSQPSMRSIVSKQVATHEQGKAQGIISSICSF  379

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            AS++SP+  +PLT  FLSD APF+  GF I+C      IA   + M++   P
Sbjct  380  ASVISPLAFSPLTDLFLSDRAPFNFPGFSIMCIGFTTTIAFIQSLMIRATPP  431



>gb|KJB58029.1| hypothetical protein B456_009G190900 [Gossypium raimondii]
Length=444

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 111/184 (60%), Gaps = 0/184 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ GV   +SQ++++P++ P +GE+ +L + L  S
Sbjct  259  GLHASLLYYLKARFHFNKDQFADLMVITGVAGTISQLLLMPILAPALGEERLLSVGLFFS  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+ + Y  AW+ WVPY +  F + Y+   P   +++S+     +QGKAQG ++G+ + A
Sbjct  319  SAHMIFYSIAWSFWVPYAAAMFSLFYVFSQPCIRSIVSKQVGPCEQGKAQGIISGIGSFA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++ SP+  +PLT  FLS+ APF   GF I+C     +IA   + M++   P       + 
Sbjct  379  NVASPLAFSPLTALFLSERAPFYFPGFSIMCVGFASMIAFVQSLMIRAIPPISSQRVGNC  438

Query  212  ESIE  201
              +E
Sbjct  439  NYME  442



>emb|CBX25325.1| hypothetical_protein [Oryza brachyantha]
Length=391

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 109/195 (56%), Gaps = 51/195 (26%)
 Frame = -3

Query  758  MSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciall  579
            M GI  VL++YLK+ FGFDKNQ SE+LMVVG+G+I SQI+VLP++   VGEK        
Sbjct  239  MIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQILVLPVIINTVGEK--------  290

Query  578  asiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQA  399
                                    GV+ + +  +              GKAQGF++ V++
Sbjct  291  ------------------------GVLCVGILAS--------------GKAQGFISTVKS  312

Query  398  IASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS--  225
             A LL+P+ M+PLT++F+S+ APF+CKGF    A   +VI+L  + MLK D  AK +   
Sbjct  313  TAVLLAPLFMSPLTSYFISEQAPFNCKGFSFFMAGFFLVISLGISLMLKPDCGAKCTRVA  372

Query  224  ---EDDAESIEAPLL  189
               + D E+++APLL
Sbjct  373  VPDQPDHEAVQAPLL  387



>ref|XP_008236069.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Prunus 
mume]
Length=444

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 109/177 (62%), Gaps = 1/177 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L+++LKA F F+KNQ ++++++VG+   VSQ++ +P++ P +GE+ +L I LL  
Sbjct  260  GLQASLMYFLKARFHFNKNQFADLMLIVGISGTVSQLLFMPMLAPVIGEEKLLSIGLLVG  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   +WA WVPY +  F     LV P+  ++ S+     +QGKAQG ++G+ + A
Sbjct  320  SFNMFLNSISWAVWVPYAATLFSAFGFLVQPSIRSIASKQVGPDEQGKAQGCISGISSFA  379

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDA-PAKKSS  225
            +++SP+  + LT  FLS+ APF   GF I+C  L M+IA   + M++    P+ K S
Sbjct  380  NIVSPLIFSSLTALFLSEEAPFYFPGFSIMCIGLAMIIAFVQSTMIRASPIPSHKIS  436



>gb|KDP36870.1| hypothetical protein JCGZ_08161 [Jatropha curcas]
Length=421

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A  ++YLKA F F+KNQ ++++++ G+   +SQ++++P++ P +GE  +L + L  S
Sbjct  236  GLHASAMYYLKARFHFNKNQFADLMVISGIAGTISQLLLMPILVPVLGEGRLLSVGLFFS  295

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+  LY  AW  WVPY++    ++++   P    ++S+   S +QGKAQG ++G+ + A
Sbjct  296  CAHMFLYSIAWTFWVPYVAAMLSILFVFSQPCMRTIVSKQVGSCEQGKAQGCISGIGSFA  355

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            +++SP+  +PLT  FLS+ APF   GF I+CA    +IAL  + M++L  P
Sbjct  356  NVVSPLLFSPLTALFLSERAPFHFPGFSIMCAGFTSMIALIQSIMMRLPPP  406



>ref|XP_009121175.1| PREDICTED: uncharacterized protein LOC103846003 isoform X4 [Brassica 
rapa]
Length=370

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 111/190 (58%), Gaps = 0/190 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  +G+ +  L++LKA FGFDKNQ +++++++ +   +SQ+ VLP     +GE+ +L 
Sbjct  179  SSFSDNGMQSAFLYFLKARFGFDKNQFADLMLLITIVGSISQLFVLPRFASTIGERKLLS  238

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    +LV P+   + SR     +QGK QG ++
Sbjct  239  AGLFMEFTNMAVVSISWAPWVPYLTTLFVSGAMLVMPSVCGIASRQVGPGEQGKVQGCIS  298

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C SL  +I    + M+K   P++ 
Sbjct  299  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCISLSSMIGFFQSLMIKDVPPSQL  358

Query  230  SSEDDAESIE  201
            + E ++ S E
Sbjct  359  NKEINSTSRE  368



>emb|CDY12985.1| BnaC02g29920D [Brassica napus]
Length=520

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S   +G+ A  ++YLKA F F+K+Q ++++++ G+   VSQ++ +P++ P + E+ +L 
Sbjct  357  SSLSEAGLHASSMYYLKAKFQFNKDQFADLMIIFGIAGSVSQLLFMPILIPALKEEKLLS  416

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L    A+  L G AW+AWVPY++  F ++ I       +++S+  +S +QGKAQG ++
Sbjct  417  IGLFFGCAHMFLLGMAWSAWVPYMAAMFSLVSIFHQSCMRSIVSKQVTSYEQGKAQGIIS  476

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVI  279
             + ++A+++SP+  +PLT WFLS+ APF   GF ++CA   MVI
Sbjct  477  SICSLANVISPLAFSPLTGWFLSERAPFHFPGFSLMCAGFTMVI  520



>ref|XP_009620054.1| PREDICTED: uncharacterized protein LOC104111941 [Nicotiana tomentosiformis]
Length=438

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 114/184 (62%), Gaps = 0/184 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G++A LL++LKA F F+K+Q +++L++ G+   +SQ++++P++ P  GE+ +L I L  S
Sbjct  254  GLEASLLYFLKAQFHFNKDQFADLLIISGIAGSISQLLLMPILAPAFGEEKLLSIGLFFS  313

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY  AW++WVPY +    V  I   P   ++ S+     +QGK QG + G+ + A
Sbjct  314  CLHMLLYSIAWSSWVPYATALISVFSIFAMPCLKSIASKQIGPNEQGKVQGCITGICSFA  373

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            S++SP+  +PLT  FLS NAPF   GFGI CA+   ++A   + M++ D      S +D+
Sbjct  374  SVVSPLIFSPLTALFLSQNAPFHFPGFGIACAAFASMLAFIQSLMIRPDDTVINCSPNDS  433

Query  212  ESIE  201
            +S E
Sbjct  434  DSGE  437



>ref|XP_009767684.1| PREDICTED: uncharacterized protein LOC104218795 [Nicotiana sylvestris]
Length=438

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 115/184 (63%), Gaps = 0/184 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G++A LL++LKA F F+ +Q +++L++ G+   +SQ++++P++ P +GE+ +L + LL S
Sbjct  254  GVEASLLYFLKAQFHFNTDQFADLLIISGIAGSISQLLLMPILAPALGEEKLLSVGLLFS  313

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY  AW++WVPY S    V  I   P   ++ S+     +QGK QG + G+ + A
Sbjct  314  CLHMLLYSIAWSSWVPYASALISVFSIFAMPCLKSIASKQIGPNEQGKVQGCITGICSFA  373

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            S++SP+  +PLT  FLS NAPF   GFGI CA+   ++A   + M++ D      S +D+
Sbjct  374  SVVSPLIFSPLTALFLSQNAPFHFPGFGIACAAFASMLAFIQSLMIRPDDTVINCSPNDS  433

Query  212  ESIE  201
            +S E
Sbjct  434  DSGE  437



>gb|KDP33282.1| hypothetical protein JCGZ_13069 [Jatropha curcas]
Length=451

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 113/189 (60%), Gaps = 2/189 (1%)
 Frame = -3

Query  767  SWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilci  588
            S   +G  A L++YLKA F F KNQ +++L+++G   +VSQ++ +PL+ P + E+ IL I
Sbjct  263  SLAEAGFLASLMYYLKARFHFSKNQYADLLLLIGAAGMVSQLIFMPLLAPIISEEKILSI  322

Query  587  allasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAG  408
             L       LLY  AW+ WVPY S +  V  +LV P+  ++ S+     +QGKAQG ++ 
Sbjct  323  GLFMGFINMLLYSIAWSNWVPYASTALTVFTVLVQPSLRSITSKQVGPDEQGKAQGCISS  382

Query  407  VQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK--LDAPAK  234
            + + AS++SP+  +PLT  FLS+ APF   GF I C    ++I    + M+K  +  P +
Sbjct  383  ICSFASIISPLIFSPLTALFLSEEAPFKFPGFSISCIGFALLIGFIPSIMIKAPIPIPCQ  442

Query  233  KSSEDDAES  207
            K++ +  E+
Sbjct  443  KNNSNSMEA  451



>ref|XP_009121174.1| PREDICTED: uncharacterized protein LOC103846003 isoform X3 [Brassica 
rapa]
Length=413

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 111/190 (58%), Gaps = 0/190 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  +G+ +  L++LKA FGFDKNQ +++++++ +   +SQ+ VLP     +GE+ +L 
Sbjct  222  SSFSDNGMQSAFLYFLKARFGFDKNQFADLMLLITIVGSISQLFVLPRFASTIGERKLLS  281

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    +LV P+   + SR     +QGK QG ++
Sbjct  282  AGLFMEFTNMAVVSISWAPWVPYLTTLFVSGAMLVMPSVCGIASRQVGPGEQGKVQGCIS  341

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C SL  +I    + M+K   P++ 
Sbjct  342  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCISLSSMIGFFQSLMIKDVPPSQL  401

Query  230  SSEDDAESIE  201
            + E ++ S E
Sbjct  402  NKEINSTSRE  411



>ref|XP_004500907.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Cicer arietinum]
Length=453

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 108/171 (63%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F FDKN  ++++++ G+   VSQ++++P+  P +GE  +L I L   
Sbjct  280  GLHGSMMYYLKARFHFDKNHFADLMVISGIAGTVSQLLLMPIFAPTLGEARLLSIGLFFH  339

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW++WVPY +  F ++++   P   +++S+     +QG+AQG ++G+ +IA
Sbjct  340  CVHMFLYSIAWSSWVPYAAAMFSILFVFSQPCIRSIVSKQVDPHEQGRAQGCISGICSIA  399

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             ++SP+  +PLT  FLS+ APFD  GF I+C  +  +++   + ML++  P
Sbjct  400  QIVSPLVFSPLTALFLSEKAPFDFPGFSIMCIGIASMVSFIQSMMLRVVPP  450



>ref|XP_011088646.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Sesamum 
indicum]
Length=439

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 109/184 (59%), Gaps = 0/184 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S   +G+ + LL++LKA F F K+Q ++VL++  +GA +S ++++P + P +GE+ +L 
Sbjct  251  NSLAEAGLQSCLLYFLKARFQFKKDQFADVLLIAYIGATISNMLLMPTLGPIIGEETLLS  310

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            + L A          AWA WVPY S S GV   L +P   +++S+     +QG AQG + 
Sbjct  311  LGLFAGFLNMFFDSIAWAPWVPYASASMGVFLFLSSPNLRSIVSKQVGPNEQGLAQGCIL  370

