BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006A15

Length=802
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362212.1|  PREDICTED: uncharacterized protein LOC102599885    419   7e-139   Solanum tuberosum [potatoes]
ref|XP_004249181.1|  PREDICTED: protein trichome birefringence          419   9e-139   Solanum lycopersicum
ref|XP_009757308.1|  PREDICTED: protein trichome birefringence-like     418   1e-138   Nicotiana sylvestris
ref|XP_010557950.1|  PREDICTED: protein trichome birefringence-like     414   8e-138   Tarenaya hassleriana [spider flower]
ref|XP_009611858.1|  PREDICTED: protein trichome birefringence-like     414   1e-137   Nicotiana tomentosiformis
ref|XP_011078818.1|  PREDICTED: protein trichome birefringence-like     413   3e-137   Sesamum indicum [beniseed]
emb|CDP10159.1|  unnamed protein product                                412   7e-137   Coffea canephora [robusta coffee]
ref|XP_011075105.1|  PREDICTED: protein trichome birefringence-like     410   1e-136   Sesamum indicum [beniseed]
ref|XP_004249290.1|  PREDICTED: protein trichome birefringence-like     409   2e-136   Solanum lycopersicum
ref|XP_006351352.1|  PREDICTED: uncharacterized protein LOC102598...    411   3e-136   Solanum tuberosum [potatoes]
ref|XP_006351351.1|  PREDICTED: uncharacterized protein LOC102598...    412   5e-136   Solanum tuberosum [potatoes]
ref|XP_010520026.1|  PREDICTED: protein trichome birefringence-like     409   1e-135   Tarenaya hassleriana [spider flower]
ref|XP_010257492.1|  PREDICTED: protein trichome birefringence          406   6e-135   Nelumbo nucifera [Indian lotus]
gb|AAM67355.1|  unknown                                                 395   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009783309.1|  PREDICTED: protein trichome birefringence-like     406   2e-134   Nicotiana sylvestris
ref|NP_568173.2|  protein TRICHOME BIREFRINGENCE                        404   6e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002534536.1|  conserved hypothetical protein                     403   9e-134   Ricinus communis
gb|KDO70900.1|  hypothetical protein CISIN_1g037533mg                   391   2e-133   Citrus sinensis [apfelsine]
ref|XP_002871228.1|  hypothetical protein ARALYDRAFT_487481             402   3e-133   
emb|CBI30004.3|  unnamed protein product                                390   1e-132   Vitis vinifera
gb|ADI48429.1|  trichome birefringence                                  400   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429897.1|  hypothetical protein CICLE_v10011263mg             400   6e-132   Citrus clementina [clementine]
gb|KDP24643.1|  hypothetical protein JCGZ_25559                         399   7e-132   Jatropha curcas
ref|XP_009604045.1|  PREDICTED: protein trichome birefringence-like     399   9e-132   Nicotiana tomentosiformis
ref|XP_006287297.1|  hypothetical protein CARUB_v10000490mg             398   1e-131   Capsella rubella
ref|XP_006492844.1|  PREDICTED: protein YLS7-like                       399   1e-131   Citrus sinensis [apfelsine]
emb|CDY55774.1|  BnaA03g55480D                                          395   1e-131   Brassica napus [oilseed rape]
ref|XP_010491248.1|  PREDICTED: protein trichome birefringence-like     398   2e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010265940.1|  PREDICTED: protein trichome birefringence-like     397   2e-131   Nelumbo nucifera [Indian lotus]
ref|XP_008443032.1|  PREDICTED: protein trichome birefringence          397   4e-131   Cucumis melo [Oriental melon]
ref|XP_006399144.1|  hypothetical protein EUTSA_v10012993mg             397   4e-131   Eutrema salsugineum [saltwater cress]
ref|XP_010452610.1|  PREDICTED: protein trichome birefringence          397   5e-131   Camelina sativa [gold-of-pleasure]
emb|CDX81015.1|  BnaC03g02690D                                          393   6e-131   
emb|CDY05000.1|  BnaAnng01820D                                          392   1e-130   
emb|CDX98947.1|  BnaC09g48880D                                          394   1e-130   
gb|KFK25082.1|  hypothetical protein AALP_AA8G063700                    394   1e-130   Arabis alpina [alpine rockcress]
ref|XP_007029023.1|  Emb:CAB82953.1, putative                           396   1e-130   
ref|XP_009130955.1|  PREDICTED: protein trichome birefringence-like     395   1e-130   Brassica rapa
ref|XP_002280022.1|  PREDICTED: protein trichome birefringence          396   2e-130   Vitis vinifera
ref|XP_009122281.1|  PREDICTED: protein trichome birefringence          396   2e-130   Brassica rapa
emb|CDX70077.1|  BnaA10g24260D                                          394   2e-130   
ref|XP_010111373.1|  hypothetical protein L484_028030                   394   5e-130   Morus notabilis
ref|XP_009125778.1|  PREDICTED: protein trichome birefringence-like     390   7e-130   Brassica rapa
ref|XP_004161492.1|  PREDICTED: uncharacterized protein LOC101228487    392   4e-129   
ref|XP_004136561.1|  PREDICTED: uncharacterized protein LOC101220024    392   4e-129   Cucumis sativus [cucumbers]
ref|XP_008789200.1|  PREDICTED: protein trichome birefringence          393   4e-129   Phoenix dactylifera
gb|KJB16333.1|  hypothetical protein B456_002G223800                    391   6e-129   Gossypium raimondii
ref|XP_007204224.1|  hypothetical protein PRUPE_ppa002919mg             391   7e-129   Prunus persica
ref|XP_003625280.1|  hypothetical protein MTR_7g093450                  390   9e-129   Medicago truncatula
gb|KJB76673.1|  hypothetical protein B456_012G100000                    392   1e-128   Gossypium raimondii
ref|XP_008240911.1|  PREDICTED: protein trichome birefringence          390   1e-128   Prunus mume [ume]
ref|XP_010058223.1|  PREDICTED: protein trichome birefringence          389   7e-128   Eucalyptus grandis [rose gum]
ref|XP_004493599.1|  PREDICTED: uncharacterized protein LOC101511851    388   7e-128   Cicer arietinum [garbanzo]
ref|XP_002323329.2|  hypothetical protein POPTR_0016s05930g             387   1e-127   
ref|XP_011005287.1|  PREDICTED: protein trichome birefringence-like     387   3e-127   Populus euphratica
ref|XP_010917266.1|  PREDICTED: protein trichome birefringence          388   4e-127   Elaeis guineensis
gb|ABK28553.1|  unknown                                                 384   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187813.1|  protein TRICHOME BIREFRINGENCE-LIKE 1                 384   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039468.1|  PREDICTED: protein trichome birefringence-like     385   1e-126   Populus euphratica
ref|XP_002882764.1|  predicted protein                                  383   1e-126   Arabidopsis lyrata subsp. lyrata
ref|XP_009391441.1|  PREDICTED: protein trichome birefringence-like     388   1e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003535115.1|  PREDICTED: protein YLS7-like                       384   1e-126   Glycine max [soybeans]
ref|XP_002308359.2|  hypothetical protein POPTR_0006s20840g             384   2e-126   
emb|CDY72094.1|  BnaCnng75930D                                          382   2e-126   Brassica napus [oilseed rape]
ref|XP_010486896.1|  PREDICTED: protein trichome birefringence-li...    381   6e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010498482.1|  PREDICTED: protein trichome birefringence-li...    380   1e-125   Camelina sativa [gold-of-pleasure]
emb|CDY08459.1|  BnaA05g26950D                                          381   1e-125   Brassica napus [oilseed rape]
ref|XP_006575204.1|  PREDICTED: protein YLS7-like                       382   1e-125   Glycine max [soybeans]
ref|XP_006407376.1|  hypothetical protein EUTSA_v10020451mg             380   2e-125   Eutrema salsugineum [saltwater cress]
ref|XP_009146650.1|  PREDICTED: protein trichome birefringence-li...    379   3e-125   Brassica rapa
ref|XP_006299462.1|  hypothetical protein CARUB_v10015627mg             379   3e-125   Capsella rubella
ref|NP_001057100.1|  Os06g0207500                                       384   6e-125   
ref|XP_006656749.1|  PREDICTED: mucin-19-like                           386   8e-125   
ref|XP_010464957.1|  PREDICTED: protein trichome birefringence-li...    378   1e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010932482.1|  PREDICTED: protein trichome birefringence-li...    382   1e-124   Elaeis guineensis
gb|KFK38572.1|  hypothetical protein AALP_AA3G130900                    376   3e-124   Arabis alpina [alpine rockcress]
ref|XP_003553434.1|  PREDICTED: protein YLS7-like                       379   4e-124   Glycine max [soybeans]
ref|XP_009369426.1|  PREDICTED: protein trichome birefringence          379   6e-124   Pyrus x bretschneideri [bai li]
ref|XP_007145701.1|  hypothetical protein PHAVU_007G261000g             380   6e-124   Phaseolus vulgaris [French bean]
ref|XP_003560946.2|  PREDICTED: protein trichome birefringence-li...    384   7e-124   Brachypodium distachyon [annual false brome]
ref|XP_003520540.1|  PREDICTED: protein YLS7-like                       377   1e-123   Glycine max [soybeans]
dbj|BAD35858.1|  lustrin A-like                                         384   1e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ36212.1|  hypothetical protein OsJ_20530                          383   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007162340.1|  hypothetical protein PHAVU_001G143600g             377   3e-123   Phaseolus vulgaris [French bean]
ref|XP_004497886.1|  PREDICTED: uncharacterized protein LOC101512080    373   5e-123   Cicer arietinum [garbanzo]
gb|KEH16599.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    373   5e-123   Medicago truncatula
gb|EMT28814.1|  hypothetical protein F775_14799                         378   6e-123   
ref|XP_008387218.1|  PREDICTED: protein trichome birefringence-like     375   1e-122   
gb|EYU39954.1|  hypothetical protein MIMGU_mgv1a008556mg                364   9e-122   Erythranthe guttata [common monkey flower]
ref|XP_002436669.1|  hypothetical protein SORBIDRAFT_10g006800          380   1e-121   Sorghum bicolor [broomcorn]
ref|XP_008791924.1|  PREDICTED: protein trichome birefringence-li...    377   2e-121   
ref|XP_004303340.1|  PREDICTED: protein trichome birefringence-like     372   2e-121   Fragaria vesca subsp. vesca
ref|XP_009146094.1|  PREDICTED: protein trichome birefringence-li...    359   2e-121   
ref|XP_010672635.1|  PREDICTED: protein trichome birefringence-li...    370   3e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004964924.1|  PREDICTED: fibroin heavy chain-like                379   3e-121   Setaria italica
ref|NP_001141610.1|  uncharacterized protein LOC100273728               361   9e-121   
gb|EPS65088.1|  hypothetical protein M569_09686                         367   1e-120   Genlisea aurea
gb|AFW85381.1|  putative DUF231 domain containing family protein        376   3e-120   
ref|XP_009120981.1|  PREDICTED: protein trichome birefringence-li...    363   2e-119   Brassica rapa
gb|KJB15004.1|  hypothetical protein B456_002G154200                    363   5e-119   Gossypium raimondii
gb|EAY87710.1|  hypothetical protein OsI_09124                          367   7e-119   Oryza sativa Indica Group [Indian rice]
ref|XP_004954083.1|  PREDICTED: cell wall protein AWA1-like             368   2e-118   Setaria italica
ref|XP_009417662.1|  PREDICTED: protein trichome birefringence-like     367   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573026.1|  PREDICTED: protein trichome birefringence          368   2e-118   Brachypodium distachyon [annual false brome]
ref|XP_006649087.1|  PREDICTED: protein YLS7-like                       366   3e-118   Oryza brachyantha
gb|KHG20627.1|  CAS1 domain-containing 1                                361   4e-118   Gossypium arboreum [tree cotton]
dbj|BAD16880.1|  hypothetical protein                                   365   4e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009414351.1|  PREDICTED: protein trichome birefringence-li...    362   3e-117   
ref|XP_002454638.1|  hypothetical protein SORBIDRAFT_04g034670          363   5e-117   Sorghum bicolor [broomcorn]
dbj|BAK01401.1|  predicted protein                                      364   6e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008679266.1|  PREDICTED: protein trichome birefringence-li...    362   3e-116   Zea mays [maize]
ref|XP_006849537.1|  hypothetical protein AMTR_s00024p00162030          357   2e-114   
gb|EPS66265.1|  hypothetical protein M569_08511                         343   7e-114   Genlisea aurea