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            G+ A A+++SP+  +PL+  FLS++APF  +GF I+C  L  +     + M+ L +  K 
Sbjct  371  GMTAFANVISPLIYSPLSALFLSEDAPFHFQGFSILCVGLAWLAGFFLSIMIPLLSRNKS  430

Query  230  SSED  219
            S+ D
Sbjct  431  SNGD  434



>gb|KDO68186.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=438

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 105/168 (63%), Gaps = 0/168 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A  L++LKA F F+KNQ ++++++ G+   +SQ++ +PL+ P +GE  +L + L A+
Sbjct  264  GMQASFLYFLKAQFHFNKNQFADLMLIAGLAGTISQLLFMPLLAPILGEAKLLSLGLFAA  323

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +   +W+AWVPY + +F V+ +  TP+  +++S+     +QGKAQG ++G+ + A
Sbjct  324  CINMFICSISWSAWVPYATTAFSVLVVFATPSFRSIVSKQVGPNEQGKAQGCISGISSFA  383

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKL  249
            +++SP+  +PLT  FLS  APF+  GF I+C  L  V A     +L  
Sbjct  384  NIVSPLIFSPLTALFLSKGAPFNFPGFSIMCIGLASVRAFTYELLLSF  431



>ref|XP_007136127.1| hypothetical protein PHAVU_009G020100g [Phaseolus vulgaris]
 gb|ESW08121.1| hypothetical protein PHAVU_009G020100g [Phaseolus vulgaris]
Length=433

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 108/171 (63%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +L++LKA F FDKNQ ++++++ G+   VSQ++++P++ P +GE  +L I L   
Sbjct  260  GLHGSMLYFLKAQFHFDKNQFADLMVISGIAGTVSQLLIMPILAPILGEARLLSIGLFFH  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW++ VPY S  F ++++   P   +++S+     +QGKAQG ++G+ ++A
Sbjct  320  CVHMFLYSIAWSSLVPYASAMFSILFVFSQPCIRSIVSKQVGPHEQGKAQGCISGICSVA  379

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             ++SP+  +PLT  FLS+ APFD  GF I+C     +++   + ML++  P
Sbjct  380  HIVSPLVFSPLTALFLSEKAPFDFPGFSIMCIGFASMVSFIQSMMLRVAPP  430



>ref|XP_009121172.1| PREDICTED: uncharacterized protein LOC103846003 isoform X1 [Brassica 
rapa]
Length=454

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 111/190 (58%), Gaps = 0/190 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  +G+ +  L++LKA FGFDKNQ +++++++ +   +SQ+ VLP     +GE+ +L 
Sbjct  263  SSFSDNGMQSAFLYFLKARFGFDKNQFADLMLLITIVGSISQLFVLPRFASTIGERKLLS  322

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    +LV P+   + SR     +QGK QG ++
Sbjct  323  AGLFMEFTNMAVVSISWAPWVPYLTTLFVSGAMLVMPSVCGIASRQVGPGEQGKVQGCIS  382

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C SL  +I    + M+K   P++ 
Sbjct  383  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCISLSSMIGFFQSLMIKDVPPSQL  442

Query  230  SSEDDAESIE  201
            + E ++ S E
Sbjct  443  NKEINSTSRE  452



>ref|XP_002865558.1| hypothetical protein ARALYDRAFT_917583 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41817.1| hypothetical protein ARALYDRAFT_917583 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 109/177 (62%), Gaps = 0/177 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S   +G+ A  ++YLKA F F+K+Q ++++++ G    +SQ++ +P++ P + E+ +L 
Sbjct  99   SSLAEAGLHASSMYYLKAKFHFNKDQFADLMIIFGAAGSISQLLFMPILVPALKEERLLS  158

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L    A+  L   AW++WVPY++  F    I       +++S+   S +QGKAQG ++
Sbjct  159  IGLFFGCAHMFLICVAWSSWVPYMAAIFTFFSIFPQSCMRSIVSKQVESYEQGKAQGIIS  218

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             + ++A+++SP+  +PLT WFLS+ APF+  GF I+CA   M IA   + M++   P
Sbjct  219  SICSLANVISPLAFSPLTDWFLSERAPFNFPGFSIMCAGFTMTIAFIQSLMIRATTP  275



>gb|KFK32943.1| hypothetical protein AALP_AA6G309500 [Arabis alpina]
Length=436

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 112/177 (63%), Gaps = 0/177 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            TS   +G+ A  ++YLKA F F+K+Q ++++++VG    +SQ++ +P++ P + E+ +L 
Sbjct  253  TSLGEAGLHASSMYYLKAKFHFNKDQFADLMIIVGAAGSISQLLFMPILVPVLKEERLLS  312

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            + L    A+  L   AW++WVPY++  F V+ I       +++S+  +S +QGKAQG ++
Sbjct  313  LGLFFGCAHMFLISVAWSSWVPYIAALFTVVSIFPGSCMRSIVSKQVTSYEQGKAQGIIS  372

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
             + ++A+++SP+  +PLT WFLS+ APF+  GF I+ A   M IA   + M++   P
Sbjct  373  SICSLANVISPLAFSPLTDWFLSERAPFNFPGFSIMIAGFTMTIAFIKSLMIRATTP  429



>ref|XP_006828835.1| hypothetical protein AMTR_s00001p00146610 [Amborella trichopoda]
 gb|ERM96251.1| hypothetical protein AMTR_s00001p00146610 [Amborella trichopoda]
Length=207

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 110/178 (62%), Gaps = 0/178 (0%)
 Frame = -3

Query  734  LHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallasiaysll  555
            ++YLKA F FDKNQ +++L++ G+    SQ++ +P++   VGE+ +L + L A  A++ L
Sbjct  29   VYYLKARFHFDKNQFADILLICGIAGATSQMLFMPILATAVGEEKLLRVGLFACCAHTFL  88

Query  554  YGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSPI  375
            Y  AW++ VPY++  F    +  TP   +++S+   + +QGKAQG ++G+++ AS+LSP+
Sbjct  89   YCIAWSSAVPYIASMFAFFTVFTTPCIGSIVSKQVGADEQGKAQGCISGIRSFASVLSPL  148

Query  374  GMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDAESIE  201
             MTPLT  FLS+ APF   GF I+CA    +IA   + +++   P        +  ++
Sbjct  149  AMTPLTALFLSERAPFPFPGFSIMCAGFASLIAFGQSFVMRAAPPISTLKASSSNYVQ  206



>gb|KHG18467.1| Hippocampus abundant transcript 1 [Gossypium arboreum]
Length=443

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 121/181 (67%), Gaps = 1/181 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+++  ++YLKA F F+KNQ ++++++ G+ A +SQ+ ++PL+   +G+  +L I L AS
Sbjct  263  GMESSSMYYLKARFHFNKNQFADLMLIGGIVATISQLFIMPLLVSPIGDGRLLSIGLFAS  322

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              Y++LY  AW+AWVPY + +   + +   P+  ++ SR +   +QGKAQG ++G+ ++A
Sbjct  323  CVYAILYSIAWSAWVPYAAAAVSTVMVFAPPSLRSIASRQAGPREQGKAQGCISGILSLA  382

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++++P+  +PLT+ FLS+ APF   GF IIC ++ ++IA   + M+   AP+  ++E+  
Sbjct  383  NVMAPLIFSPLTSLFLSEGAPFHFPGFSIICIAITLMIAFIQSLMIG-RAPSTSNAENST  441

Query  212  E  210
            E
Sbjct  442  E  442



>ref|XP_008445315.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=434

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 116/181 (64%), Gaps = 2/181 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G  A +++YLKA F FDK+++++++++ GV + +SQ+++ P++ P +GE  +L + +  +
Sbjct  253  GHHASIMYYLKAKFHFDKDRIADLMVISGVASSISQLLLTPILVPVLGENRLLSVGVFFN  312

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LL+  AW+ WV Y +  F V+YI   P   +++S+   +++QGKAQG ++G+ + A
Sbjct  313  CLHMLLHSLAWSEWVSYGAAMFSVLYIFWQPCLQSIVSKQVGASEQGKAQGCISGISSFA  372

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP   +PLT  FLS+NAPF   GF I+CA+   +IA   + M+K   PAK  +    
Sbjct  373  NVVSPFVFSPLTALFLSENAPFYFPGFSIMCAASAAMIAFVQSMMIK--TPAKACTSIHV  430

Query  212  E  210
            E
Sbjct  431  E  431



>ref|XP_006280482.1| hypothetical protein CARUB_v10026419mg [Capsella rubella]
 gb|EOA13380.1| hypothetical protein CARUB_v10026419mg [Capsella rubella]
Length=438

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 112/172 (65%), Gaps = 0/172 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ A  ++YLKA F F+K+Q ++++++ G    +SQ++ +P++ P + E+ +L I L  
Sbjct  260  AGLHASSVYYLKAKFHFNKDQFADLMIIFGTAGSISQLLFMPILVPALKEERLLSIGLFF  319

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            + A+  L   AW++WVPY++  F +  I       +++S+  +S +QGKAQG ++ + ++
Sbjct  320  AAAHMFLLCVAWSSWVPYIAAIFALFSIFPQSCMRSIVSKQVASNEQGKAQGIISSICSL  379

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            A+++SP+  +PLT WFLS++APF+  GF I+CA + M IA   + M++   P
Sbjct  380  ANVISPLAFSPLTDWFLSESAPFNFPGFSIMCAGVTMTIAFIQSLMIRATPP  431



>ref|XP_003603840.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
Length=454

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 106/168 (63%), Gaps = 0/168 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F FDKN  ++++++ G+   VSQ+ ++P+  P +GE  +L I L   
Sbjct  281  GLHGSMMYYLKARFHFDKNHFADLMIISGIAGTVSQLFLMPIFAPTLGEARLLSIGLFFH  340

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  +Y  AW++WVPY +  F ++++   P   +++S+     +QG+AQG ++G+ +IA
Sbjct  341  CVHMFIYSIAWSSWVPYAAAMFSILFVFSQPCIRSIVSKQVDPREQGRAQGCISGICSIA  400

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKL  249
             ++SP+  +PLT  FLS+ APF+  GF I+C  +  +++   + ML++
Sbjct  401  HIVSPLAFSPLTALFLSEKAPFNFPGFSIMCIGIASMVSFVQSMMLRV  448



>gb|AES74091.2| MFS transporter [Medicago truncatula]
Length=434

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 106/168 (63%), Gaps = 0/168 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F FDKN  ++++++ G+   VSQ+ ++P+  P +GE  +L I L   
Sbjct  261  GLHGSMMYYLKARFHFDKNHFADLMIISGIAGTVSQLFLMPIFAPTLGEARLLSIGLFFH  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  +Y  AW++WVPY +  F ++++   P   +++S+     +QG+AQG ++G+ +IA
Sbjct  321  CVHMFIYSIAWSSWVPYAAAMFSILFVFSQPCIRSIVSKQVDPREQGRAQGCISGICSIA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKL  249
             ++SP+  +PLT  FLS+ APF+  GF I+C  +  +++   + ML++
Sbjct  381  HIVSPLAFSPLTALFLSEKAPFNFPGFSIMCIGIASMVSFVQSMMLRV  428



>gb|KEH44398.1| MFS transporter [Medicago truncatula]
Length=440

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 116/186 (62%), Gaps = 3/186 (2%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G  AV ++YLKA F ++KNQ ++++M+ G+GA ++Q+ ++P++ P VGE+ +L   L  S
Sbjct  254  GSMAVTMYYLKARFQYNKNQFADLMMISGIGATLTQLFLMPILVPAVGEEKLLTTGLFVS  313

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                L+Y  +W+AWVPY    F V+ +LV P+  ++ S+     +QG  QG ++G+ + A
Sbjct  314  CISMLMYSISWSAWVPYALAGFSVLGVLVRPSLTSIASKQVGPNEQGMVQGCLSGITSAA  373

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP---AKKSSE  222
            +++SP+  +PLT  FLS++APF+  GF ++C  L ++ A   + M++   P    K SS 
Sbjct  374  NIISPLIFSPLTALFLSEDAPFNFPGFSLMCLGLTLMTAFFLSLMIRAPPPIMGDKVSSN  433

Query  221  DDAESI  204
               E++
Sbjct  434  RCTETL  439



>ref|XP_007017917.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY15142.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=444

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 112/186 (60%), Gaps = 1/186 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ GV   +SQ++++P++ P +GE+ +L I L  S
Sbjct  259  GLHASLLYYLKARFHFNKDQFADLMVITGVAGTISQLLLMPVLAPALGEERLLAIGLFFS  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+   Y  AW+ WVPY +  F + Y+   P   +++S+     +QGKAQGF++G+ + A
Sbjct  319  CAHMFFYSIAWSVWVPYAAAVFSLFYVFSQPCIRSIVSKQVGPCEQGKAQGFISGIGSFA  378

Query  392  SLLSPIGMTPLT-TWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            ++ SP+  +PLT   FLS+ APF   GF I+C     +IA   + M++   P       +
Sbjct  379  NVASPLIFSPLTAALFLSEGAPFYFPGFSIMCVGFASMIAFFQSLMIRAVPPISSQRVGN  438

Query  215  AESIEA  198
               +EA
Sbjct  439  YNCMEA  444



>ref|XP_010442182.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
 ref|XP_010442183.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
 ref|XP_010442184.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
Length=438

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 111/175 (63%), Gaps = 0/175 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ A  ++YLKA F F K+Q ++++++ G    +SQ++ +P + P + E+ +L I L  
Sbjct  260  AGLHASSMYYLKAKFHFTKDQFADLMIICGAAGSISQLIFMPNLVPALKEERLLSIGLFF  319

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            + A+  L   AW++WVPY++  F ++ +       +++S+  +S +QGKAQG ++ + ++
Sbjct  320  ASAHMFLLCVAWSSWVPYIAAIFALLSVFPQSCMRSIVSKQVASYEQGKAQGIISSICSL  379

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            A+++SP+  +PLT WFLS+ APF+  GF I+CA   M IA   + M++  AP  +
Sbjct  380  ANVISPLAFSPLTDWFLSERAPFNFPGFSIMCAGFTMTIAFIQSLMIRATAPMSE  434



>emb|CDY07888.1| BnaC03g47340D [Brassica napus]
Length=381

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 108/190 (57%), Gaps = 0/190 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA FGFDKNQ +++L+++ +   +SQ+ VLP     +GE+ +L 
Sbjct  190  SSFSDSGMQSAFLYFLKARFGFDKNQFADLLLLITIVGSISQLFVLPRFASSIGERKLLS  249

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    I+V P+   + SR     +QGK QG ++
Sbjct  250  TGLFMEFMNMAIVSISWAPWVPYLTTVFVPGAIIVMPSVCGIASRQVGPGEQGKVQGCIS  309

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C +L  +I    + ++K   P   
Sbjct  310  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCIALSSMIGFLQSLLMKDVPPQSL  369

Query  230  SSEDDAESIE  201
            + E +  S E
Sbjct  370  NKEINNSSRE  379



>ref|NP_001151277.1| tetracycline transporter protein [Zea mays]
 gb|ACG42211.1| tetracycline transporter protein [Zea mays]
Length=262

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 110/168 (65%), Gaps = 0/168 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ + LL++LKA F + KNQ + +L+++G+    SQ+ V+PL+ P +GE+ +L I+L+A
Sbjct  86   TGLLSALLYFLKAKFHYSKNQYANLLLIIGITGSFSQLTVMPLLVPKLGEQKLLVISLVA  145

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            S   + LY  +W++WVPYL+ S  ++ +LVTP   +++S+     +QG  QG + G+ + 
Sbjct  146  SCGQAFLYSISWSSWVPYLAASSVILSMLVTPCIRSIVSKKVGPFEQGMVQGCMTGISST  205

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            AS++SP+  TPLT W LS+  PF  KGF + CA    ++AL  +  ++
Sbjct  206  ASVVSPLIFTPLTAWCLSEATPFYLKGFSVACAGFATLVALATSISMR  253



>ref|XP_004142991.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
sativus]
 ref|XP_004161071.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
sativus]
Length=437

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 116/182 (64%), Gaps = 2/182 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +L+YLKA F FDK++ ++++++ G  + +SQ++++P++ P +GE  +L +AL   
Sbjct  258  GLHASVLYYLKARFQFDKDRFADLMVIFGAASTISQLLLIPILVPVLGEGRLLSVALFFY  317

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                LLY  AWA WV Y +    ++YI   P   +++S+   +++QGKAQG ++G+   A
Sbjct  318  SVQMLLYSIAWADWVVYAATMLSMLYIFWQPCLQSIVSKQVGASEQGKAQGCISGISLFA  377

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+NAPF   GF I C+   ++IA   + +++  AP K ++ +  
Sbjct  378  NVVSPLVFSPLTALFLSENAPFYFPGFSIFCSGASVMIAFVRSILMR--APTKATTSNLV  435

Query  212  ES  207
            E+
Sbjct  436  EA  437



>gb|EYU37988.1| hypothetical protein MIMGU_mgv1a006415mg [Erythranthe guttata]
Length=444

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 115/190 (61%), Gaps = 1/190 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            TS   +G  A L+++LKA F F+K+Q + VL++  +GA ++  + +P++ P VGE+ +LC
Sbjct  251  TSLAEAGGAAFLMYFLKARFHFNKDQFAVVLLITNLGATLTNAIFMPILGPIVGEETLLC  310

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            +AL       L    AW+AWVPY S S G+ + L +P   +++S+   S++QG AQG + 
Sbjct  311  VALFNGFLNMLFDSIAWSAWVPYASASLGMFFTLSSPCIRSIVSKEVKSSEQGIAQGCIL  370

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            G+ + A+++SP+  +PL+  FLS+ APF+  GF ++C     V+ L  + ++ ++ P   
Sbjct  371  GITSFANVVSPLIFSPLSALFLSERAPFNFPGFCVLCIGFAYVVGLILSVVININ-PFVS  429

Query  230  SSEDDAESIE  201
              +  +E I 
Sbjct  430  RRDRVSEEIN  439



>ref|XP_004144923.1| PREDICTED: tetracycline resistance protein, class D-like [Cucumis 
sativus]
 gb|KGN43275.1| hypothetical protein Csa_7G016600 [Cucumis sativus]
Length=448

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            GI A +L+Y KA F FDK+Q ++++++ GV   VSQ+V++PL+ P + E  +L + LL  
Sbjct  264  GIQASILYYFKARFHFDKDQFADLMLLNGVAGTVSQLVLMPLLVPVLSEDKLLSLGLLVG  323

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
               +++   AWA WVPY    F +  + V+P   +++S+  S  +QGK QG ++G+ ++A
Sbjct  324  SIGTVINSIAWAIWVPYAVTIFFIFSVFVSPCLRSIVSKQVSQYEQGKIQGCLSGLSSLA  383

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACML  255
             + +PI  +PLT  FLSD+ PF   GF ++C ++  VIAL  + M+
Sbjct  384  QIAAPIIFSPLTALFLSDHPPFYFPGFSLLCIAITSVIALILSLMM  429



>ref|XP_007142795.1| hypothetical protein PHAVU_007G017500g [Phaseolus vulgaris]
 gb|ESW14789.1| hypothetical protein PHAVU_007G017500g [Phaseolus vulgaris]
Length=443

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 106/171 (62%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ AVLL+YLKA F F+KNQ +++ M+ GVGA ++Q+ ++P++ P +GE+ +L   LL  
Sbjct  257  GLMAVLLYYLKARFQFNKNQFADLFMITGVGATLAQLFLMPILVPVIGEERLLSTGLLIG  316

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +Y  AWA WVPY      +  + V P+  ++ S+    T+QG  QG ++G+ + A
Sbjct  317  CINVFVYSIAWATWVPYALAGCSIFTVFVRPSLCSIASKQVGPTEQGMVQGCLSGISSFA  376

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++++P+  +PLT  FLS++APF   GF ++C  L M+ A   + M++   P
Sbjct  377  NIIAPLVFSPLTALFLSEDAPFYYPGFSLMCLGLAMMTAFFQSLMIRAAPP  427



>gb|EYU37986.1| hypothetical protein MIMGU_mgv1a006358mg [Erythranthe guttata]
Length=447

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 109/183 (60%), Gaps = 2/183 (1%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ A L++YLKA F F K+Q +++ ++  + + +S +V++P++ P +GE+ +LCI L A
Sbjct  261  AGVQAFLMYYLKARFHFQKDQFADIWLITNIASTLSSMVLMPILAPLLGEETLLCIGLFA  320

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
                 LL   AWA WVPY S + GV   L +P+  ++IS+     +QG AQG + G+ + 
Sbjct  321  GFLNMLLDSIAWAPWVPYASATLGVFLFLASPSIRSIISKQVGPCEQGIAQGCLMGIASF  380

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            A+++SP+  +PL+  FLSD APF   GF I+C  L    A     M+K+      SS D 
Sbjct  381  ANIISPLIYSPLSALFLSDTAPFKFPGFSILCVGLAWFAAFIVGTMIKIQ--PLWSSRDR  438

Query  215  AES  207
            A S
Sbjct  439  ASS  441



>ref|XP_004253206.1| PREDICTED: uncharacterized protein LOC101250386 [Solanum lycopersicum]
Length=440

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+D+ LL++LKA F F+KNQ +++L++ G+   +SQ++++P++   +GE+ +L + LL S
Sbjct  256  GLDSSLLYFLKAQFHFNKNQFADLLIISGIAGSISQLLLMPILVSALGEEKLLSVGLLFS  315

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY  AW++WVPY S    V+ I V P   ++ S+     +QGK QG + G+ + A
Sbjct  316  CFHILLYSIAWSSWVPYASALISVMSIFVMPCLKSIASKQVGPNEQGKVQGCITGICSFA  375

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPA---KKSSE  222
            S++SP+  +PLT  FLSD+APF   GFG+ CA+   +IA   + M+    P    + S+ 
Sbjct  376  SVVSPLIFSPLTALFLSDHAPFHFPGFGLACAAFAFMIAFIESFMISSACPVISCRLSNS  435

Query  221  DDAE  210
            D  E
Sbjct  436  DFEE  439



>ref|XP_009136358.1| PREDICTED: uncharacterized protein LOC103860499 isoform X6 [Brassica 
rapa]
Length=370

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA F FDKNQ +++L+++ +   +SQ+ VLP     +GE+ +L 
Sbjct  179  SSFSDSGMQSAFLYFLKARFAFDKNQFADLLLLITIVGSISQLFVLPRFASSIGERKLLS  238

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    I+V P+   + SR +   +QGK QG ++
Sbjct  239  TGLFMEFMNMAIVSISWAPWVPYLTTVFVPGAIIVMPSVCGIASRQAGPGEQGKVQGCIS  298

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C +L  +I    + M+K D P ++
Sbjct  299  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCIALSSMIGFLQSLMIK-DVPPQQ  357

Query  230  SSED  219
             +++
Sbjct  358  LNKE  361



>gb|KHN11509.1| Tetracycline resistance protein, class A [Glycine soja]
Length=198

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 106/171 (62%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ AVLL+YLKA F F+KNQ +++LM+ G+GA ++Q+  +P++ P +GE+ +L   LL S
Sbjct  12   GLMAVLLYYLKARFQFNKNQFADLLMITGIGATLAQLFFMPILVPVIGEEKLLSTGLLIS  71