gb|EMS48369.1|  hypothetical protein TRIUR3_11824                       345   2e-113   Triticum urartu
ref|XP_008646340.1|  PREDICTED: protein trichome birefringence          354   2e-113   
gb|AFW73695.1|  putative DUF231 domain containing family protein        353   2e-113   
ref|XP_008352647.1|  PREDICTED: protein trichome birefringence-li...    342   2e-113   
ref|XP_009375160.1|  PREDICTED: protein trichome birefringence-like     342   4e-112   
ref|XP_009587467.1|  PREDICTED: protein trichome birefringence-like     342   1e-110   Nicotiana tomentosiformis
ref|XP_007011182.1|  Uncharacterized protein isoform 1                  343   2e-110   
ref|XP_008363351.1|  PREDICTED: protein trichome birefringence-li...    341   3e-110   
ref|XP_010044971.1|  PREDICTED: protein trichome birefringence-li...    336   7e-109   Eucalyptus grandis [rose gum]
ref|XP_008352661.1|  PREDICTED: protein trichome birefringence-li...    338   8e-109   
ref|XP_004228795.2|  PREDICTED: protein trichome birefringence-like     331   9e-109   
gb|KJB73054.1|  hypothetical protein B456_011G212300                    333   4e-107   Gossypium raimondii
ref|XP_006357865.1|  PREDICTED: uncharacterized protein LOC102596807    335   2e-106   Solanum tuberosum [potatoes]
ref|XP_007204980.1|  hypothetical protein PRUPE_ppa003027mg             332   4e-106   Prunus persica
gb|EMS61403.1|  hypothetical protein TRIUR3_19587                       334   1e-105   Triticum urartu
ref|XP_002534436.1|  conserved hypothetical protein                     328   3e-105   Ricinus communis
gb|KHG04354.1|  CAS1 domain-containing 1                                328   5e-105   Gossypium arboreum [tree cotton]
ref|XP_009783417.1|  PREDICTED: protein trichome birefringence-li...    328   6e-105   Nicotiana sylvestris
ref|XP_008360191.1|  PREDICTED: protein trichome birefringence-li...    327   9e-105   
ref|XP_004497358.1|  PREDICTED: uncharacterized protein LOC101512304    325   1e-104   Cicer arietinum [garbanzo]
ref|XP_009376704.1|  PREDICTED: protein trichome birefringence-li...    328   3e-104   Pyrus x bretschneideri [bai li]
ref|XP_009364158.1|  PREDICTED: protein trichome birefringence-li...    327   8e-104   Pyrus x bretschneideri [bai li]
ref|XP_010673529.1|  PREDICTED: protein trichome birefringence-like     318   9e-104   
ref|XP_008361466.1|  PREDICTED: protein trichome birefringence-li...    326   1e-103   
ref|XP_011037956.1|  PREDICTED: protein trichome birefringence-like     324   1e-103   Populus euphratica
ref|XP_008363352.1|  PREDICTED: protein trichome birefringence-li...    317   1e-103   
gb|AES97753.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    322   2e-103   Medicago truncatula
ref|XP_008229144.1|  PREDICTED: protein trichome birefringence-li...    325   4e-103   
ref|XP_007207689.1|  hypothetical protein PRUPE_ppa023743mg             322   6e-103   
ref|XP_006841061.1|  hypothetical protein AMTR_s00085p00172090          319   2e-102   Amborella trichopoda
ref|XP_004296154.1|  PREDICTED: protein trichome birefringence-li...    317   2e-101   Fragaria vesca subsp. vesca
gb|KDP44302.1|  hypothetical protein JCGZ_19169                         313   3e-101   Jatropha curcas
ref|XP_002297655.2|  hypothetical protein POPTR_0001s04810g             316   1e-100   
ref|XP_006854129.1|  hypothetical protein AMTR_s00048p00162020          315   2e-100   
gb|KFK38571.1|  hypothetical protein AALP_AA3G130800                    317   7e-99    Arabis alpina [alpine rockcress]
ref|XP_010268038.1|  PREDICTED: protein trichome birefringence-li...    309   9e-99    Nelumbo nucifera [Indian lotus]
gb|EMT28517.1|  hypothetical protein F775_15700                         306   3e-98    
ref|XP_003592794.1|  hypothetical protein MTR_1g116130                  310   5e-98    
ref|XP_004143065.1|  PREDICTED: uncharacterized protein LOC101210768    309   6e-98    Cucumis sativus [cucumbers]
gb|KHN27090.1|  hypothetical protein glysoja_032858                     300   8e-98    Glycine soja [wild soybean]
ref|XP_008444354.1|  PREDICTED: protein trichome birefringence-li...    308   1e-97    Cucumis melo [Oriental melon]
ref|XP_008389689.1|  PREDICTED: protein trichome birefringence-li...    306   3e-96    Malus domestica [apple tree]
ref|XP_007044711.1|  Uncharacterized protein TCM_010432                 307   3e-96    
ref|XP_003555633.2|  PREDICTED: protein YLS7-like                       304   4e-96    Glycine max [soybeans]
ref|XP_004298485.1|  PREDICTED: protein trichome birefringence-li...    305   9e-96    Fragaria vesca subsp. vesca
gb|EYU44005.1|  hypothetical protein MIMGU_mgv1a026273mg                300   2e-95    Erythranthe guttata [common monkey flower]
ref|XP_004229072.1|  PREDICTED: protein trichome birefringence-li...    298   1e-94    Solanum lycopersicum
gb|KHN37297.1|  hypothetical protein glysoja_013512                     300   1e-94    Glycine soja [wild soybean]
ref|XP_011461651.1|  PREDICTED: protein trichome birefringence-li...    306   1e-94    Fragaria vesca subsp. vesca
ref|XP_006590231.1|  PREDICTED: protein YLS7-like                       300   1e-94    
ref|XP_010920201.1|  PREDICTED: protein trichome birefringence-li...    298   1e-94    Elaeis guineensis
ref|XP_004296155.1|  PREDICTED: protein trichome birefringence-li...    306   2e-94    Fragaria vesca subsp. vesca
ref|XP_007142667.1|  hypothetical protein PHAVU_007G006500g             299   2e-94    Phaseolus vulgaris [French bean]
ref|XP_006355406.1|  PREDICTED: uncharacterized protein LOC102580314    296   4e-94    Solanum tuberosum [potatoes]
ref|XP_007221982.1|  hypothetical protein PRUPE_ppa002834mg             301   5e-94    Prunus persica
gb|KEH20203.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    298   7e-94    Medicago truncatula
ref|XP_010682517.1|  PREDICTED: protein trichome birefringence-li...    297   1e-93    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB31199.1|  hypothetical protein B456_005G180600                    298   1e-93    Gossypium raimondii
ref|XP_002525401.1|  conserved hypothetical protein                     299   1e-93    Ricinus communis
ref|XP_008221854.1|  PREDICTED: protein trichome birefringence-li...    300   1e-93    Prunus mume [ume]
ref|XP_010251171.1|  PREDICTED: protein trichome birefringence-li...    299   2e-93    Nelumbo nucifera [Indian lotus]
ref|XP_008340353.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    295   2e-93    Malus domestica [apple tree]
gb|KJB31198.1|  hypothetical protein B456_005G180600                    298   3e-93    Gossypium raimondii
ref|XP_010100425.1|  hypothetical protein L484_027736                   295   4e-93    
ref|XP_010940155.1|  PREDICTED: protein trichome birefringence-li...    299   4e-93    Elaeis guineensis
ref|XP_004509571.1|  PREDICTED: uncharacterized protein LOC101508086    298   4e-93    Cicer arietinum [garbanzo]
gb|KDO82333.1|  hypothetical protein CISIN_1g007771mg                   297   6e-93    Citrus sinensis [apfelsine]
ref|XP_006438320.1|  hypothetical protein CICLE_v10031033mg             297   7e-93    Citrus clementina [clementine]
ref|XP_006483906.1|  PREDICTED: protein YLS7-like                       297   8e-93    Citrus sinensis [apfelsine]
ref|XP_009393972.1|  PREDICTED: protein trichome birefringence-li...    294   9e-93    
gb|KCW59798.1|  hypothetical protein EUGRSUZ_H02546                     286   9e-93    Eucalyptus grandis [rose gum]
ref|XP_011045285.1|  PREDICTED: protein trichome birefringence-li...    296   1e-92    Populus euphratica
ref|XP_008791066.1|  PREDICTED: protein trichome birefringence-li...    293   1e-92    Phoenix dactylifera
ref|XP_004489803.1|  PREDICTED: uncharacterized protein LOC101513224    295   1e-92    Cicer arietinum [garbanzo]
ref|XP_008229347.1|  PREDICTED: protein trichome birefringence-like     301   2e-92    
emb|CDO98793.1|  unnamed protein product                                291   3e-92    Coffea canephora [robusta coffee]
gb|KDP26622.1|  hypothetical protein JCGZ_17780                         295   4e-92    Jatropha curcas
ref|XP_008812175.1|  PREDICTED: protein trichome birefringence-li...    296   5e-92    Phoenix dactylifera
ref|XP_009392183.1|  PREDICTED: protein trichome birefringence-li...    298   7e-92    Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI28569.3|  unnamed protein product                                287   9e-92    Vitis vinifera
ref|XP_007035738.1|  Trichome birefringence-like 4                      290   1e-91    Theobroma cacao [chocolate]
ref|XP_011100832.1|  PREDICTED: protein trichome birefringence-li...    290   2e-91    Sesamum indicum [beniseed]
ref|XP_006378226.1|  hypothetical protein POPTR_0010s05310g             291   3e-91    
emb|CDP13190.1|  unnamed protein product                                294   3e-91    Coffea canephora [robusta coffee]
gb|KJB72754.1|  hypothetical protein B456_011G194800                    289   3e-91    Gossypium raimondii
ref|XP_007153754.1|  hypothetical protein PHAVU_003G062400g             291   4e-91    Phaseolus vulgaris [French bean]
ref|XP_006419433.1|  hypothetical protein CICLE_v10006676mg             288   4e-91    
ref|XP_003613189.1|  hypothetical protein MTR_5g033800                  288   1e-90    Medicago truncatula
ref|XP_006585942.1|  PREDICTED: protein YLS7-like                       290   1e-90    Glycine max [soybeans]
ref|XP_009591829.1|  PREDICTED: protein trichome birefringence-li...    292   2e-90    Nicotiana tomentosiformis
ref|XP_002265658.2|  PREDICTED: protein trichome birefringence-li...    291   3e-90    Vitis vinifera
ref|XP_010227191.1|  PREDICTED: protein trichome birefringence-li...    294   4e-90    Brachypodium distachyon [annual false brome]
gb|KHG00171.1|  U3 small nucleolar RNA-associated 6                     277   4e-90    Gossypium arboreum [tree cotton]
ref|XP_009795954.1|  PREDICTED: protein trichome birefringence-li...    291   4e-90    Nicotiana sylvestris
gb|KDO71838.1|  hypothetical protein CISIN_1g045325mg                   285   4e-90    Citrus sinensis [apfelsine]
ref|XP_006602386.1|  PREDICTED: protein YLS7-like                       288   4e-90    Glycine max [soybeans]
ref|XP_010553609.1|  PREDICTED: protein trichome birefringence-li...    289   5e-90    Tarenaya hassleriana [spider flower]
ref|XP_006356414.1|  PREDICTED: uncharacterized protein LOC102583109    289   6e-90    Solanum tuberosum [potatoes]
ref|XP_006488998.1|  PREDICTED: protein YLS7-like                       285   7e-90    Citrus sinensis [apfelsine]
ref|XP_010026659.1|  PREDICTED: protein trichome birefringence-li...    287   9e-90    
emb|CCI55362.1|  PH01B035L11.7                                          291   2e-89    Phyllostachys edulis [kikko-chiku]
ref|XP_004502134.1|  PREDICTED: uncharacterized protein LOC101510392    284   3e-89    Cicer arietinum [garbanzo]
ref|XP_003517720.1|  PREDICTED: protein YLS7-like                       286   4e-89    Glycine max [soybeans]
gb|EYU28435.1|  hypothetical protein MIMGU_mgv1a003426mg                287   5e-89    Erythranthe guttata [common monkey flower]
ref|XP_004238644.1|  PREDICTED: protein trichome birefringence-li...    286   7e-89    
ref|XP_010473258.1|  PREDICTED: protein trichome birefringence-li...    285   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_007157368.1|  hypothetical protein PHAVU_002G064300g             284   1e-88    Phaseolus vulgaris [French bean]
ref|XP_002886589.1|  hypothetical protein ARALYDRAFT_475253             284   2e-88    
ref|XP_002448144.1|  hypothetical protein SORBIDRAFT_06g022030          289   2e-88    Sorghum bicolor [broomcorn]
ref|XP_006302106.1|  hypothetical protein CARUB_v10020097mg             284   4e-88    Capsella rubella
ref|XP_008663376.1|  PREDICTED: protein trichome birefringence-li...    288   4e-88    
ref|XP_010418022.1|  PREDICTED: protein trichome birefringence-li...    283   5e-88    Camelina sativa [gold-of-pleasure]
ref|XP_003519825.1|  PREDICTED: protein YLS7-like                       283   6e-88    Glycine max [soybeans]
ref|XP_002271893.1|  PREDICTED: protein trichome birefringence-li...    280   8e-88    Vitis vinifera
gb|AES91931.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    280   9e-88    Medicago truncatula
ref|XP_011086599.1|  PREDICTED: protein trichome birefringence-li...    284   1e-87    Sesamum indicum [beniseed]
ref|XP_002519189.1|  conserved hypothetical protein                     280   1e-87    Ricinus communis
ref|NP_176278.2|  uncharacterized protein                               282   1e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KHN00372.1|  hypothetical protein glysoja_000040                     281   1e-87    Glycine soja [wild soybean]
ref|XP_010510908.1|  PREDICTED: protein trichome birefringence-li...    282   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010671195.1|  PREDICTED: protein trichome birefringence-li...    280   2e-87    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY40499.1|  BnaC09g14570D                                          280   3e-87    Brassica napus [oilseed rape]
ref|XP_006392115.1|  hypothetical protein EUTSA_v10023395mg             281   3e-87    Eutrema salsugineum [saltwater cress]
emb|CDY69617.1|  BnaA09g53160D                                          281   4e-87    Brassica napus [oilseed rape]
ref|XP_009113182.1|  PREDICTED: protein trichome birefringence-li...    281   4e-87    Brassica rapa
gb|KFK40758.1|  hypothetical protein AALP_AA2G037100                    278   4e-86    Arabis alpina [alpine rockcress]
ref|NP_001053267.1|  Os04g0508000                                       282   7e-86    
emb|CAH67561.1|  OSIGBa0101P20.4                                        282   9e-86    Oryza sativa [red rice]
gb|EYU17992.1|  hypothetical protein MIMGU_mgv1a025478mg                275   1e-85    Erythranthe guttata [common monkey flower]
ref|XP_006282292.1|  hypothetical protein CARUB_v10028578mg             274   3e-85    Capsella rubella
gb|EYU44003.1|  hypothetical protein MIMGU_mgv1a017776mg                265   4e-85    Erythranthe guttata [common monkey flower]
ref|XP_010471907.1|  PREDICTED: protein trichome birefringence-li...    269   4e-85    
emb|CDY33914.1|  BnaA02g30730D                                          273   5e-85    Brassica napus [oilseed rape]
ref|XP_009129778.1|  PREDICTED: protein trichome birefringence-li...    273   6e-85    Brassica rapa
gb|KHN14559.1|  hypothetical protein glysoja_027168                     274   9e-85    Glycine soja [wild soybean]
ref|NP_199745.1|  protein TRICHOME BIREFRINGENCE-LIKE                   272   1e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDY00034.1|  BnaC09g02670D                                          271   2e-84    
emb|CBW30214.1|  Conserved hypothetical protein                         272   2e-84    Musa balbisiana [starchy banana]
ref|XP_010442398.1|  PREDICTED: protein trichome birefringence-li...    271   5e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010482212.1|  PREDICTED: protein trichome birefringence-li...    270   9e-84    Camelina sativa [gold-of-pleasure]
emb|CDY05635.1|  BnaC02g39020D                                          270   9e-84    
ref|XP_011083135.1|  PREDICTED: protein trichome birefringence-li...    273   1e-83    Sesamum indicum [beniseed]
ref|XP_009394684.1|  PREDICTED: protein trichome birefringence-li...    270   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY49608.1|  BnaA09g03300D                                          269   2e-83    Brassica napus [oilseed rape]
emb|CBW30176.1|  Conserved hypothetical protein                         270   2e-83    Musa balbisiana [starchy banana]
ref|XP_009111874.1|  PREDICTED: protein trichome birefringence-li...    268   3e-83    Brassica rapa
ref|XP_010558437.1|  PREDICTED: protein trichome birefringence-li...    268   5e-83    Tarenaya hassleriana [spider flower]
ref|XP_006395071.1|  hypothetical protein EUTSA_v10005359mg             267   1e-82    Eutrema salsugineum [saltwater cress]
ref|XP_002865730.1|  hypothetical protein ARALYDRAFT_331346             267   1e-82    Arabidopsis lyrata subsp. lyrata
ref|XP_003609734.1|  hypothetical protein MTR_4g121560                  266   2e-82    
gb|KFK26585.1|  hypothetical protein AALP_AA8G267500                    266   3e-82    Arabis alpina [alpine rockcress]
ref|XP_010670899.1|  PREDICTED: protein trichome birefringence-li...    264   4e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010671194.1|  PREDICTED: protein trichome birefringence-li...    264   2e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO61978.1|  hypothetical protein CISIN_1g023751mg                   257   6e-81    Citrus sinensis [apfelsine]
ref|XP_011020489.1|  PREDICTED: protein trichome birefringence-li...    263   7e-81    Populus euphratica
ref|XP_002311402.2|  hypothetical protein POPTR_0008s10790g             259   1e-80    
ref|XP_010046898.1|  PREDICTED: protein trichome birefringence-li...    262   1e-80    Eucalyptus grandis [rose gum]
gb|KDP35862.1|  hypothetical protein JCGZ_10642                         263   2e-80    Jatropha curcas
ref|XP_003610012.1|  hypothetical protein MTR_4g126950                  261   2e-80    
dbj|BAE98654.1|  hypothetical protein                                   256   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507926.1|  PREDICTED: uncharacterized protein LOC101489...    256   5e-80    
ref|XP_002268396.1|  PREDICTED: protein trichome birefringence-li...    263   7e-80    Vitis vinifera
ref|XP_010265394.1|  PREDICTED: protein trichome birefringence-li...    259   2e-79    Nelumbo nucifera [Indian lotus]
ref|XP_002527690.1|  conserved hypothetical protein                     260   3e-79    
ref|XP_008223825.1|  PREDICTED: protein trichome birefringence-li...    259   3e-79    Prunus mume [ume]
ref|XP_003541536.1|  PREDICTED: protein YLS7-like                       258   3e-79    Glycine max [soybeans]
ref|XP_008450807.1|  PREDICTED: protein trichome birefringence-li...    258   4e-79    
ref|XP_004150389.1|  PREDICTED: uncharacterized protein LOC101212427    258   5e-79    
emb|CDY14070.1|  BnaC02g01870D                                          258   5e-79    
ref|XP_010687461.1|  PREDICTED: protein trichome birefringence-li...    257   8e-79    
ref|XP_008781812.1|  PREDICTED: protein trichome birefringence-li...    258   8e-79    
ref|XP_007222250.1|  hypothetical protein PRUPE_ppa004735mg             258   1e-78    
ref|XP_006453211.1|  hypothetical protein CICLE_v10008256mg             256   1e-78    
gb|KHN22642.1|  hypothetical protein glysoja_027530                     256   2e-78    
ref|XP_006474304.1|  PREDICTED: protein YLS7-like                       257   2e-78    
ref|XP_003550638.1|  PREDICTED: protein YLS7-like                       256   3e-78    
gb|AAM64322.1|  unknown                                                 255   8e-78    
ref|XP_010913702.1|  PREDICTED: protein trichome birefringence-li...    255   8e-78    
ref|XP_010693998.1|  PREDICTED: protein trichome birefringence-li...    253   9e-78    
gb|KFK26286.1|  hypothetical protein AALP_AA8G228100                    255   1e-77    
ref|NP_197559.1|  protein trichome birefringence-like 5                 255   1e-77    
ref|XP_002871948.1|  hypothetical protein ARALYDRAFT_488963             254   1e-77    
gb|KJB22003.1|  hypothetical protein B456_004G024900                    255   1e-77    
gb|KHG14015.1|  CAS1 domain-containing 1                                255   1e-77    
gb|KHN17657.1|  hypothetical protein glysoja_005854                     254   1e-77    
gb|KJB22001.1|  hypothetical protein B456_004G024900                    254   2e-77    
gb|KJB22002.1|  hypothetical protein B456_004G024900                    254   2e-77    
ref|XP_004507925.1|  PREDICTED: uncharacterized protein LOC101489...    254   2e-77    
ref|XP_007014486.1|  Trichome birefringence-like 5 isoform 1            253   2e-77    
ref|XP_010493164.1|  PREDICTED: protein trichome birefringence-li...    254   3e-77    
ref|XP_010420901.1|  PREDICTED: protein trichome birefringence-li...    254   4e-77    
ref|XP_002324663.2|  hypothetical protein POPTR_0018s13290g             254   4e-77    
ref|XP_002308095.2|  hypothetical protein POPTR_0006s07090g             254   4e-77    
ref|XP_009342821.1|  PREDICTED: protein trichome birefringence-li...    253   7e-77    
ref|XP_006657213.1|  PREDICTED: protein YLS7-like                       249   8e-77    
emb|CAN83582.1|  hypothetical protein VITISV_001564                     263   1e-76    
ref|XP_006287593.1|  hypothetical protein CARUB_v10000803mg             253   1e-76    
ref|XP_006400622.1|  hypothetical protein EUTSA_v10013361mg             252   1e-76    
ref|XP_011020096.1|  PREDICTED: protein trichome birefringence-li...    252   1e-76    
ref|XP_007154672.1|  hypothetical protein PHAVU_003G138100g             250   2e-76    
emb|CDX92451.1|  BnaA10g14900D                                          251   2e-76    
ref|XP_009120795.1|  PREDICTED: protein trichome birefringence-li...    251   3e-76    
gb|KJB82732.1|  hypothetical protein B456_013G211200                    249   3e-76    
ref|XP_010454365.1|  PREDICTED: protein trichome birefringence-li...    251   5e-76    
gb|KHG05807.1|  Pyridoxal-phosphate-dependent serine hydroxymethy...    248   7e-76    
ref|XP_011017737.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    251   1e-75    
emb|CDY16546.1|  BnaC09g37270D                                          250   1e-75    
ref|XP_004299786.1|  PREDICTED: protein trichome birefringence-li...    249   3e-75    
ref|XP_010535816.1|  PREDICTED: protein trichome birefringence-li...    248   1e-74    
gb|EMS57111.1|  hypothetical protein TRIUR3_15228                       240   1e-74    
emb|CDP03007.1|  unnamed protein product                                249   2e-74    
gb|AFW58807.1|  putative DUF231 domain containing family protein        252   2e-74    
ref|XP_009418554.1|  PREDICTED: protein trichome birefringence-li...    246   2e-74    
gb|EAZ01954.1|  hypothetical protein OsI_23985                          246   3e-74    
ref|XP_003560398.1|  PREDICTED: protein trichome birefringence-li...    245   3e-74    
ref|XP_009763711.1|  PREDICTED: protein trichome birefringence-li...    246   8e-74    
ref|XP_009610815.1|  PREDICTED: protein trichome birefringence-li...    245   1e-73    
ref|XP_004978124.1|  PREDICTED: uncharacterized protein LOC101771038    250   2e-73    
ref|NP_001058264.1|  Os06g0659400                                       243   3e-73    
ref|XP_002515280.1|  conserved hypothetical protein                     245   5e-73    
ref|XP_009604954.1|  PREDICTED: protein trichome birefringence-li...    244   6e-73    
ref|XP_007051109.1|  Trichome birefringence-like 6                      243   2e-72    
ref|XP_011079550.1|  PREDICTED: protein trichome birefringence-li...    242   6e-72    
ref|XP_008649021.1|  PREDICTED: protein trichome birefringence-li...    240   8e-72    
ref|XP_007201163.1|  hypothetical protein PRUPE_ppa004056mg             241   9e-72    
ref|XP_009783488.1|  PREDICTED: protein trichome birefringence-li...    241   9e-72    
ref|XP_010652247.1|  PREDICTED: protein trichome birefringence-li...    240   1e-71    
ref|XP_006349183.1|  PREDICTED: uncharacterized protein LOC102598625    240   2e-71    
ref|XP_002301513.2|  hypothetical protein POPTR_0002s19680g             239   2e-71    
gb|AFK44929.1|  unknown                                                 239   2e-71    
ref|XP_010259297.1|  PREDICTED: protein trichome birefringence-li...    239   2e-71    
ref|XP_004229386.1|  PREDICTED: protein trichome birefringence-li...    240   3e-71    
gb|KDP28262.1|  hypothetical protein JCGZ_14033                         240   3e-71    
gb|KJB49816.1|  hypothetical protein B456_008G139200                    233   3e-71    
ref|XP_002437399.1|  hypothetical protein SORBIDRAFT_10g026240          238   4e-71    
ref|XP_009384432.1|  PREDICTED: protein trichome birefringence-li...    239   6e-71    
ref|XP_010267992.1|  PREDICTED: protein trichome birefringence-li...    237   8e-71    
ref|XP_004164982.1|  PREDICTED: uncharacterized LOC101220002            234   9e-71    
ref|XP_007163180.1|  hypothetical protein PHAVU_001G213200g             238   9e-71    
ref|XP_004301795.1|  PREDICTED: protein trichome birefringence-li...    238   9e-71    
ref|XP_006366199.1|  PREDICTED: uncharacterized protein LOC102583...    237   1e-70    
ref|XP_003625972.1|  hypothetical protein MTR_7g109550                  236   1e-70    
ref|XP_009384431.1|  PREDICTED: protein trichome birefringence-li...    238   2e-70    
ref|XP_006366198.1|  PREDICTED: uncharacterized protein LOC102583...    237   2e-70    
ref|XP_004984615.1|  PREDICTED: uncharacterized protein LOC101785375    240   2e-70    