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +Y  AW AWVPY      V  + V P+  ++ S+    T+QG  QG ++ + + A
Sbjct  72   CINVFVYSIAWTAWVPYALAGCSVFAVFVRPSLCSIASKQVGPTEQGMVQGCLSAISSFA  131

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++++P+  +PLT  FLS+ APF   GF ++C  L +++A   + +++   P
Sbjct  132  NIIAPLIFSPLTALFLSEEAPFYFPGFSLMCLGLALMVAFFQSLIIRAVPP  182



>ref|XP_010690317.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Beta 
vulgaris subsp. vulgaris]
Length=434

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L+++LKA F F KNQ + ++++VGV  +VSQ+V++P++    GE+ +L I LL +
Sbjct  257  GLHASLMYFLKAEFHFSKNQFANLMLIVGVAGMVSQLVLMPMLLSVTGEEWLLRIGLLVA  316

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                +L   AW  WV Y      V  I  TP   ++ S+   + +QGKAQG ++G+ + A
Sbjct  317  STNMILNSIAWNVWVIYAVAGLSVFVIFTTPCMRSIASKQVGACEQGKAQGCISGIGSFA  376

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            +++SP+  +PLT  FLSD APF   GF ++C +LC  IA   + M++
Sbjct  377  NIISPLVFSPLTAMFLSDKAPFHYPGFSLLCIALCTAIAFIQSLMIR  423



>gb|EPS73404.1| hypothetical protein M569_01349 [Genlisea aurea]
Length=427

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 95/152 (63%), Gaps = 0/152 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G  +   ++LKA F F+K+Q ++++M+VGV    SQ+V+LP++ P  GEK +L I L  
Sbjct  249  NGFSSSAFYFLKAEFHFNKDQFADLMMIVGVAGSFSQLVLLPILTPIAGEKRMLSIGLFF  308

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            +  + +LY  AWA WV Y S S  V+     P   +V S+   S +QGK QG + G+ ++
Sbjct  309  TSLHMILYSVAWAPWVAYASASMSVLATFAAPCLRSVASKQMGSDEQGKGQGCITGISSL  368

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIIC  300
            A++LSP+  TPLT  FLSD APF   GF ++C
Sbjct  369  ANILSPLAFTPLTALFLSDRAPFHFPGFTLLC  400



>ref|XP_009136351.1| PREDICTED: uncharacterized protein LOC103860499 isoform X3 [Brassica 
rapa]
Length=405

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA F FDKNQ +++L+++ +   +SQ+ VLP     +GE+ +L 
Sbjct  214  SSFSDSGMQSAFLYFLKARFAFDKNQFADLLLLITIVGSISQLFVLPRFASSIGERKLLS  273

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    I+V P+   + SR +   +QGK QG ++
Sbjct  274  TGLFMEFMNMAIVSISWAPWVPYLTTVFVPGAIIVMPSVCGIASRQAGPGEQGKVQGCIS  333

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C +L  +I    + M+K D P ++
Sbjct  334  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCIALSSMIGFLQSLMIK-DVPPQQ  392

Query  230  SSED  219
             +++
Sbjct  393  LNKE  396



>ref|XP_009136353.1| PREDICTED: uncharacterized protein LOC103860499 isoform X4 [Brassica 
rapa]
 ref|XP_009136354.1| PREDICTED: uncharacterized protein LOC103860499 isoform X4 [Brassica 
rapa]
 ref|XP_009136355.1| PREDICTED: uncharacterized protein LOC103860499 isoform X4 [Brassica 
rapa]
 ref|XP_009136356.1| PREDICTED: uncharacterized protein LOC103860499 isoform X4 [Brassica 
rapa]
Length=387

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA F FDKNQ +++L+++ +   +SQ+ VLP     +GE+ +L 
Sbjct  196  SSFSDSGMQSAFLYFLKARFAFDKNQFADLLLLITIVGSISQLFVLPRFASSIGERKLLS  255

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    I+V P+   + SR +   +QGK QG ++
Sbjct  256  TGLFMEFMNMAIVSISWAPWVPYLTTVFVPGAIIVMPSVCGIASRQAGPGEQGKVQGCIS  315

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C +L  +I    + M+K D P ++
Sbjct  316  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCIALSSMIGFLQSLMIK-DVPPQQ  374

Query  230  SSED  219
             +++
Sbjct  375  LNKE  378



>ref|XP_002510601.1| tetracycline transporter, putative [Ricinus communis]
 gb|EEF52788.1| tetracycline transporter, putative [Ricinus communis]
Length=442

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 116/185 (63%), Gaps = 0/185 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A L++YLKA F F+KNQ ++++++ G+   +SQ++++PL+ P +GE  +L + L  +
Sbjct  258  GLHASLMYYLKARFHFNKNQFADLMVISGIAGTISQLLLMPLLAPALGEARLLSVGLFFT  317

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW+ WVPY +    ++++   P    ++S+   + +QGKAQGFV+G+ ++A
Sbjct  318  CIHMFLYSIAWSFWVPYAAALLSILFVFSQPCLRTIVSKQVGACEQGKAQGFVSGLGSLA  377

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+ APF   GF I+C     +IAL  + M+++  P       + 
Sbjct  378  NVVSPLVFSPLTALFLSERAPFHFPGFSIMCVGFASMIALIQSMMMRVAPPISNERASNY  437

Query  212  ESIEA  198
             ++EA
Sbjct  438  SNVEA  442



>emb|CDY02224.1| BnaA03g39430D [Brassica napus]
Length=437

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA F FDKNQ +++L+++ +   +SQ+ VLP     +GE+ +L 
Sbjct  246  SSFSDSGMQSAFLYFLKARFAFDKNQFADLLLLITIVGSISQLFVLPRFASSIGERKLLS  305

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    I+V P+   + SR +   +QGK QG ++
Sbjct  306  TGLFMEFMNMAIVSISWAPWVPYLTTVFVPGAIIVMPSVCGIASRQAGPGEQGKVQGCIS  365

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C +L  +I    + M+K D P ++
Sbjct  366  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCIALSSMIGFLQSLMIK-DVPPQQ  424

Query  230  SSED  219
             +++
Sbjct  425  LNKE  428



>gb|KJB15873.1| hypothetical protein B456_002G200900 [Gossypium raimondii]
Length=494

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 121/181 (67%), Gaps = 1/181 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+++  ++YLKA F F+KNQ ++++++ G+ A +SQ+ ++PL+   +G+  +L I L AS
Sbjct  314  GMESSSMYYLKARFHFNKNQFADLMLIGGIVATISQLFIMPLLVSPIGDGRLLSIGLFAS  373

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              Y++LY  AW+AWVPY + +   + +   P+  ++ S+ +   +QGKAQG ++G+ ++A
Sbjct  374  CVYAILYSIAWSAWVPYAAAAVSTVMVFAPPSLRSIASKQAGPREQGKAQGCISGIISLA  433

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++++P+  +PLT+ FLS+ APF   GF IIC ++ ++IA   + M+   AP+  ++E+  
Sbjct  434  NIMAPLIFSPLTSLFLSEGAPFHFPGFSIICIAITLMIAFIQSLMIG-RAPSTSNAENST  492

Query  212  E  210
            E
Sbjct  493  E  493



>ref|XP_009136350.1| PREDICTED: uncharacterized protein LOC103860499 isoform X2 [Brassica 
rapa]
Length=424

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA F FDKNQ +++L+++ +   +SQ+ VLP     +GE+ +L 
Sbjct  233  SSFSDSGMQSAFLYFLKARFAFDKNQFADLLLLITIVGSISQLFVLPRFASSIGERKLLS  292

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    I+V P+   + SR +   +QGK QG ++
Sbjct  293  TGLFMEFMNMAIVSISWAPWVPYLTTVFVPGAIIVMPSVCGIASRQAGPGEQGKVQGCIS  352

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C +L  +I    + M+K D P ++
Sbjct  353  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCIALSSMIGFLQSLMIK-DVPPQQ  411

Query  230  SSED  219
             +++
Sbjct  412  LNKE  415



>gb|KDP33281.1| hypothetical protein JCGZ_13068 [Jatropha curcas]
Length=447

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 103/176 (59%), Gaps = 0/176 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A  ++YLKA F F KNQ +++L++ GV  + SQ++ +PL+ P + E+ +L I L   
Sbjct  268  GLLASFMYYLKARFHFSKNQYADLLLLTGVAGMASQLIFMPLLVPIISEEKLLSIGLFMG  327

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                LL   AW+ WVPY S +  V  +LV P+  ++ S+     +QGKAQG ++ + + A
Sbjct  328  FINMLLCSIAWSNWVPYASTALTVFTVLVQPSLRSITSKQVGPNEQGKAQGCISSISSFA  387

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS  225
            +++SP+  +PLT  FLS+ AP    GF I+C    ++I    + M+K      KS+
Sbjct  388  NIISPLIFSPLTALFLSEEAPLKFPGFSILCIGFALLIGFIQSIMIKASIQKNKSN  443



>ref|XP_007041737.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX97568.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=443

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 123/184 (67%), Gaps = 1/184 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ + L++YLKA F F+KNQ ++++++ G+ + +SQ+ ++PL+   +G+  +L I LL S
Sbjct  260  GMISSLMYYLKARFHFNKNQFADLMLIAGIISTISQLFLMPLLVSPLGDGKLLSIGLLVS  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A ++LY  AW+ WVPY + +  ++ +   P+  ++ S+ + + +QGKAQG ++G+ ++A
Sbjct  320  CANAILYSIAWSDWVPYAATALSIMMVFAPPSLRSIASKQAGAREQGKAQGCISGISSLA  379

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            ++++P+  +PLT  FLS++APF   GF IIC ++ ++IA   + M+   AP+  S ++ +
Sbjct  380  NIIAPLVFSPLTALFLSEDAPFHFPGFSIICIAITLMIAFIQSLMIG-SAPSTSSDKNSS  438

Query  212  ESIE  201
              +E
Sbjct  439  NCME  442



>ref|XP_009136349.1| PREDICTED: uncharacterized protein LOC103860499 isoform X1 [Brassica 
rapa]
Length=451

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+ +  L++LKA F FDKNQ +++L+++ +   +SQ+ VLP     +GE+ +L 
Sbjct  260  SSFSDSGMQSAFLYFLKARFAFDKNQFADLLLLITIVGSISQLFVLPRFASSIGERKLLS  319

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
              L        +   +WA WVPYL+  F    I+V P+   + SR +   +QGK QG ++
Sbjct  320  TGLFMEFMNMAIVSISWAPWVPYLTTVFVPGAIIVMPSVCGIASRQAGPGEQGKVQGCIS  379

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV++   +++P   +PLT  FLS+NAPF   GF ++C +L  +I    + M+K D P ++
Sbjct  380  GVKSFGKVVAPFVFSPLTALFLSNNAPFYFPGFSLLCIALSSMIGFLQSLMIK-DVPPQQ  438

Query  230  SSED  219
             +++
Sbjct  439  LNKE  442



>ref|XP_011046630.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Populus 
euphratica]
Length=441

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 116/185 (63%), Gaps = 1/185 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +++YLKA F F KN  +++++++G+  + SQ+V +PL+ P V E+ +L I LL  
Sbjct  258  GMQASIMYYLKARFHFSKNHNADLMLLLGIAGMASQLVFMPLLAPHVAEEKLLAIGLLGG  317

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
            IA +LLY  AW+ WVPY +  F V  + V P   ++ S+    T+QGKAQG ++G+ + A
Sbjct  318  IADALLYSVAWSNWVPYATTIFAVFIVCVPPCLRSIASKQVGPTEQGKAQGCISGIISFA  377