ref|XP_006840447.1|  hypothetical protein AMTR_s00045p00169080          234   3e-70    
ref|XP_008660213.1|  PREDICTED: protein trichome birefringence-li...    240   3e-70    
gb|EYU46810.1|  hypothetical protein MIMGU_mgv1a005200mg                236   4e-70    
ref|XP_008454494.1|  PREDICTED: protein trichome birefringence-li...    236   4e-70    
gb|KJB49815.1|  hypothetical protein B456_008G139200                    231   5e-70    
ref|XP_011069938.1|  PREDICTED: protein trichome birefringence-li...    237   6e-70    
ref|XP_011042254.1|  PREDICTED: protein trichome birefringence-li...    236   6e-70    
ref|XP_010413281.1|  PREDICTED: protein trichome birefringence-li...    235   6e-70    
ref|XP_009378730.1|  PREDICTED: protein trichome birefringence-li...    236   8e-70    
ref|XP_004152223.1|  PREDICTED: uncharacterized protein LOC101220002    236   8e-70    
ref|XP_003553667.1|  PREDICTED: protein YLS7-like                       234   9e-70    
ref|XP_010512629.1|  PREDICTED: protein trichome birefringence-li...    234   1e-69    
gb|KHN19212.1|  hypothetical protein glysoja_041564                     231   1e-69    
ref|XP_006444502.1|  hypothetical protein CICLE_v100200871mg            231   1e-69    
ref|XP_010468959.1|  PREDICTED: protein trichome birefringence-li...    234   1e-69    
ref|XP_004243016.1|  PREDICTED: protein trichome birefringence-li...    235   1e-69    
ref|XP_002862720.1|  hypothetical protein ARALYDRAFT_497319             233   2e-69    
gb|EYU37306.1|  hypothetical protein MIMGU_mgv1a022803mg                234   2e-69    
ref|XP_002878459.1|  hypothetical protein ARALYDRAFT_486743             233   2e-69    
ref|XP_006402380.1|  hypothetical protein EUTSA_v10005925mg             233   3e-69    
ref|XP_006649967.1|  PREDICTED: uncharacterized protein LOC102700223    236   3e-69    
ref|XP_010921490.1|  PREDICTED: protein trichome birefringence-li...    235   3e-69    
ref|XP_006492340.1|  PREDICTED: protein YLS7-like                       234   3e-69    
ref|XP_006290990.1|  hypothetical protein CARUB_v10017104mg             233   4e-69    
gb|KJB49817.1|  hypothetical protein B456_008G139200                    233   6e-69    
gb|EPS60512.1|  hypothetical protein M569_14291                         233   7e-69    
ref|XP_003520751.1|  PREDICTED: protein YLS7-like                       233   7e-69    
emb|CBI17853.3|  unnamed protein product                                228   8e-69    
ref|XP_004494426.1|  PREDICTED: uncharacterized protein LOC101501...    231   1e-68    
ref|NP_191798.1|  protein trichome birefringence-like 6                 231   1e-68    
ref|XP_009116908.1|  PREDICTED: protein trichome birefringence-li...    230   3e-68    
emb|CDY11418.1|  BnaA09g39840D                                          230   3e-68    
ref|XP_008781112.1|  PREDICTED: protein trichome birefringence-li...    232   4e-68    
ref|XP_010038289.1|  PREDICTED: protein trichome birefringence-li...    231   5e-68    
ref|XP_010679388.1|  PREDICTED: protein trichome birefringence-li...    230   2e-67    
ref|XP_010087235.1|  hypothetical protein L484_009744                   229   2e-67    
ref|XP_008345228.1|  PREDICTED: protein trichome birefringence-li...    223   3e-67    
emb|CDX76633.1|  BnaC08g32190D                                          227   3e-67    
ref|XP_003561699.1|  PREDICTED: protein trichome birefringence-li...    231   3e-67    
gb|EMT09233.1|  hypothetical protein F775_52456                         231   4e-67    
ref|NP_001049898.2|  Os03g0307700                                       231   4e-67    
ref|XP_008369046.1|  PREDICTED: protein trichome birefringence-li...    228   6e-67    
dbj|BAD95134.1|  hypothetical protein                                   227   6e-67    
ref|XP_010544965.1|  PREDICTED: protein trichome birefringence-li...    226   2e-66    
ref|XP_010107044.1|  hypothetical protein L484_003589                   226   2e-66    
gb|EPS62559.1|  hypothetical protein M569_12231                         224   4e-66    
emb|CDP17066.1|  unnamed protein product                                226   4e-66    
gb|KFK35420.1|  hypothetical protein AALP_AA5G282000                    224   4e-66    
ref|XP_009378728.1|  PREDICTED: protein trichome birefringence-li...    221   1e-65    
dbj|BAK07580.1|  predicted protein                                      227   1e-65    
ref|XP_008369108.1|  PREDICTED: protein trichome birefringence-li...    223   3e-65    
ref|XP_010523922.1|  PREDICTED: protein trichome birefringence-li...    219   9e-64    
gb|EPS68903.1|  hypothetical protein M569_05864                         214   3e-63    
gb|ABK22287.1|  unknown                                                 215   3e-63    
gb|ABK25068.1|  unknown                                                 215   3e-63    
ref|XP_004984616.1|  PREDICTED: uncharacterized protein LOC101785781    220   5e-63    
ref|XP_007200128.1|  hypothetical protein PRUPE_ppa017879mg             218   9e-62    
ref|XP_002467978.1|  hypothetical protein SORBIDRAFT_01g037460          215   4e-61    
ref|XP_006481868.1|  PREDICTED: protein YLS7-like                       204   5e-60    
ref|XP_008778408.1|  PREDICTED: protein trichome birefringence-li...    207   2e-59    
ref|XP_007214171.1|  hypothetical protein PRUPE_ppa019033mg             203   2e-58    
ref|XP_006430129.1|  hypothetical protein CICLE_v10013764mg             202   2e-58    
ref|XP_004513587.1|  PREDICTED: uncharacterized protein LOC101513882    202   3e-58    
gb|KDO63330.1|  hypothetical protein CISIN_1g043893mg                   202   3e-58    
ref|XP_004296926.1|  PREDICTED: protein trichome birefringence-li...    203   3e-58    
ref|XP_011090776.1|  PREDICTED: protein trichome birefringence-li...    202   8e-58    
gb|KJB76676.1|  hypothetical protein B456_012G100000                    204   1e-57    
gb|ABR16389.1|  unknown                                                 202   1e-57    
ref|XP_008458564.1|  PREDICTED: protein trichome birefringence-li...    202   1e-57    
gb|EMT12175.1|  hypothetical protein F775_08902                         201   2e-57    
ref|XP_004170863.1|  PREDICTED: uncharacterized LOC101220391            196   3e-57    
gb|EYU41525.1|  hypothetical protein MIMGU_mgv1a021660mg                201   4e-57    
ref|XP_006289833.1|  hypothetical protein CARUB_v10003438mg             198   4e-57    
ref|XP_008355511.1|  PREDICTED: protein trichome birefringence-li...    197   5e-57    
ref|XP_006446764.1|  hypothetical protein CICLE_v10017800mg             198   7e-57    
gb|EYU46596.1|  hypothetical protein MIMGU_mgv1a006590mg                199   7e-57    
ref|XP_011079836.1|  PREDICTED: protein trichome birefringence-li...    200   7e-57    
ref|XP_002975529.1|  hypothetical protein SELMODRAFT_52381              196   1e-56    
ref|XP_008244482.1|  PREDICTED: protein trichome birefringence-li...    198   1e-56    
ref|XP_006836087.1|  hypothetical protein AMTR_s00114p00129910          198   1e-56    
ref|NP_974739.1|  protein trichome birefringence-like 9                 196   2e-56    
ref|XP_010491163.1|  PREDICTED: protein trichome birefringence-li...    197   3e-56    
ref|XP_002981501.1|  hypothetical protein SELMODRAFT_54079              194   4e-56    
ref|XP_011024935.1|  PREDICTED: protein PMR5-like                       196   4e-56    
ref|XP_010913162.1|  PREDICTED: protein trichome birefringence-li...    199   4e-56    
ref|NP_568164.2|  protein trichome birefringence-like 9                 196   5e-56    
ref|XP_009386636.1|  PREDICTED: protein trichome birefringence-li...    197   5e-56    
ref|XP_010423377.1|  PREDICTED: protein trichome birefringence-li...    196   7e-56    
ref|XP_002973496.1|  hypothetical protein SELMODRAFT_53072              194   7e-56    
gb|KDP31784.1|  hypothetical protein JCGZ_12245                         196   8e-56    
ref|XP_011071665.1|  PREDICTED: protein trichome birefringence-li...    197   8e-56    
gb|KEH41970.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    196   8e-56    
ref|XP_008222981.1|  PREDICTED: protein trichome birefringence-li...    197   9e-56    
ref|XP_010248439.1|  PREDICTED: protein trichome birefringence-li...    196   9e-56    
ref|XP_002963582.1|  hypothetical protein SELMODRAFT_64159              194   9e-56    
ref|XP_011082551.1|  PREDICTED: protein trichome birefringence-li...    196   1e-55    
ref|XP_008355512.1|  PREDICTED: protein trichome birefringence-li...    194   1e-55    
ref|XP_009338476.1|  PREDICTED: protein trichome birefringence-li...    196   2e-55    
ref|XP_010543924.1|  PREDICTED: protein trichome birefringence-li...    195   2e-55    
ref|XP_004149267.1|  PREDICTED: uncharacterized protein LOC101220391    195   2e-55    
ref|XP_010278184.1|  PREDICTED: protein trichome birefringence-li...    195   3e-55    
ref|XP_008245906.1|  PREDICTED: protein trichome birefringence-li...    191   3e-55    
gb|EYU45620.1|  hypothetical protein MIMGU_mgv1a026217mg                194   4e-55    
ref|XP_009386635.1|  PREDICTED: protein trichome birefringence-li...    197   5e-55    
ref|XP_010452537.1|  PREDICTED: protein trichome birefringence-li...    194   6e-55    
emb|CDP03616.1|  unnamed protein product                                195   6e-55    
ref|XP_008235399.1|  PREDICTED: protein trichome birefringence-li...    191   6e-55    
ref|XP_009410411.1|  PREDICTED: protein trichome birefringence-li...    195   7e-55    
ref|XP_008351230.1|  PREDICTED: protein trichome birefringence-li...    194   7e-55    
ref|XP_006400475.1|  hypothetical protein EUTSA_v10013457mg             194   8e-55    
ref|XP_008222980.1|  PREDICTED: protein trichome birefringence-li...    194   9e-55    
ref|XP_007225765.1|  hypothetical protein PRUPE_ppa005540mg             194   1e-54    
gb|KDP40121.1|  hypothetical protein JCGZ_02119                         194   1e-54    
ref|XP_009146706.1|  PREDICTED: protein trichome birefringence-li...    193   1e-54    
ref|XP_008340925.1|  PREDICTED: protein trichome birefringence-li...    194   1e-54    
gb|ADE76095.1|  unknown                                                 194   1e-54    
ref|XP_008462600.1|  PREDICTED: protein trichome birefringence-li...    190   1e-54    
ref|XP_010099371.1|  hypothetical protein L484_004797                   193   1e-54    
ref|XP_009364196.1|  PREDICTED: protein trichome birefringence-li...    194   2e-54    
ref|XP_008390840.1|  PREDICTED: protein trichome birefringence-li...    193   2e-54    
ref|XP_009395765.1|  PREDICTED: protein trichome birefringence-li...    195   2e-54    
emb|CDY27711.1|  BnaA05g31200D                                          193   2e-54    
ref|XP_006419845.1|  hypothetical protein CICLE_v10004949mg             190   2e-54    
ref|XP_006489318.1|  PREDICTED: protein YLS7-like isoform X1            193   2e-54    
emb|CBI32367.3|  unnamed protein product                                192   2e-54    
ref|XP_007034642.1|  Trichome birefringence-like 11 isoform 1           193   2e-54    
ref|XP_004143390.1|  PREDICTED: uncharacterized protein LOC101211013    192   3e-54    
ref|XP_010277751.1|  PREDICTED: protein trichome birefringence-li...    192   3e-54    
ref|XP_004247157.1|  PREDICTED: protein trichome birefringence-li...    193   3e-54    
ref|XP_009412789.1|  PREDICTED: protein trichome birefringence-li...    193   3e-54    
gb|EMS46662.1|  hypothetical protein TRIUR3_30641                       190   4e-54    
ref|XP_010654124.1|  PREDICTED: protein trichome birefringence-li...    192   4e-54    
ref|XP_008235216.1|  PREDICTED: protein trichome birefringence-li...    194   4e-54    
gb|KCW84265.1|  hypothetical protein EUGRSUZ_B01121                     189   4e-54    
emb|CDY49998.1|  BnaC03g34550D                                          189   4e-54    
ref|XP_002272356.2|  PREDICTED: protein trichome birefringence-li...    192   4e-54    
ref|XP_009129639.1|  PREDICTED: protein trichome birefringence-li...    192   5e-54    
ref|XP_002520761.1|  conserved hypothetical protein                     192   6e-54    
ref|XP_003541625.2|  PREDICTED: protein YLS7-like                       192   6e-54    
ref|XP_006850739.1|  hypothetical protein AMTR_s00025p00057340          188   6e-54    
ref|XP_010486094.1|  PREDICTED: protein trichome birefringence-li...    192   6e-54    
ref|XP_008342804.1|  PREDICTED: protein trichome birefringence-li...    191   6e-54    