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS++APF   GF I+C     +IA   + +++  AP   S +  +
Sbjct  378  NIISPLIFSPLTALFLSEDAPFHFPGFSILCIGFATMIAFFQSVLMR-GAPPISSHKISS  436

Query  212  ESIEA  198
             S+ A
Sbjct  437  NSLVA  441



>ref|XP_004500909.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X4 [Cicer arietinum]
Length=420

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 101/160 (63%), Gaps = 0/160 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F FDKN  ++++++ G+   VSQ++++P+  P +GE  +L I L   
Sbjct  216  GLHGSMMYYLKARFHFDKNHFADLMVISGIAGTVSQLLLMPIFAPTLGEARLLSIGLFFH  275

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW++WVPY +  F ++++   P   +++S+     +QG+AQG ++G+ +IA
Sbjct  276  CVHMFLYSIAWSSWVPYAAAMFSILFVFSQPCIRSIVSKQVDPHEQGRAQGCISGICSIA  335

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIAL  273
             ++SP+  +PLT  FLS+ APFD  GF I+C  +  V  L
Sbjct  336  QIVSPLVFSPLTALFLSEKAPFDFPGFSIMCIGIASVRTL  375



>ref|XP_004500906.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Cicer arietinum]
Length=466

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 101/160 (63%), Gaps = 0/160 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+   +++YLKA F FDKN  ++++++ G+   VSQ++++P+  P +GE  +L I L   
Sbjct  262  GLHGSMMYYLKARFHFDKNHFADLMVISGIAGTVSQLLLMPIFAPTLGEARLLSIGLFFH  321

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              +  LY  AW++WVPY +  F ++++   P   +++S+     +QG+AQG ++G+ +IA
Sbjct  322  CVHMFLYSIAWSSWVPYAAAMFSILFVFSQPCIRSIVSKQVDPHEQGRAQGCISGICSIA  381

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIAL  273
             ++SP+  +PLT  FLS+ APFD  GF I+C  +  V  L
Sbjct  382  QIVSPLVFSPLTALFLSEKAPFDFPGFSIMCIGIASVRTL  421



>ref|XP_010539087.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Tarenaya hassleriana]
Length=450

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 101/152 (66%), Gaps = 0/152 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ A  ++YLKA F F+K+Q ++++++ G    +SQ++ +P++   +GE+++L I L  
Sbjct  260  AGLQASTMYYLKAKFHFNKDQFADLMVIYGAAGSISQLLFMPILVHGLGEEIMLSIGLFF  319

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
              A   L   AW+AWVPY S +F V  IL  P+  +++S+  ++ +QGKAQG ++ + + 
Sbjct  320  GCANMFLLSVAWSAWVPYTSAAFSVFSILSQPSMRSIVSKQVATHEQGKAQGIISSICSF  379

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIIC  300
            AS++SP+  +PLT  FLSD APF+  GF I+C
Sbjct  380  ASVISPLAFSPLTDLFLSDRAPFNFPGFSIMC  411



>ref|XP_008445313.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
melo]
Length=437

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 114/180 (63%), Gaps = 0/180 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +L+YLKA F FDK++ ++++++ G  +  SQ++++P++ P +GE  +L +AL   
Sbjct  258  GLHASVLYYLKARFQFDKDRFADLMVIFGAASTFSQLILIPILVPVLGEGRLLSVALFFY  317

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                LLY  AWA WV Y++    +++I   P   +++S+   +++QGKAQG ++G+   +
Sbjct  318  SVQMLLYSIAWADWVVYVATMLSMLFIFWQPCLQSIVSKQVGASEQGKAQGCISGISLFS  377

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS+NAPF   GF I+CA   +++A   + +++    A  SS  +A
Sbjct  378  NVVSPLVFSPLTALFLSENAPFYFPGFSILCAGASVMLAFVRSILMRTPTRATTSSHVEA  437



>ref|XP_006409366.1| hypothetical protein EUTSA_v10022689mg [Eutrema salsugineum]
 gb|ESQ50819.1| hypothetical protein EUTSA_v10022689mg [Eutrema salsugineum]
Length=452

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 112/183 (61%), Gaps = 5/183 (3%)
 Frame = -3

Query  767  SWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilci  588
            ++  SG+++  ++YLKA FGF KN  +++ ++V +    SQ+ ++P++   +GE+ +L  
Sbjct  259  TFSQSGMESAFMYYLKARFGFKKNDFAQLSLLVWIIGSFSQLFIMPILVSSIGERWVLST  318

Query  587  allasiaysllYGFAWAAWVPYLSVSF--GVIYILVTPATYAVISRASSSTDQGKAQGFV  414
             LL     + +   +WAAWVPY +  F  GV++I+  P+   + SR   S +QGK QG +
Sbjct  319  GLLMEFFNAAILSVSWAAWVPYAATVFIPGVMFIM--PSVSGIASRQVGSAEQGKVQGSI  376

Query  413  AGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAK  234
             GV++ A +++P   +PLT  FLSDNAPF   GF ++C +L ++I    + M+K D P+ 
Sbjct  377  YGVKSFAEVVAPFVYSPLTALFLSDNAPFYFPGFSLLCIALSLMIGFLQSLMIK-DVPSS  435

Query  233  KSS  225
             SS
Sbjct  436  SSS  438



>ref|XP_010494156.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Camelina sativa]
Length=435

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 111/175 (63%), Gaps = 0/175 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ A  ++YLKA F F+K+Q ++++++ G    +SQ++ +P++ P + E+ +L I L  
Sbjct  260  AGLHASSMYYLKAKFHFNKDQFADLMIICGAAGSISQLLFMPILVPALKEERLLSIGLFF  319

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            + A+  L   AW++WVPY++    +  +       +++S+  +S +QGKAQG ++ + ++
Sbjct  320  ASAHMFLLCVAWSSWVPYIAAISALFSVFPQSCIRSIVSKQVASYEQGKAQGIISSICSL  379

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            A+++SP+  +PLT WFLS+ APF+  GF I+CA   M +A   + M++   P +K
Sbjct  380  ANVISPLAFSPLTDWFLSERAPFNFPGFSIMCAGFTMTVAFIQSIMIRATTPIEK  434



>ref|XP_006342087.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=438

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 110/184 (60%), Gaps = 0/184 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G++A +L +LKA F F+KNQ +++L++ G+   +SQ++++P++ P  GE+ +L I L  S
Sbjct  254  GLEASILFFLKAQFHFNKNQFADLLIISGIAGSISQLLLMPILAPAFGEEKLLSIGLFFS  313

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY  AW++WVPY      ++     P   ++ S+     +QGK QG + G+ + A
Sbjct  314  CLHMLLYSIAWSSWVPYACAMISILSNFAMPCLKSIASKQIGPNEQGKVQGCITGISSFA  373

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            S++SP+  +PLT  FLS NAPF   GFG+ CA+   ++A   + M+K D      S +D+
Sbjct  374  SVVSPLIFSPLTALFLSQNAPFHYPGFGLACAAFASMLAFIQSLMIKPDENVTNWSVNDS  433

Query  212  ESIE  201
               E
Sbjct  434  NLAE  437



>ref|XP_004983781.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X3 [Setaria italica]
Length=324

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 106/161 (66%), Gaps = 0/161 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+   LL++LKA F + KNQ + +L+++G+    SQ+ V+PL+ P +GE+ +L IAL+A
Sbjct  148  TGLLNTLLYFLKAKFHYSKNQYANLLLIMGITGSFSQLAVMPLLVPKLGEQKLLIIALIA  207

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            S  ++ LY  AW++WVPYL+ S  V+  LV P   ++IS+     +QG  QG + G+ +I
Sbjct  208  SCGHAFLYSIAWSSWVPYLAASCVVLSTLVNPCIRSIISKKVGPFEQGMVQGCITGISSI  267

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIAL  273
            A+++SP+  TPLT W LS+  PF  KGF + CA    ++AL
Sbjct  268  ANVISPLVFTPLTAWCLSEATPFYLKGFSLACAGFATLVAL  308



>ref|XP_008447920.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Cucumis melo]
 ref|XP_008447921.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Cucumis melo]
Length=449

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 108/167 (65%), Gaps = 2/167 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +L+Y KA F FDK+Q ++++++ GV   VSQ+V++PL+ P + E  +L + LL  
Sbjct  265  GMQASILYYFKARFHFDKDQFADLMLLNGVAGTVSQLVLMPLLVPVLSEDKLLSLGLLVG  324

Query  572  iaysllYGFAWAAWVPY-LSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
                ++   AWA WVPY +++SF +  + V+P   +++S+     +QGK QG ++G+ ++
Sbjct  325  SISMVINSIAWAIWVPYAVAISF-IFSVFVSPCLRSIVSKQVGQNEQGKIQGCLSGLSSL  383

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACML  255
            A + +PI  +PLT  FLSD+ PF+  GF ++C ++  VIAL  + M+
Sbjct  384  AQIAAPIIFSPLTALFLSDHPPFNFPGFSLLCIAITSVIALILSLMM  430



>ref|XP_009124112.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Brassica rapa]
Length=367

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 103/160 (64%), Gaps = 0/160 (0%)
 Frame = -3

Query  719  AAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallasiaysllYGFAW  540
            A F F+K+Q ++++++ G+   VSQ++ +P++ P + E+ +L I L    A+  L G AW
Sbjct  201  AKFHFNKDQFADLMIIFGIAGSVSQLLFMPILIPALKEEKLLSIGLFFGCAHMFLLGMAW  260

Query  539  AAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSPIGMTPL  360
            +AWVPY++  F ++ I       +++S+  +S +QGKAQG ++ + ++A+++SP+  +PL
Sbjct  261  SAWVPYMAAMFSLVSIFPQSCMRSIVSKQVTSYEQGKAQGIISSICSLANVISPLAFSPL  320

Query  359  TTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            T WFLS+ APF+  GF ++CA   M IA   + M++   P
Sbjct  321  TGWFLSERAPFNFPGFSLMCAGFTMTIAFILSLMIRATTP  360



>emb|CDY31390.1| BnaA07g03250D [Brassica napus]
Length=440

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 104/179 (58%), Gaps = 0/179 (0%)
 Frame = -3

Query  737  LLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallasiaysl  558
             L++LKA FGFDKNQ +++++++ +   +SQ+ VLP     +GE+ +L   L        
Sbjct  260  FLYFLKARFGFDKNQFADLMLLITIVGSISQLFVLPRFASTIGERKLLSAGLFMEFTNMA  319

Query  557  lYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSP  378
            +   +WA WVPYL+  F    +LV P+   + SR     +QGK QG ++GV++   +++P
Sbjct  320  VVSISWAPWVPYLTTLFVPGAMLVMPSVCGIASRQVGPGEQGKMQGCISGVKSFGKVVAP  379

Query  377  IGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDAESIE  201
               +PLT  FLS+NAPF   GF ++C SL  +I    + M+K   P++ + E ++ S E
Sbjct  380  FVFSPLTALFLSNNAPFYFPGFSLLCISLSSMIGFFQSLMIKDVPPSQLNKEINSTSRE  438



>ref|XP_002313691.1| hypothetical protein POPTR_0009s14090g [Populus trichocarpa]
 gb|EEE87646.1| hypothetical protein POPTR_0009s14090g [Populus trichocarpa]
Length=442

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 113/176 (64%), Gaps = 0/176 (0%)
 Frame = -3

Query  767  SWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilci  588
            S    G+ A +++YLKA F F KNQ ++++++VGV  + SQ++ +PL+ P V E+ +L I
Sbjct  254  SLSYGGLQASIMYYLKARFHFSKNQYADLMLLVGVSGMASQLLFMPLLAPLVAEEKLLAI  313

Query  587  allasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAG  408
             LL  IA +LLY  A +AWVPY +  F V  + + P   +++S+     +QGKAQG ++G
Sbjct  314  GLLGGIANALLYSVACSAWVPYATTIFSVFAVFIPPCLRSIVSKQIGPNEQGKAQGCISG  373

Query  407  VQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            + ++A+++SP+  +PLT  FLS++APF+  GF  +C    ++IA   + +++   P
Sbjct  374  IISLANIISPLIYSPLTALFLSEDAPFNFPGFIFVCIGFAIMIAFFQSLLIRAAPP  429



>ref|XP_007222153.1| hypothetical protein PRUPE_ppa005755mg [Prunus persica]
 gb|EMJ23352.1| hypothetical protein PRUPE_ppa005755mg [Prunus persica]
Length=445

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 113/171 (66%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +++YLKA F F+K+Q ++++++ GV   +SQ++++PL+ P +GE+ +L I L  S
Sbjct  261  GLHASMMYYLKARFHFNKDQFADLMVISGVAGTISQLLLMPLLAPALGEEKLLSIGLFFS  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+  LYG AW+ WVPY +  F + Y+  TP   +++S+    ++QGKAQG ++G+ + A
Sbjct  321  CAHMFLYGVAWSFWVPYAAAMFSIFYVFATPCMRSIVSKQVGPSEQGKAQGCISGICSFA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            +++SPI  +PLT  FLS+ APF+  GF +IC     +IA   + M++   P
Sbjct  381  NVISPIAFSPLTALFLSEKAPFNFPGFSLICVGFAAMIAFIQSVMIRAVPP  431



>ref|XP_010467437.1| PREDICTED: uncharacterized protein LOC104747497 [Camelina sativa]
Length=460

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 111/194 (57%), Gaps = 11/194 (6%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+++  L++LKA FGFDK Q +E+++++ +    +Q+ VLP     +GE+ +L 
Sbjct  268  SSFSESGLESAYLYFLKARFGFDKKQFAELVLLLNIVGSFTQLFVLPRFASAIGERKLLS  327

Query  590  iallasiaysllYGFAWAAWVPYLSVSF---GVIYILVTPATYAVISRASSSTDQGKAQG  420
              L        +   +WA WVPY +  F   G ++++  PA   + SR   + +QGK QG
Sbjct  328  TGLFMQFLNMAIVSISWAPWVPYFTTIFVLPGALFVI--PAVCGIASRQVGTGEQGKVQG  385

Query  419  FVAGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK----  252
             ++GV++  +++ P  ++PLT  FLSDNAPF   GF ++C SL  +I    +  +K    
Sbjct  386  CISGVRSFGAVVGPFALSPLTALFLSDNAPFYFPGFCLLCVSLSSLIGFFQSLFIKDVPT  445

Query  251  --LDAPAKKSSEDD  216
              L+  + K+S D+
Sbjct  446  PPLNKASNKTSRDE  459



>ref|XP_002521243.1| tetracycline transporter, putative [Ricinus communis]
 gb|EEF41099.1| tetracycline transporter, putative [Ricinus communis]
Length=410

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 97/157 (62%), Gaps = 0/157 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            GI A  ++Y KA F F KNQ +++ ++ G+  ++SQ++ +PL+ PFV EK +L   L   
Sbjct  183  GIQAASMYYWKARFHFTKNQFADLFLLAGLAGMISQLIFMPLLAPFVSEKKLLSAGLFMG  242

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                LLY  +W+ WVPY + +  V  + VTP+  +++S+     +QGKAQG ++ + + A
Sbjct  243  FVTMLLYSISWSFWVPYATTALTVFVVFVTPSLRSIVSKQVGPDEQGKAQGCISSISSFA  302

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMV  282
            +++SP+  +PLT  FLS+ APF   GF ++C    +V
Sbjct  303  NIISPLIFSPLTALFLSEEAPFHFPGFSMLCIGFALV  339



>ref|XP_002280708.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Vitis 
vinifera]
 emb|CBI37822.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 106/185 (57%), Gaps = 2/185 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL++LKA F F+KNQ ++++++VGV   +SQ++ +PL+ P V E+ +L I L   
Sbjct  257  GLQASLLYFLKARFHFNKNQFADIMLIVGVMGTISQLLFMPLLAPRVSEEKLLSIGLFMG  316

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   AW+ WVPY   +     +   P   ++ S+     +QGKAQG ++G+ + A
Sbjct  317  CTNIFLNSIAWSFWVPYAIAALAAFAVFANPCVRSIASKQVGPNEQGKAQGCISGISSSA  376

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
             ++SP+  +PLT  FLS  APF   GF I+C     +IA   + M++   P   SS+  +
Sbjct  377  QIISPLIFSPLTALFLSQGAPFYFPGFSIMCIGFASMIAFIQSTMIRAVPPI--SSQPTS  434

Query  212  ESIEA  198
             SIEA
Sbjct  435  NSIEA  439



>ref|XP_009124111.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Brassica rapa]
Length=434

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 103/160 (64%), Gaps = 0/160 (0%)
 Frame = -3

Query  719  AAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallasiaysllYGFAW  540
            A F F+K+Q ++++++ G+   VSQ++ +P++ P + E+ +L I L    A+  L G AW
Sbjct  268  AKFHFNKDQFADLMIIFGIAGSVSQLLFMPILIPALKEEKLLSIGLFFGCAHMFLLGMAW  327

Query  539  AAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSPIGMTPL  360
            +AWVPY++  F ++ I       +++S+  +S +QGKAQG ++ + ++A+++SP+  +PL
Sbjct  328  SAWVPYMAAMFSLVSIFPQSCMRSIVSKQVTSYEQGKAQGIISSICSLANVISPLAFSPL  387

Query  359  TTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            T WFLS+ APF+  GF ++CA   M IA   + M++   P
Sbjct  388  TGWFLSERAPFNFPGFSLMCAGFTMTIAFILSLMIRATTP  427



>ref|XP_009124108.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Brassica rapa]
 ref|XP_009124110.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Brassica rapa]
Length=458

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 103/160 (64%), Gaps = 0/160 (0%)
 Frame = -3

Query  719  AAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallasiaysllYGFAW  540
            A F F+K+Q ++++++ G+   VSQ++ +P++ P + E+ +L I L    A+  L G AW
Sbjct  292  AKFHFNKDQFADLMIIFGIAGSVSQLLFMPILIPALKEEKLLSIGLFFGCAHMFLLGMAW  351

Query  539  AAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIASLLSPIGMTPL  360
            +AWVPY++  F ++ I       +++S+  +S +QGKAQG ++ + ++A+++SP+  +PL
Sbjct  352  SAWVPYMAAMFSLVSIFPQSCMRSIVSKQVTSYEQGKAQGIISSICSLANVISPLAFSPL  411

Query  359  TTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            T WFLS+ APF+  GF ++CA   M IA   + M++   P
Sbjct  412  TGWFLSERAPFNFPGFSLMCAGFTMTIAFILSLMIRATTP  451



>ref|XP_010489312.1| PREDICTED: uncharacterized protein LOC104767001 isoform X2 [Camelina 
sativa]
Length=379

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 111/194 (57%), Gaps = 11/194 (6%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+++  L++LKA FGFDK Q +E+++++ +    +Q+ VLP     +GE+ +L 
Sbjct  187  SSFSESGLESAYLYFLKARFGFDKKQFAELVLLLNIVGSFTQLFVLPRFASAIGERKLLS  246

Query  590  iallasiaysllYGFAWAAWVPYLSVSF---GVIYILVTPATYAVISRASSSTDQGKAQG  420
              L        +   +WA WVPY +  F   G ++++  P+   + SR   + +QGK QG
Sbjct  247  TGLFMQFLNMAIVSISWAPWVPYFTTIFVLPGALFVI--PSVCGIASRQVGTGEQGKVQG  304

Query  419  FVAGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK----  252
             ++GV++  +++ P  ++PLT  FLSDNAPF   GF ++C SL  +I    +  +K    
Sbjct  305  CISGVRSFGAVVGPFALSPLTALFLSDNAPFYFPGFCLLCVSLSSLIGFFQSLFIKDVPT  364

Query  251  --LDAPAKKSSEDD  216
              L+  + K+S D+
Sbjct  365  PPLNKASNKTSRDE  378



>ref|XP_004983779.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Setaria italica]
Length=435

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 109/168 (65%), Gaps = 0/168 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+   LL++LKA F + KNQ + +L+++G+    SQ+ V+PL+ P +GE+ +L IAL+A
Sbjct  259  TGLLNTLLYFLKAKFHYSKNQYANLLLIMGITGSFSQLAVMPLLVPKLGEQKLLIIALIA  318

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            S  ++ LY  AW++WVPYL+ S  V+  LV P   ++IS+     +QG  QG + G+ +I
Sbjct  319  SCGHAFLYSIAWSSWVPYLAASCVVLSTLVNPCIRSIISKKVGPFEQGMVQGCITGISSI  378

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            A+++SP+  TPLT W LS+  PF  KGF + CA    ++AL  +  ++
Sbjct  379  ANVISPLVFTPLTAWCLSEATPFYLKGFSLACAGFATLVALATSISMR  426



>gb|KHN37382.1| Hippocampus abundant transcript 1 protein [Glycine soja]
Length=424

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 106/171 (62%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ AVLL+YLKA F F+KNQ +++LM+ G+GA ++Q+  +P++ P +GE+ +L   LL S
Sbjct  238  GLMAVLLYYLKARFQFNKNQFADLLMITGIGATLAQLFFMPILVPVIGEEKLLSTGLLIS  297

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +Y  AW AWVPY      V  + V P+  ++ S+    T+QG  QG ++ + + A
Sbjct  298  CINVFVYSIAWTAWVPYALAGCSVFAVFVRPSLCSIASKQVGPTEQGMVQGCLSAISSFA  357

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++++P+  +PLT  FLS+ APF   GF ++C  L +++A   + M++   P
Sbjct  358  NIIAPLIFSPLTALFLSEEAPFYFPGFSLMCLGLALMVAFFQSLMIRAVPP  408



>ref|XP_004238394.1| PREDICTED: uncharacterized protein LOC101248671 [Solanum lycopersicum]
Length=436

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 110/181 (61%), Gaps = 0/181 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G++A LL +LKA F F+K Q +++L++ G+   +SQ++++P++ P  GE+ +L I L  S
Sbjct  254  GLEASLLFFLKAQFHFNKIQFADLLIISGIAGSISQLLLMPILAPAFGEEKLLSIGLFFS  313

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY  AW++WVPY S    ++ I   P   ++ S+     +QGK QG + G+ + A
Sbjct  314  CLHMLLYSIAWSSWVPYASAMISMLSIFAMPCLKSIASKQIGPNEQGKVQGCITGICSFA  373

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            S++SP+  +PLT  FLS NAPF   GFG+ CA+   ++A   + M+K D      S +D+
Sbjct  374  SVVSPLIFSPLTALFLSQNAPFHYPGFGLACAAFGSMLAFIQSLMIKPDNNVTNWSVNDS  433

Query  212  E  210
             
Sbjct  434  N  434



>ref|XP_003535759.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Glycine 
max]
Length=443

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 106/171 (62%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ AVLL+YLKA F F+KNQ +++LM+ G+GA ++Q+  +P++ P +GE+ +L   LL S
Sbjct  257  GLMAVLLYYLKARFQFNKNQFADLLMITGIGATLAQLFFMPILVPVIGEEKLLSTGLLIS  316

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +Y  AW AWVPY      V  + V P+  ++ S+    T+QG  QG ++ + + A
Sbjct  317  CINVFVYSIAWTAWVPYALAGCSVFAVFVRPSLCSIASKQVGPTEQGMVQGCLSAISSFA  376

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++++P+  +PLT  FLS+ APF   GF ++C  L +++A   + M++   P
Sbjct  377  NIIAPLIFSPLTALFLSEEAPFYFPGFSLMCLGLALMVAFFQSLMIRAVPP  427