>ref|XP_006362212.1| PREDICTED: uncharacterized protein LOC102599885 [Solanum tuberosum]
Length=691

 Score =   419 bits (1077),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEYN  VEFFV+PFLVQEWE ADKKG KK ETLRLDL+  SADKYKNADIL+FNTGHWWT
Sbjct  456  EEYNFRVEFFVSPFLVQEWEYADKKGTKK-ETLRLDLIGQSADKYKNADILIFNTGHWWT  514

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY+EL+V+EAFRKALTTWGRWVD+H+NP KTFVLFRGYSASHFS
Sbjct  515  HEKTSLGKDYYQEGSHVYNELDVLEAFRKALTTWGRWVDSHVNPKKTFVLFRGYSASHFS  574

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKN TYLTPYP KM VLERVL GMKTQVSYLN+TRMTDFRKD H
Sbjct  575  GGQWNSGGACDHETEPIKNTTYLTPYPSKMNVLERVLKGMKTQVSYLNITRMTDFRKDGH  634

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ  + EE+++PL +QDCSHWCLPGVPD WNELLYA++LV Q+QK
Sbjct  635  PSVYRKQKFTVEEKKTPLLFQDCSHWCLPGVPDAWNELLYAKILVNQHQK  684



>ref|XP_004249181.1| PREDICTED: protein trichome birefringence [Solanum lycopersicum]
Length=691

 Score =   419 bits (1076),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 189/230 (82%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEYN  VEFFV+PFLVQEWE +DKKG KK ETLRLDL+  SADKYKNADIL+FNTGHWWT
Sbjct  456  EEYNFRVEFFVSPFLVQEWEYSDKKGVKK-ETLRLDLIGQSADKYKNADILIFNTGHWWT  514

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY+EL+V+EAFRKALTTWGRWVD+H+NP +TFVLFRGYSASHFS
Sbjct  515  HEKTSLGKDYYQEGSHVYNELDVLEAFRKALTTWGRWVDSHVNPKRTFVLFRGYSASHFS  574

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKN TYLTPYP KM VLERVL GMKTQVSYLN+TRMTDFRKD H
Sbjct  575  GGQWNSGGACDHETEPIKNTTYLTPYPSKMNVLERVLKGMKTQVSYLNITRMTDFRKDGH  634

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ  + EE++SPL +QDCSHWCLPGVPD WNELLYA++LV Q+QK
Sbjct  635  PSVYRKQKFTTEEKKSPLLFQDCSHWCLPGVPDAWNELLYAKILVNQHQK  684



>ref|XP_009757308.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=684

 Score =   418 bits (1075),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/230 (83%), Positives = 208/230 (90%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEYNC VEFFV+PFLVQEWE ADKKG KK ETLRLDL+  SADKYKNADIL+FNTGHWWT
Sbjct  449  EEYNCRVEFFVSPFLVQEWEFADKKGVKK-ETLRLDLIGQSADKYKNADILIFNTGHWWT  507

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY EL+V+EAFRKALTTWGRW+D+H+NP KTFVLFRGYSASHFS
Sbjct  508  HEKTSLGKDYYQEGSHVYSELDVLEAFRKALTTWGRWIDSHVNPHKTFVLFRGYSASHFS  567

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKN TYLTPYP KM VLERVL GMKTQVSYLNVTRMTD+RKD H
Sbjct  568  GGQWNSGGACDHETEPIKNNTYLTPYPSKMNVLERVLRGMKTQVSYLNVTRMTDYRKDGH  627

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ L+ EE++S L +QDCSHWCLPGVPD WNELLYA+LLV Q+ K
Sbjct  628  PSIYRKQKLTNEEKKSELLFQDCSHWCLPGVPDAWNELLYAKLLVNQHMK  677



>ref|XP_010557950.1| PREDICTED: protein trichome birefringence-like [Tarenaya hassleriana]
Length=626

 Score =   414 bits (1064),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 205/225 (91%), Gaps = 1/225 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNCTVEF+V+PFLVQEWE+ DK G KK ETLRLDLV  S+D+YK ADI+VFNTGHWWTH
Sbjct  392  DYNCTVEFYVSPFLVQEWEVVDKNGTKK-ETLRLDLVGRSSDQYKGADIIVFNTGHWWTH  450