>ref|XP_010467445.1| PREDICTED: uncharacterized protein LOC104747501 isoform X1 [Camelina 
sativa]
 ref|XP_010467446.1| PREDICTED: uncharacterized protein LOC104747501 isoform X1 [Camelina 
sativa]
 ref|XP_010467447.1| PREDICTED: uncharacterized protein LOC104747501 isoform X1 [Camelina 
sativa]
 ref|XP_010467448.1| PREDICTED: uncharacterized protein LOC104747501 isoform X1 [Camelina 
sativa]
Length=460

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 111/194 (57%), Gaps = 11/194 (6%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+++  L++LKA FGFDK Q ++++++V +   ++Q+ VLP     +GE+ +L 
Sbjct  268  SSFSESGLESAFLYFLKARFGFDKKQFADLVLLVNIVGSITQLFVLPRFASAMGERKLLS  327

Query  590  iallasiaysllYGFAWAAWVPYLSVSF---GVIYILVTPATYAVISRASSSTDQGKAQG  420
              L        +   +WA WVPY + +F   G ++++  P+   + SR   + +QGK QG
Sbjct  328  TGLFMQFLNMAIVSISWAPWVPYFTTTFLLPGALFVI--PSVCGIASREVGTGEQGKVQG  385

Query  419  FVAGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK----  252
             ++GV++   ++ P  ++PLT  FLSDNAPF   GF ++C SL  +I    +  +K    
Sbjct  386  CLSGVRSFGRVVGPFALSPLTALFLSDNAPFYFPGFCLLCVSLSSLIGFFQSLFIKDGPT  445

Query  251  --LDAPAKKSSEDD  216
              L+    K+S D+
Sbjct  446  PPLNKAINKTSRDE  459



>gb|EYU37987.1| hypothetical protein MIMGU_mgv1a019548mg, partial [Erythranthe 
guttata]
Length=432

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ + L++YLKA F F K+Q +++ ++  +   +S +VV+PL+ P +GE+    +  + 
Sbjct  256  AGVQSFLMYYLKARFHFQKDQFADIWLITNIAFTISSMVVMPLLAPLLGEECRRRMLAML  315

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
                      AWA WVPY S  FGV   + +P+   +IS+    ++QG AQG + G+ + 
Sbjct  316  LD------SIAWAGWVPYASALFGVFLFVASPSIRCIISKQVGPSEQGIAQGCLMGIASF  369

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMV  282
            A+++SP+  +PL+ WFLSD +PF+  GF I+C  L  V
Sbjct  370  ANIISPLIYSPLSAWFLSDTSPFNFPGFSILCVGLAWV  407



>ref|XP_010489311.1| PREDICTED: uncharacterized protein LOC104767001 isoform X1 [Camelina 
sativa]
Length=460

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 111/194 (57%), Gaps = 11/194 (6%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S+  SG+++  L++LKA FGFDK Q +E+++++ +    +Q+ VLP     +GE+ +L 
Sbjct  268  SSFSESGLESAYLYFLKARFGFDKKQFAELVLLLNIVGSFTQLFVLPRFASAIGERKLLS  327

Query  590  iallasiaysllYGFAWAAWVPYLSVSF---GVIYILVTPATYAVISRASSSTDQGKAQG  420
              L        +   +WA WVPY +  F   G ++++  P+   + SR   + +QGK QG
Sbjct  328  TGLFMQFLNMAIVSISWAPWVPYFTTIFVLPGALFVI--PSVCGIASRQVGTGEQGKVQG  385

Query  419  FVAGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK----  252
             ++GV++  +++ P  ++PLT  FLSDNAPF   GF ++C SL  +I    +  +K    
Sbjct  386  CISGVRSFGAVVGPFALSPLTALFLSDNAPFYFPGFCLLCVSLSSLIGFFQSLFIKDVPT  445

Query  251  --LDAPAKKSSEDD  216
              L+  + K+S D+
Sbjct  446  PPLNKASNKTSRDE  459



>ref|XP_004143076.1| PREDICTED: uncharacterized protein LOC101213676 [Cucumis sativus]
Length=836

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 114/176 (65%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F FDK+  ++++++ G  + +SQ++++P++ P +GE  +L I L  +
Sbjct  258  GLYASLLYYLKARFHFDKDMFADLMVISGTTSTISQLLLMPILIPALGENRLLSIGLFFN  317

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY FAWA WV Y++  F  ++I   P   +++S+   +++QGKAQG ++G+ + A
Sbjct  318  CIHMLLYSFAWADWVVYVAPMFSTLFIFWRPCLQSIVSKQVGASEQGKAQGCISGISSFA  377

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS  225
             ++SP+  +PLT  FLS NAPF   GF I+CA    +IA   + M++   P+K +S
Sbjct  378  HVVSPLVFSPLTALFLSQNAPFYFPGFSIMCAGSIAMIAFVQSIMIR--DPSKANS  431


 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 114/181 (63%), Gaps = 2/181 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G  A +++YLKA F FDK+++++++++ GV + +SQ+++ P++ P +GE  +L + +  +
Sbjct  655  GHHASIMYYLKAKFHFDKDRIADLMVISGVASSISQLLLTPILVPALGENRLLSVGVFFN  714

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LL+  AW+AWV Y +    V+YI   P   +++S+   + +QGKAQG ++G+ + A
Sbjct  715  SLHMLLHSLAWSAWVSYGAAMLSVLYIFWQPCLQSIVSKQVGAGEQGKAQGCISGISSFA  774

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP   +PL   FLS+NAPF   GF I+CA+   + A   + M+K  APAK  +    
Sbjct  775  NVVSPFVFSPLAALFLSENAPFHFPGFSIMCAASAAMTAFVQSMMIK--APAKACTSIHV  832

Query  212  E  210
            E
Sbjct  833  E  833



>ref|XP_010494154.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Camelina sativa]
 ref|XP_010494155.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Camelina sativa]
Length=438

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 109/172 (63%), Gaps = 0/172 (0%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+ A  ++YLKA F F+K+Q ++++++ G    +SQ++ +P++ P + E+ +L I L  
Sbjct  260  AGLHASSMYYLKAKFHFNKDQFADLMIICGAAGSISQLLFMPILVPALKEERLLSIGLFF  319

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
            + A+  L   AW++WVPY++    +  +       +++S+  +S +QGKAQG ++ + ++
Sbjct  320  ASAHMFLLCVAWSSWVPYIAAISALFSVFPQSCIRSIVSKQVASYEQGKAQGIISSICSL  379

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            A+++SP+  +PLT WFLS+ APF+  GF I+CA   M +A   + M++   P
Sbjct  380  ANVISPLAFSPLTDWFLSERAPFNFPGFSIMCAGFTMTVAFIQSIMIRATTP  431



>ref|XP_009355593.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009355595.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X2 [Pyrus x bretschneideri]
Length=442

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 100/167 (60%), Gaps = 0/167 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL++LKA F F+KNQ ++++++  +    SQ++ +P+    +GE+ +L I L+  
Sbjct  261  GMQASLLYFLKARFHFNKNQFADLMLIFSISGATSQLLFMPMFATAIGEEKLLTIGLIMG  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 L   +WA WVPY +  F V   LV P+  ++ S+     DQG+AQG + G+ + A
Sbjct  321  SMSMFLNSISWAVWVPYAATLFNVFGYLVQPSIRSIASKQVGPHDQGRAQGCILGISSFA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLK  252
            +++SP+  +PLT  FLS+ APF+  GF I+C  L  +I    + M+K
Sbjct  381  NIVSPLLFSPLTALFLSEEAPFNFPGFSIMCIGLAPLIGFVQSLMIK  427



>ref|XP_010467435.1| PREDICTED: uncharacterized protein LOC104747494 isoform X1 [Camelina 
sativa]
Length=473

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 109/178 (61%), Gaps = 4/178 (2%)
 Frame = -3

Query  767  SWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilci  588
            ++  SG+ +  +++LKA FGF+KN  +E+L++V +   +SQ+ +LP++   +GE+ +L  
Sbjct  273  TFSQSGMGSAFMYFLKARFGFNKNDFAELLLLVNIIGSISQLFILPILVSAIGERKVLST  332

Query  587  allasiaysllYGFAWAAWVPYLSVSF--GVIYILVTPATYAVISRASSSTDQGKAQGFV  414
             LL     +     AW+AWVPY +     GV++++  P+   + SR   S++QGK QG +
Sbjct  333  GLLMEFLNAACLSVAWSAWVPYATTLLVPGVMFVM--PSVCGIASRQVGSSEQGKVQGCI  390

Query  413  AGVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            +GV+A A +++P   +PLT  FLS+NAPF   GF ++C +  ++I    + ++K   P
Sbjct  391  SGVKAFAGVVAPFLFSPLTALFLSENAPFYFPGFSLLCVAFSLMIGFLQSLLIKEHPP  448



>gb|AFW72717.1| hypothetical protein ZEAMMB73_747947 [Zea mays]
Length=479

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 114/203 (56%), Gaps = 8/203 (4%)
 Frame = -3

Query  767  SWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilci  588
            S    G+   LL+YLKA FG++K++ + +L++VG   ++SQ+ V+P++ P +GE+++L +
Sbjct  260  SLGEHGLQTALLYYLKAQFGYNKDEFANLLLIVGAAGMLSQLTVMPILAPILGEEMLLIV  319

Query  587  allasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAG  408
             LL    +  LYG AW+ WVPY + +F ++   V P+    +S+   S +QG AQG ++G
Sbjct  320  GLLGGCTHVFLYGIAWSYWVPYFAAAFVILSAFVHPSIRTNVSKNVGSNEQGIAQGCISG  379

Query  407  VQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKS  228
            + + AS+L P+  TPLT        PF+ KGF I+CA  C  I        K+ +  +K 
Sbjct  380  ISSFASILGPLIFTPLTE-------PFNFKGFSILCAGFCTCIDRKGQDGKKVTSSKRKR  432

Query  227  SEDDAE-SIEAPLLS*VRVLRRE  162
              +  E   E P L  +    RE
Sbjct  433  VPNHVEIPKENPKLVIINFKVRE  455



>gb|EYU40457.1| hypothetical protein MIMGU_mgv1a021568mg [Erythranthe guttata]
Length=438

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 110/185 (59%), Gaps = 0/185 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S   +G+ + L++YLKA F + K+Q +++ ++  +GA VS +V++P + P +GE+ +LC
Sbjct  248  NSLAEAGVQSFLMYYLKARFHYQKDQFADIWLITYIGATVSNMVLMPTLGPLLGEETLLC  307

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L+A     LLY  AW +WVPY S S  +   L +P+   +IS+ +   +QG AQG + 
Sbjct  308  IGLVAGFLNMLLYSIAWTSWVPYASASLAIFLSLASPSIRCIISKQAGPYEQGIAQGCIM  367

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKK  231
            GV + A+++SP+  +PL+  FLS+ APF+  GF I+C  L  +     + M+K+     +
Sbjct  368  GVSSFANVISPLIYSPLSALFLSEAAPFNFPGFSILCVGLAWLAGFVLSAMIKIVPLLSR  427

Query  230  SSEDD  216
                D
Sbjct  428  RRPSD  432



>ref|XP_008445314.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=438

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 118/180 (66%), Gaps = 0/180 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F FDK++ ++++++ G  + +SQ+++LP++ P +GE  +L + L  +
Sbjct  259  GLYASLLYYLKARFHFDKDRFADLMVISGAASTISQLLLLPILIPALGENRLLSVGLFFN  318

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY FAWA WV Y++  F +++I   P   +++S+   +++QGKAQG ++G+ + A
Sbjct  319  CIHMLLYSFAWADWVAYVAAMFSILFIFWRPCLQSIVSKQVGASEQGKAQGCISGISSFA  378