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTSKGEDYYQEGSHVY ELNV+EAFRKALTTW RWVD ++NP K+ V FRGYSASHFSG
Sbjct  451  EKTSKGEDYYQEGSHVYDELNVLEAFRKALTTWSRWVDKNVNPNKSLVFFRGYSASHFSG  510

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGGACD E EPIKN+TYLTPYPPKM+VLERVL GMKT V+YLN+TRM+D+RKD HP
Sbjct  511  GQWNSGGACDSETEPIKNQTYLTPYPPKMQVLERVLKGMKTSVTYLNITRMSDYRKDGHP  570

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            S+YRKQ LSEEERRSPLRYQDCSHWCLPGVPD WNE+LYAELLVK
Sbjct  571  SIYRKQKLSEEERRSPLRYQDCSHWCLPGVPDSWNEILYAELLVK  615



>ref|XP_009611858.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=648

 Score =   414 bits (1065),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 207/230 (90%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY+C VEFFV+PFLVQEWE ADKKG KK ETLRLDL+  SADKYKNADIL+FNTGHWWT
Sbjct  413  EEYDCRVEFFVSPFLVQEWEFADKKGVKK-ETLRLDLIGQSADKYKNADILIFNTGHWWT  471

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY EL+V+EAFRKALTTWGRWVD+H+N  KTFVLFRGYSASHFS
Sbjct  472  HEKTSLGKDYYQEGSHVYSELDVLEAFRKALTTWGRWVDSHVNSQKTFVLFRGYSASHFS  531

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKN TYLTPYP KM VLERVL GMKTQVSYLNVTRMTD+RKD H
Sbjct  532  GGQWNSGGACDHETEPIKNNTYLTPYPSKMNVLERVLRGMKTQVSYLNVTRMTDYRKDGH  591

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ L+ EE++S L +QDCSHWCLPGVPD WNELLYA+LLV Q+ K
Sbjct  592  PSIYRKQKLTNEEKKSELLFQDCSHWCLPGVPDAWNELLYAKLLVNQHMK  641



>ref|XP_011078818.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=634

 Score =   413 bits (1061),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 212/236 (90%), Gaps = 3/236 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+Y CTVEFFV+PFLVQEWE+AD+ G  KKETLRLDLV+ SADKYKNADI+VFNTGHWWT
Sbjct  399  EDYKCTVEFFVSPFLVQEWELADRNG-TKKETLRLDLVSRSADKYKNADIIVFNTGHWWT  457

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSHVY ELNV+EAFRKA+TTWGRWVD +IN  KT V FRGYSASHFS
Sbjct  458  HEKTSKGKDYYQEGSHVYGELNVLEAFRKAITTWGRWVDANINQTKTLVFFRGYSASHFS  517

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CDHE EPIKNETYL+ YPPKM V+E+VL G+KT V+YLN+TRMTD+RKD H
Sbjct  518  GGQWNSGGQCDHETEPIKNETYLSQYPPKMTVVEKVLKGIKTPVTYLNITRMTDYRKDGH  577

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK--QYQKSSKK  101
            PSMYRKQ++S+EERRSPL +QDCSHWCLPGVPD WNE+LYAELLVK  Q Q+S K+
Sbjct  578  PSMYRKQHMSDEERRSPLSFQDCSHWCLPGVPDAWNEILYAELLVKLNQKQQSQKR  633



>emb|CDP10159.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   412 bits (1058),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 188/230 (82%), Positives = 205/230 (89%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+Y  TVEFFV PFLVQEWE  DK G KKKETLRLDLV HSADKYK+ADI++FNTGHWWT
Sbjct  387  EDYKFTVEFFVTPFLVQEWEFQDKNG-KKKETLRLDLVGHSADKYKSADIIIFNTGHWWT  445

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT+ G+DYYQEGSHVY ELNV+EAFRKALTTW RWVD  +NPAK+ V FRGYSASHFS
Sbjct  446  HDKTALGKDYYQEGSHVYSELNVLEAFRKALTTWARWVDAKVNPAKSLVFFRGYSASHFS  505

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKNETYL+ YP KM VLE++L  MKT VSYLNVTRMTD+RKD H
Sbjct  506  GGQWNSGGACDHETEPIKNETYLSQYPSKMVVLEKILRNMKTPVSYLNVTRMTDYRKDGH  565

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ L+EEERRSPLRYQDCSHWCLPGVPD WNELLYAELLVK+YQK
Sbjct  566  PSVYRKQSLTEEERRSPLRYQDCSHWCLPGVPDSWNELLYAELLVKRYQK  615



>ref|XP_011075105.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=616

 Score =   410 bits (1055),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/230 (81%), Positives = 206/230 (90%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY CTVEFFVAPFLVQEWE+A K G  K ETLRLDL++ SADKYKNADI+VFNTGHWWT
Sbjct  386  EEYKCTVEFFVAPFLVQEWEVAGKNGTTK-ETLRLDLISRSADKYKNADIIVFNTGHWWT  444

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSH+Y +LNV+EAFRKALTTWGRW+D +INP K+ V FRGYSASHFS
Sbjct  445  HEKTSTGKDYYQEGSHIYKDLNVLEAFRKALTTWGRWIDANINPMKSLVFFRGYSASHFS  504

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD+E EPIKNETYLTPYP KM VLE+VL GMKT V+YLNVTRMTD+RKD H
Sbjct  505  GGQWNSGGQCDNETEPIKNETYLTPYPQKMTVLEKVLRGMKTHVTYLNVTRMTDYRKDGH  564

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ+LS+EERRSPL +QDCSHWCLPGVPD WNE+LYAELLVK  QK
Sbjct  565  PSIYRKQHLSDEERRSPLSFQDCSHWCLPGVPDAWNEILYAELLVKLNQK  614



>ref|XP_004249290.1| PREDICTED: protein trichome birefringence-like [Solanum lycopersicum]
Length=578

 Score =   409 bits (1050),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 208/234 (89%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY C VEFFV+PFLVQ+WE+ADKKG KK ETLRLDL+  SADKYK+AD+LVFNTGHWWT
Sbjct  344  EEYKCRVEFFVSPFLVQQWEVADKKGGKK-ETLRLDLIGESADKYKDADVLVFNTGHWWT  402

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG+HVY+ELNV+EAFR+ALTTWGRW+D HINP KTFVLFRGYSASHFS
Sbjct  403  HEKTSLGKDYYQEGNHVYNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGYSASHFS  462

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE V  GMKTQVSYLN+TRMTD+RKD H
Sbjct  463  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEDVFKGMKTQVSYLNITRMTDYRKDGH  522

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRK  L+ +ERRS  RYQDCSHWCLPGVPD WNELLYAELLV+ +QK   K
Sbjct  523  PSIYRKPNLTLKERRSQWRYQDCSHWCLPGVPDAWNELLYAELLVRLHQKHQSK  576



>ref|XP_006351352.1| PREDICTED: uncharacterized protein LOC102598735 isoform X2 [Solanum 
tuberosum]
Length=656

 Score =   411 bits (1056),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 209/234 (89%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EY C VEFFV+PFLVQ+WE+ADKKG KK ETLRLDL+  SADKYKNADILVFNTGHWWT
Sbjct  422  KEYKCRVEFFVSPFLVQQWEVADKKGGKK-ETLRLDLIGESADKYKNADILVFNTGHWWT  480

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG+HV++ELNV+EAFR+ALTTWGRW+D HINP KTFVLFRGYSASHFS
Sbjct  481  HEKTSLGKDYYQEGNHVHNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGYSASHFS  540

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE V  GMKTQVSYLN+TRMTD+RKD H
Sbjct  541  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEDVFKGMKTQVSYLNITRMTDYRKDGH  600

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRK  L+ +ERRS  RYQDCSHWCLPGVPD WNELLYAELLV+ +QK  +K
Sbjct  601  PSIYRKPNLTLKERRSQWRYQDCSHWCLPGVPDAWNELLYAELLVRLHQKQQEK  654



>ref|XP_006351351.1| PREDICTED: uncharacterized protein LOC102598735 isoform X1 [Solanum 
tuberosum]
Length=713

 Score =   412 bits (1059),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 209/234 (89%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EY C VEFFV+PFLVQ+WE+ADKKG  KKETLRLDL+  SADKYKNADILVFNTGHWWT
Sbjct  479  KEYKCRVEFFVSPFLVQQWEVADKKG-GKKETLRLDLIGESADKYKNADILVFNTGHWWT  537

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG+HV++ELNV+EAFR+ALTTWGRW+D HINP KTFVLFRGYSASHFS
Sbjct  538  HEKTSLGKDYYQEGNHVHNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGYSASHFS  597

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE V  GMKTQVSYLN+TRMTD+RKD H
Sbjct  598  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEDVFKGMKTQVSYLNITRMTDYRKDGH  657

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRK  L+ +ERRS  RYQDCSHWCLPGVPD WNELLYAELLV+ +QK  +K
Sbjct  658  PSIYRKPNLTLKERRSQWRYQDCSHWCLPGVPDAWNELLYAELLVRLHQKQQEK  711



>ref|XP_010520026.1| PREDICTED: protein trichome birefringence-like [Tarenaya hassleriana]
Length=649

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 206/226 (91%), Gaps = 1/226 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+CTVEF+V+PFLVQEWE+ DK G KK ETLRLDLV  S+++YK ADI++FNTGHWWT
Sbjct  414  KDYDCTVEFYVSPFLVQEWEVVDKNGTKK-ETLRLDLVGRSSEQYKGADIIIFNTGHWWT  472

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGSHVY ELNV+EAFRKALTTW RWVD ++NP K+ VLFRGYSASHFS
Sbjct  473  HEKTSKGEDYYQEGSHVYGELNVLEAFRKALTTWSRWVDKNVNPDKSLVLFRGYSASHFS  532

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYPPKM+VLERV+ GMKT V+YLN+TR+TD+RKD H
Sbjct  533  GGQWNSGGACDSETEPIKNETYLTPYPPKMQVLERVIKGMKTPVTYLNITRLTDYRKDGH  592

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            PS+YRKQ LS EERRSPLRYQDCSHWCLPGVPD WNE+LYAELLV+
Sbjct  593  PSIYRKQNLSPEERRSPLRYQDCSHWCLPGVPDSWNEILYAELLVQ  638



>ref|XP_010257492.1| PREDICTED: protein trichome birefringence [Nelumbo nucifera]
Length=597

 Score =   406 bits (1043),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 205/234 (88%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+VEFF +PFLVQEWE+ D  G KK ETLRLD++    DKYK ADI+VFNTGHWWT
Sbjct  365  EDYNCSVEFFRSPFLVQEWEMPDTNGSKK-ETLRLDVIERKFDKYKTADIIVFNTGHWWT  423

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSH+Y ELNVVEAFRKALTTW RWVD +I+P+ T V FRGYSASHFS
Sbjct  424  HKKTSKGKDYYQEGSHIYGELNVVEAFRKALTTWARWVDANIDPSNTMVFFRGYSASHFS  483

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CDHE EPIKNETYL PYPPKM+VLE V+ GMKT VSYLN+TRMTD+RKDAH
Sbjct  484  GGQWNSGGQCDHETEPIKNETYLNPYPPKMKVLESVMKGMKTHVSYLNITRMTDYRKDAH  543