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP+  +PLT  FLS NAPF   GF I+CA    +IA   + M++  + A  SS  +A
Sbjct  379  NVVSPLVFSPLTALFLSQNAPFYFPGFSIMCAGSTAMIAFVQSMMIRDPSKANSSSHVEA  438



>ref|XP_010467431.1| PREDICTED: uncharacterized protein LOC104747492 isoform X2 [Camelina 
sativa]
Length=398

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 109/177 (62%), Gaps = 1/177 (1%)
 Frame = -3

Query  767  SWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilci  588
            ++  SG+ +  L++LKA FGF+KN  +E+++++ +   +SQ+ VLP++   +GE+ +L I
Sbjct  202  TFAQSGMQSAFLYFLKARFGFNKNDFAELILLMTIIGSISQLFVLPILVSAIGERKVLSI  261

Query  587  allasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAG  408
             LL     +     +W+AWVPY +     + + V P+   + SR   + +QGK QG+++G
Sbjct  262  GLLMETLNAACLSVSWSAWVPYATTVLVPVVMFVMPSVCGIASRQVGAGEQGKVQGYISG  321

Query  407  VQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPA  237
            V++ + +L+P   +PLT  FLS+NAPF   GF ++C +  ++I    + ++K D P+
Sbjct  322  VKSFSGVLAPFIYSPLTALFLSENAPFYFPGFSLLCVAFSLMIGFLLSLLIK-DVPS  377



>ref|XP_007041738.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOX97569.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=444

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 122/185 (66%), Gaps = 2/185 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ + L++YLKA F F+KNQ ++++++ G+ + +SQ+ ++PL+   +G+  +L I LL S
Sbjct  260  GMISSLMYYLKARFHFNKNQFADLMLIAGIISTISQLFLMPLLVSPLGDGKLLSIGLLVS  319

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISR-ASSSTDQGKAQGFVAGVQAI  396
             A ++LY  AW+ WVPY + +  ++ +   P+  ++ S+ A +   QGKAQG ++G+ ++
Sbjct  320  CANAILYSIAWSDWVPYAATALSIMMVFAPPSLRSIASKQAGAREQQGKAQGCISGISSL  379

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDD  216
            A++++P+  +PLT  FLS++APF   GF IIC ++ ++IA   + M+   AP+  S ++ 
Sbjct  380  ANIIAPLVFSPLTALFLSEDAPFHFPGFSIICIAITLMIAFIQSLMIG-SAPSTSSDKNS  438

Query  215  AESIE  201
            +  +E
Sbjct  439  SNCME  443



>ref|XP_010467430.1| PREDICTED: uncharacterized protein LOC104747492 isoform X1 [Camelina 
sativa]
Length=463

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 109/177 (62%), Gaps = 1/177 (1%)
 Frame = -3

Query  767  SWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilci  588
            ++  SG+ +  L++LKA FGF+KN  +E+++++ +   +SQ+ VLP++   +GE+ +L I
Sbjct  267  TFAQSGMQSAFLYFLKARFGFNKNDFAELILLMTIIGSISQLFVLPILVSAIGERKVLSI  326

Query  587  allasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAG  408
             LL     +     +W+AWVPY +     + + V P+   + SR   + +QGK QG+++G
Sbjct  327  GLLMETLNAACLSVSWSAWVPYATTVLVPVVMFVMPSVCGIASRQVGAGEQGKVQGYISG  386

Query  407  VQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPA  237
            V++ + +L+P   +PLT  FLS+NAPF   GF ++C +  ++I    + ++K D P+
Sbjct  387  VKSFSGVLAPFIYSPLTALFLSENAPFYFPGFSLLCVAFSLMIGFLLSLLIK-DVPS  442



>ref|XP_004161094.1| PREDICTED: uncharacterized protein LOC101225919 [Cucumis sativus]
Length=810

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 114/181 (63%), Gaps = 2/181 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G  A +++YLKA F FDK+++++++++ GV + +SQ+++ P++ P +GE  +L + +  +
Sbjct  629  GHHASIMYYLKAKFHFDKDRIADLMVISGVASSISQLLLTPILVPALGENRLLSVGVFFN  688

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LL+  AW+AWV Y +    V+YI   P   +++S+   + +QGKAQG ++G+ + A
Sbjct  689  SLHMLLHSLAWSAWVSYGAAMLSVLYIFWQPCLQSIVSKQVGAGEQGKAQGCISGISSFA  748

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSSEDDA  213
            +++SP   +PL   FLS+NAPF   GF I+CA+   + A   + M+K  APAK  +    
Sbjct  749  NVVSPFVFSPLAALFLSENAPFHFPGFSIMCAASAAMTAFVQSMMIK--APAKACTSIHV  806

Query  212  E  210
            E
Sbjct  807  E  807


 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 114/176 (65%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F FDK+  ++++++ G  + +SQ++++P++ P +GE  +L I L  +
Sbjct  258  GLYASLLYYLKARFHFDKDMFADLMVISGTTSTISQLLLMPILIPALGENRLLSIGLFFN  317

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
              + LLY F+WA WV Y++  F  ++I   P   +++S+   +++QGKAQG ++G+ + A
Sbjct  318  CIHMLLYSFSWADWVVYVAPMFSTLFIFWRPCLQSIVSKQVGASEQGKAQGCISGISSFA  377

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAPAKKSS  225
             ++SP+  +PLT  FLS NAPF   GF I+CA    +IA   + M++   P+K +S
Sbjct  378  HVVSPLVFSPLTALFLSQNAPFYFPGFSIMCAGSIAMIAFVQSIMIR--DPSKANS  431



>gb|KHG11074.1| Hippocampus abundant transcript 1 [Gossypium arboreum]
Length=436

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 108/171 (63%), Gaps = 3/171 (2%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A LL+YLKA F F+K+Q ++++++ G+      ++++P++ P +GE  +L I L  +
Sbjct  259  GLHASLLYYLKARFHFNKDQFADLMVITGIAG---TLLLMPILAPVLGEAKLLSIGLFFN  315

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+ ++Y  AW+ WVPY +  F ++Y+   P   +++S+     +QGKAQGF++G+ + A
Sbjct  316  CAHMIVYSIAWSFWVPYAAALFSLLYVFSQPCIRSIVSKQVGPCEQGKAQGFISGIGSFA  375

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++ SP+  +PLT  FLS+ APF+  GF I+C     +IA   + M++   P
Sbjct  376  NVASPLLFSPLTALFLSERAPFNFPGFSIMCVGFASMIAFVQSLMIRAFPP  426



>ref|XP_003555206.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Glycine 
max]
Length=443

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 106/171 (62%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ AVLL+YLKA F F+KNQ +++LM+ G+GA ++Q+  +P++ P +GE+ +L   LL S
Sbjct  257  GLMAVLLYYLKARFQFNKNQFADLLMITGIGATLAQLFFMPILVPVIGEEKLLSTGLLIS  316

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
                 +Y  AW AWVPY      V  + V P+  ++ S+    T+QG  QG ++ + + A
Sbjct  317  CINVFVYSIAWTAWVPYALAGCSVFAVFVRPSLCSIASKQVGPTEQGMVQGCLSAISSFA  376

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            ++++P+  +PLT  FLS+ APF   GF ++C  L +++A   + +++   P
Sbjct  377  NIIAPLIFSPLTALFLSEEAPFYFPGFSLMCLGLALMVAFFQSLIIRAVPP  427



>ref|XP_008221200.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Prunus 
mume]
Length=446

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 112/171 (65%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  GIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilciallas  573
            G+ A +++YLKA F F+K+Q ++++++ GV   +SQ++++PL+ P +GE+ +L I L  S
Sbjct  261  GLHASMMYYLKARFHFNKDQFADLMVISGVAGTISQLLLMPLLAPALGEEKLLSIGLFFS  320

Query  572  iaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAIA  393
             A+  LYG AW+ WVPY +  F + Y+  TP   +++S+    ++QGKAQG ++G+ + A
Sbjct  321  CAHMFLYGVAWSFWVPYAAAMFSIFYVFATPCMRSIVSKQVGPSEQGKAQGCISGICSFA  380

Query  392  SLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLDAP  240
            +++SPI  +PLT  FLS+ AP +  GF +IC     +IA   + M++   P
Sbjct  381  NVISPIAFSPLTALFLSEKAPINFPGFSLICVGFAAMIAFIQSVMIRAVPP  431



>ref|XP_011088648.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Sesamum indicum]
Length=379

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 102/175 (58%), Gaps = 0/175 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
             S   +GI A L++YLKA F F K+Q +++ ++  + A VS +V++P + P +GE+ +LC
Sbjct  189  NSLAEAGIQAFLMYYLKARFHFQKDQFADIWLITYISATVSNMVLMPTLGPLLGEETLLC  248

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L A     LL   AWA WVPY S   G+   L +P+   +IS+     +QG AQG V 
Sbjct  249  IGLFAGFLNMLLDSIAWAPWVPYGSAFLGIFLFLASPSLRCIISKQVGPYEQGIAQGSVM  308

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALCCACMLKLD  246
            G+ + A+++SPI  +PL+  FLSD APF   GF ++C  L   +    + ++K  
Sbjct  309  GITSFANVISPIIYSPLSALFLSDGAPFYFPGFSMLCVGLAWFVGFILSTIIKFQ  363



>ref|XP_010494158.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Camelina sativa]
Length=423

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 106/167 (63%), Gaps = 0/167 (0%)
 Frame = -3

Query  770  TSWEMSGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilc  591
            +S   +G+ A  ++YLKA F F+K+Q ++++++ G    +SQ++ +P++ P + E+ +L 
Sbjct  255  SSLGEAGLHASSMYYLKAKFHFNKDQFADLMIICGAAGSISQLLFMPILVPALKEERLLS  314

Query  590  iallasiaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVA  411
            I L  + A+  L   AW++WVPY++    +  +       +++S+  +S +QGKAQG ++
Sbjct  315  IGLFFASAHMFLLCVAWSSWVPYIAAISALFSVFPQSCIRSIVSKQVASYEQGKAQGIIS  374

Query  410  GVQAIASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIALC  270
             + ++A+++SP+  +PLT WFLS+ APF+  GF I+CA   M I  C
Sbjct  375  SICSLANVISPLAFSPLTDWFLSERAPFNFPGFSIMCAGFTMYILFC  421



>gb|EMS58246.1| Tetracycline resistance protein, class A [Triticum urartu]
Length=501

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 99/161 (61%), Gaps = 11/161 (7%)
 Frame = -3

Query  755  SGIDAVLLHYLKAAFGFDKNQLSEVLMVVGVGAIVSQIVVLPLVNPFVGEKVilcialla  576
            +G+   LL++LKA F + KNQ + +L+++G+    SQ+ V+PL+ P +GE+ +L +AL  
Sbjct  336  TGLQTALLYFLKAQFHYTKNQYANLLLIIGITGSFSQLTVMPLLAPRLGEQKLLVVALT-  394

Query  575  siaysllYGFAWAAWVPYLSVSFGVIYILVTPATYAVISRASSSTDQGKAQGFVAGVQAI  396
                           VPYL+ S  ++ ILV P   +++S+    ++QG  QG + G+ + 
Sbjct  395  ----------GSCVHVPYLAASCVILSILVGPCIRSIVSKKVGPSEQGMVQGCITGISST  444

Query  395  ASLLSPIGMTPLTTWFLSDNAPFDCKGFGIICASLCMVIAL  273
            AS++SP+  TPLT WFLS+ APF+ KGF + CA   M++AL
Sbjct  445  ASVISPLVFTPLTAWFLSETAPFNFKGFSLACAGFAMLVAL  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310