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ L+EEERRSPLRYQDCSHWCLPGVPD WNELLYAELL++  QK  +K
Sbjct  544  PSIYRKQSLTEEERRSPLRYQDCSHWCLPGVPDSWNELLYAELLIRHNQKQQQK  597



>gb|AAM67355.1| unknown [Arabidopsis thaliana]
Length=329

 Score =   395 bits (1015),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 208/231 (90%), Gaps = 1/231 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWEI  KKG KK ETLRLDLV  S+++YK AD++VFNTGHWWT
Sbjct  94   QDYNCTVEFFVSPFLVQEWEIVXKKGXKK-ETLRLDLVGKSSEQYKGADVIVFNTGHWWT  152

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NPAK+ V FRGYSASHFS
Sbjct  153  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFS  212

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  213  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  272

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKS  110
            PS+YRKQ LSE+E++SPL YQDCSHWCLPGVPD WNE+LYAEL+VK  Q S
Sbjct  273  PSVYRKQSLSEKEKKSPLLYQDCSHWCLPGVPDSWNEILYAELIVKLNQLS  323



>ref|XP_009783309.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=658

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 207/234 (88%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY C VEFFV+PFLVQ+WE+ADKKG  KKETLRLDL+  SA+KYKNADI+VFNTGHWWT
Sbjct  424  EEYKCRVEFFVSPFLVQQWEVADKKG-GKKETLRLDLIGESAEKYKNADIIVFNTGHWWT  482

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHV+ +LNV+EAFRKALTTWGRWVD HINP KT VLFRGYSASHFS
Sbjct  483  HEKTSLGKDYYQEGSHVHSQLNVLEAFRKALTTWGRWVDAHINPKKTIVLFRGYSASHFS  542

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM VLE    GMKTQVSYLN+TRM+D+RKD H
Sbjct  543  GGQWNSGGACDSETEPIKNDTYLTPYPSKMTVLENAFKGMKTQVSYLNITRMSDYRKDGH  602

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRK  L+++ER+S  RYQDCSHWCLPGVPD WNELLYAELLV+Q+QK  +K
Sbjct  603  PSIYRKPNLTDKERKSQWRYQDCSHWCLPGVPDAWNELLYAELLVRQHQKQHEK  656



>ref|NP_568173.2| protein TRICHOME BIREFRINGENCE [Arabidopsis thaliana]
 sp|Q9FG35.1|TBR_ARATH RecName: Full=Protein trichome birefringence [Arabidopsis thaliana]
 dbj|BAB09804.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF01304.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91052.1| uncharacterized protein AT5G06700 [Arabidopsis thaliana]
Length=608

 Score =   404 bits (1037),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 209/231 (90%), Gaps = 1/231 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWEI DKKG KK ETLRLDLV  S+++YK AD++VFNTGHWWT
Sbjct  373  QDYNCTVEFFVSPFLVQEWEIVDKKGTKK-ETLRLDLVGKSSEQYKGADVIVFNTGHWWT  431

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NPAK+ V FRGYSASHFS
Sbjct  432  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFS  491

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  492  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  551

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKS  110
            PS+YRKQ LSE+E++SPL YQDCSHWCLPGVPD WNE+LYAEL+VK  Q S
Sbjct  552  PSVYRKQSLSEKEKKSPLLYQDCSHWCLPGVPDSWNEILYAELIVKLNQLS  602



>ref|XP_002534536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27846.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score =   403 bits (1036),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 208/238 (87%), Gaps = 1/238 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN TVEFFV+PFLVQEWE+ADK G KKKETLRLDLV   +D+YK ADI+VFNTGHWWT
Sbjct  382  KDYNFTVEFFVSPFLVQEWEVADKNG-KKKETLRLDLVGSLSDQYKGADIIVFNTGHWWT  440

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+ YYQEG+HVY ELNV+EAFRKALTTW RWVD+H+NPAK+ V FRGYSASHFS
Sbjct  441  HEKTSKGKSYYQEGTHVYDELNVLEAFRKALTTWARWVDSHVNPAKSLVFFRGYSASHFS  500

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD+EVEPI+N TYL  YP KM VLE+VL GMKT V+YLNVT+MTD+RKD H
Sbjct  501  GGQWNSGGACDNEVEPIQNSTYLQEYPSKMVVLEKVLRGMKTHVTYLNVTQMTDYRKDGH  560

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKKAGHR  89
            PS+YRKQ +  EER+SPLRYQDCSHWCLPGVPD WNE+LYAELL+ +YQK   +  HR
Sbjct  561  PSIYRKQNVPAEERKSPLRYQDCSHWCLPGVPDAWNEILYAELLINEYQKRQVQKRHR  618



>gb|KDO70900.1| hypothetical protein CISIN_1g037533mg [Citrus sinensis]
Length=297

 Score =   391 bits (1005),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFFV+PFLVQEWE+ +K G KK ETLRLDLV  S+D+YK ADI++FNTGHWWT
Sbjct  59   KDYNCSVEFFVSPFLVQEWEMPEKDGTKK-ETLRLDLVGRSSDQYKGADIIIFNTGHWWT  117

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT++G+DYYQEGSHVY ELNV+EAFR+ALTTW RWVD ++NP K+ V FRGYSASHFS
Sbjct  118  HDKTAEGKDYYQEGSHVYGELNVLEAFRRALTTWARWVDANVNPMKSMVFFRGYSASHFS  177

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKN+TYLT YPPKM+VLE VL GMKT V+YLN+TR+TD+RKD H
Sbjct  178  GGQWNSGGACDHETEPIKNKTYLTAYPPKMKVLESVLKGMKTHVTYLNITRLTDYRKDGH  237

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ++S+ ERRSPLRYQDCSHWCLPGVPD WNEL YAEL++K+
Sbjct  238  PSIYRKQHISDAERRSPLRYQDCSHWCLPGVPDAWNELFYAELIIKE  284



>ref|XP_002871228.1| hypothetical protein ARALYDRAFT_487481 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47487.1| hypothetical protein ARALYDRAFT_487481 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 208/231 (90%), Gaps = 1/231 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWEI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  376  QDYNCTVEFFVSPFLVQEWEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  434

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NPAK+ V FRGYSASHFS
Sbjct  435  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFS  494

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  495  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  554

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKS  110
            PS+YRK  LSE+E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q S
Sbjct  555  PSVYRKHSLSEKEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQLS  605



>emb|CBI30004.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   390 bits (1001),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 204/227 (90%), Gaps = 1/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY+C+VEFFV+PFLVQEWE+ DK G KK ETLRLD +  S+DKYK ADI++FNTGHWWT
Sbjct  78   EEYHCSVEFFVSPFLVQEWEMPDKNGSKK-ETLRLDKIPTSSDKYKTADIIIFNTGHWWT  136

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD ++NPAK+ V FRGYS+SHFS
Sbjct  137  HDKTSKGKDYYQEGSHVYGELNVMEAFRKALTTWARWVDANVNPAKSLVFFRGYSSSHFS  196

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPI+NETY+  YPPKM VLE++L GMKTQV+YLN+TR+TD+RKD H
Sbjct  197  GGQWNSGGQCDGETEPIRNETYIPDYPPKMIVLEKILRGMKTQVTYLNITRITDYRKDGH  256

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ LS+EERRSPLR+QDCSHWCLPGVPD WNELLYAE+L++Q
Sbjct  257  PSIYRKQNLSDEERRSPLRFQDCSHWCLPGVPDAWNELLYAEILIRQ  303



>gb|ADI48429.1| trichome birefringence [Arabidopsis thaliana]
Length=608

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 208/231 (90%), Gaps = 1/231 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWEI DKKG KK ETLRLDLV  S+++YK AD++VFNT HWWT
Sbjct  373  QDYNCTVEFFVSPFLVQEWEIVDKKGTKK-ETLRLDLVGKSSEQYKGADVIVFNTEHWWT  431

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NPAK+ V FRGYSASHFS
Sbjct  432  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFS  491

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  492  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  551

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKS  110
            PS+YRKQ LSE+E++SPL YQDCSHWCLPGVPD WNE+LYAEL+VK  Q S
Sbjct  552  PSVYRKQSLSEKEKKSPLLYQDCSHWCLPGVPDSWNEILYAELIVKLNQLS  602



>ref|XP_006429897.1| hypothetical protein CICLE_v10011263mg [Citrus clementina]
 gb|ESR43137.1| hypothetical protein CICLE_v10011263mg [Citrus clementina]
Length=644

 Score =   400 bits (1027),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFFV+PFLVQEWE+ +K G KK ETLRLDLV  S+D+YK ADI++FNTGHWWT
Sbjct  406  KDYNCSVEFFVSPFLVQEWEMPEKDGTKK-ETLRLDLVGRSSDQYKGADIIIFNTGHWWT  464

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT++G+DYYQEGSHVY ELNV+EAFR+ALTTW RWVD ++NP K+ V FRGYSASHFS
Sbjct  465  HDKTAEGKDYYQEGSHVYGELNVLEAFRRALTTWARWVDANVNPMKSMVFFRGYSASHFS  524

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKN+TYLT YPPKM+VLE VL GMKT V+YLN+TR+TD+RKD H
Sbjct  525  GGQWNSGGACDHETEPIKNKTYLTAYPPKMKVLESVLKGMKTHVTYLNITRLTDYRKDGH  584

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ++S+ ERRSPLRYQDCSHWCLPGVPD WNEL YAEL++K+
Sbjct  585  PSIYRKQHISDAERRSPLRYQDCSHWCLPGVPDAWNELFYAELIIKE  631



>gb|KDP24643.1| hypothetical protein JCGZ_25559 [Jatropha curcas]
Length=638

 Score =   399 bits (1026),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 206/238 (87%), Gaps = 1/238 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+CT+EFFV+PFLVQEWE+ DK G  K+ETLRLDLV  S+D YKNADI++FNTGHWWT
Sbjct  402  KDYDCTIEFFVSPFLVQEWEMPDKNG-TKRETLRLDLVGRSSDLYKNADIIIFNTGHWWT  460

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSH+Y+ELNV+EAFRKALTTW RWVD ++NP K+ V FRGYSASHFS
Sbjct  461  HDKTSKGKDYYQEGSHIYNELNVLEAFRKALTTWARWVDHNVNPMKSLVFFRGYSASHFS  520

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD EVEPI N TYL  YPPKM VLERVL GMKT V+YLNVT+MTD+RKD H
Sbjct  521  GGQWNSGGACDSEVEPINNATYLRQYPPKMLVLERVLRGMKTHVTYLNVTQMTDYRKDGH  580

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKKAGHR  89
            PS+YRK+ +  EER+SPL +QDCSHWCLPGVPD WNE+LYAELL+ +YQK   +  HR
Sbjct  581  PSIYRKRNIPPEERKSPLHFQDCSHWCLPGVPDTWNEILYAELLISEYQKRRVQKKHR  638



>ref|XP_009604045.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=647

 Score =   399 bits (1026),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 201/225 (89%), Gaps = 1/225 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+Y C VEFFV+PFLVQ+WE+ADKKG  KKETLRLDL+  SA+KYKNADI+VFNTGHWWT
Sbjct  413  EDYKCRVEFFVSPFLVQQWEVADKKG-GKKETLRLDLIGESAEKYKNADIIVFNTGHWWT  471

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHV+ +LNVVEAFRKALTTWGRWVD HINP KT VLFRGYSASHFS
Sbjct  472  HEKTSLGKDYYQEGSHVHRQLNVVEAFRKALTTWGRWVDAHINPKKTVVLFRGYSASHFS  531

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM VLE+V  GMKTQVSYLN+TRM+D+RKD H
Sbjct  532  GGQWNSGGACDSETEPIKNDTYLTPYPSKMTVLEQVFKGMKTQVSYLNITRMSDYRKDGH  591

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YRK  L+++ER+S  RYQDCSHWCLPGVPD WNELLYAELL 
Sbjct  592  PSIYRKPNLTDKERKSQWRYQDCSHWCLPGVPDAWNELLYAELLA  636



>ref|XP_006287297.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
 gb|EOA20195.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
Length=613

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWEI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  378  QDYNCTVEFFVSPFLVQEWEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  436

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  437  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASHFS  496

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  497  GGQWNSGGACDSETEPIKNDTYLTPYPSKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  556

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  L+E+E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  557  PSVYRKHSLTEKEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  605



>ref|XP_006492844.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=644

 Score =   399 bits (1025),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFFV+PFLVQEWE+ +K G KK ETLRLDLV  S+D+YK ADI++FNTGHWWT
Sbjct  406  KDYNCSVEFFVSPFLVQEWEMPEKDGTKK-ETLRLDLVGRSSDQYKGADIIIFNTGHWWT  464

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT++G+DYYQEGSHVY ELNV+EAFR+ALTTW RWVD ++NP K+ V FRGYSASHFS
Sbjct  465  HDKTAEGKDYYQEGSHVYGELNVLEAFRRALTTWARWVDANVNPMKSMVFFRGYSASHFS  524

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACDHE EPIKN+TYLT YPPKM+VLE VL GMKT V+YLN+TR+TD+RKD H
Sbjct  525  GGQWNSGGACDHETEPIKNKTYLTAYPPKMKVLESVLKGMKTHVTYLNITRLTDYRKDGH  584

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ++S+ ERRSPLRYQDCSHWCLPGVPD WNEL YAEL++K+
Sbjct  585  PSIYRKQHISDAERRSPLRYQDCSHWCLPGVPDAWNELFYAELIIKE  631



>emb|CDY55774.1| BnaA03g55480D [Brassica napus]
Length=519

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  284  QDYNCTVEFFVSPFLVQENEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  342

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  343  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPDKSLVFFRGYSASHFS  402

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLERVL GM+T V+YLN+TR+TD+RKD H
Sbjct  403  GGQWNSGGACDSETEPIKNETYLTPYPDKMKVLERVLKGMRTPVTYLNITRLTDYRKDGH  462

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS++E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  463  PSVYRKQSLSDKEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  511



>ref|XP_010491248.1| PREDICTED: protein trichome birefringence-like [Camelina sativa]
Length=616

 Score =   398 bits (1022),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWEI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  381  QDYNCTVEFFVSPFLVQEWEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  439

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  440  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASHFS  499

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E +PIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  500  GGQWNSGGACDSETKPIKNDTYLTPYPSKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  559

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  L+E+E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  560  PSVYRKHTLTEKEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLSQ  608



>ref|XP_010265940.1| PREDICTED: protein trichome birefringence-like [Nelumbo nucifera]
Length=617

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 1/225 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+V+FF +PFLVQEWE+ D  G K  ETLRLD++   +D+YK ADI++FNTGHWWTH
Sbjct  378  DYNCSVDFFRSPFLVQEWEMPDTNGSKH-ETLRLDIIERKSDRYKTADIIIFNTGHWWTH  436

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTSKG+DYYQEGSHVY ELNVVEAFR+ALTTW RWVD  I+P KT V FRGYSASHFSG
Sbjct  437  EKTSKGKDYYQEGSHVYGELNVVEAFRRALTTWARWVDAKIDPKKTMVFFRGYSASHFSG  496

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG CDHE EPIKNETYLTPYPPKM VLE V+ GMKT V YLN+TRMTD+RKDAHP
Sbjct  497  GQWNSGGQCDHETEPIKNETYLTPYPPKMRVLENVMKGMKTPVFYLNITRMTDYRKDAHP  556

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            S+YRKQ L+EEER+SPLRYQDCSHWCLPGVPD WNELLYAELL++
Sbjct  557  SIYRKQSLTEEERKSPLRYQDCSHWCLPGVPDSWNELLYAELLIR  601



>ref|XP_008443032.1| PREDICTED: protein trichome birefringence [Cucumis melo]
Length=614

 Score =   397 bits (1019),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 205/230 (89%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN TVEFFV+PFLV+EWE+ DK G K KETLRLDLV  S+D+YK ADI+VFNTGHWWT
Sbjct  383  KDYNFTVEFFVSPFLVREWEMPDKNG-KTKETLRLDLVGKSSDQYKEADIIVFNTGHWWT  441

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+G+DYYQEGSHVY ELNV+EAFRKA+TTW RWVD +INP K+ V FRGYSASHFS
Sbjct  442  HEKTSRGKDYYQEGSHVYEELNVLEAFRKAITTWARWVDKNINPMKSIVFFRGYSASHFS  501

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E++PIKNETYL  YPPKM VLE+VL GMKT V+YLN+T+MTDFRKD H
Sbjct  502  GGQWNSGGQCDSEIQPIKNETYLRHYPPKMVVLEKVLKGMKTHVTYLNITKMTDFRKDGH  561

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ L+EEERRSPLR+QDCSHWCLPGVPD WNE+LYAELL+KQ Q+
Sbjct  562  PSIYRKQKLTEEERRSPLRFQDCSHWCLPGVPDAWNEILYAELLLKQQQQ  611



>ref|XP_006399144.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
 gb|ESQ40597.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
Length=613

 Score =   397 bits (1019),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI++FNTGHWWT
Sbjct  378  QDYNCTVEFFVSPFLVQETEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIIFNTGHWWT  436

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  437  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPDKSLVFFRGYSASHFS  496

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLERVL GM+T V+YLN+TR+TD+RKD H
Sbjct  497  GGQWNSGGACDSETEPIKNETYLTPYPSKMKVLERVLRGMRTPVTYLNITRLTDYRKDGH  556

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LSE+E+R+PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  557  PSVYRKHSLSEKEKRTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  605



>ref|XP_010452610.1| PREDICTED: protein trichome birefringence [Camelina sativa]
Length=621

 Score =   397 bits (1019),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWEI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  386  QDYNCTVEFFVSPFLVQEWEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  444

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  445  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASHFS  504

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E +PIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  505  GGQWNSGGACDSETKPIKNDTYLTPYPSKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  564

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  L+E+E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  565  PSVYRKHTLTEKEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLSQ  613



>emb|CDX81015.1| BnaC03g02690D [Brassica napus]
Length=519

 Score =   393 bits (1009),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  284  QDYNCTVEFFVSPFLVQENEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  342

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  343  HEKTSKGEDYYQEGSNVYHELAVHEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFS  402

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLERVL GM+T V+YLN+TR+TD+RKD H
Sbjct  403  GGQWNSGGACDSETEPIKNETYLTPYPDKMKVLERVLKGMRTPVTYLNITRLTDYRKDGH  462

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS++E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  463  PSVYRKQSLSDKEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  511



>emb|CDY05000.1| BnaAnng01820D [Brassica napus]
Length=525

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDL+  S+++YK ADI+VFNTGHWWT
Sbjct  296  QDYNCTVEFFVSPFLVQESEIVDKKGTKK-ETLRLDLIGKSSEQYKGADIIVFNTGHWWT  354

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSA+HFS
Sbjct  355  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGYSATHFS  414

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLE VL GM+T V+YLN+TR+TD+RKD H
Sbjct  415  GGQWNSGGACDSETEPIKNETYLTPYPSKMKVLESVLKGMRTPVTYLNITRLTDYRKDGH  474

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS+EE+++PL YQDCSHWCLPGVPD WNE+LYAELL+K  Q
Sbjct  475  PSVYRKQILSDEEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLLKLNQ  523



>emb|CDX98947.1| BnaC09g48880D [Brassica napus]
Length=584

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  349  QDYNCTVEFFVSPFLVQETEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  407

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  408  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFS  467

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLERVL GM+T V+YLN+TR+TD+RKD H
Sbjct  468  GGQWNSGGACDSETEPIKNETYLTPYPSKMKVLERVLRGMRTPVTYLNITRLTDYRKDGH  527

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LS+ E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  528  PSVYRKHSLSDREKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLSQ  576



>gb|KFK25082.1| hypothetical protein AALP_AA8G063700 [Arabis alpina]
Length=587

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  352  QDYNCTVEFFVSPFLVQETEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  410

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  411  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGYSASHFS  470

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKN+TYLTPYP KM+VLE+VL GMKT V+YLN+TR+TD+RKD H
Sbjct  471  GGQWNSGGACDSETEPIKNDTYLTPYPAKMKVLEKVLRGMKTPVTYLNITRLTDYRKDGH  530

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LSE+E++SPL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  531  PSVYRKHSLSEKEKKSPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  579



>ref|XP_007029023.1| Emb:CAB82953.1, putative [Theobroma cacao]
 gb|EOY09525.1| Emb:CAB82953.1, putative [Theobroma cacao]
Length=650

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 204/230 (89%), Gaps = 4/230 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCT+EFFV+PFLV+EWE+ DK G KK ETLRLDLV  S+D+YK+ADIL+FNTGHWWT
Sbjct  411  KDYNCTLEFFVSPFLVREWEMPDKNGTKK-ETLRLDLVGKSSDQYKSADILIFNTGHWWT  469

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSHVY+ELNV+EAFR+ALTTW RWVD  +NP K+ V FRGYSASHFS
Sbjct  470  HEKTSKGKDYYQEGSHVYNELNVLEAFRRALTTWARWVDARVNPMKSMVFFRGYSASHFS  529

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPI+NETYLTPYP KM VLE VL GMKT V+YLN+TR+TDFRKD H
Sbjct  530  GGQWNSGGACDSETEPIRNETYLTPYPSKMLVLESVLKGMKTHVTYLNITRLTDFRKDGH  589

Query  262  PSMYR---KQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YR   KQ +SEEER +PL+YQDCSHWCLPGVPD WNELLYAELLVK+
Sbjct  590  PSIYRKHQKQQMSEEERIAPLKYQDCSHWCLPGVPDSWNELLYAELLVKE  639



>ref|XP_009130955.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
 ref|XP_009130956.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
Length=601

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  366  QDYNCTVEFFVSPFLVQENEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  424

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  425  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPDKSLVFFRGYSASHFS  484

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLERVL GM+T V+YLN+TR+TD+RKD H
Sbjct  485  GGQWNSGGACDSETEPIKNETYLTPYPDKMKVLERVLKGMRTPVTYLNITRLTDYRKDGH  544

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS++E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  545  PSVYRKQSLSDKEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  593



>ref|XP_002280022.1| PREDICTED: protein trichome birefringence [Vitis vinifera]
Length=659

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 203/226 (90%), Gaps = 1/226 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY+C+VEFFV+PFLVQEWE+ DK G KK ETLRLD +  S+DKYK ADI++FNTGHWWT
Sbjct  416  EEYHCSVEFFVSPFLVQEWEMPDKNGSKK-ETLRLDKIPTSSDKYKTADIIIFNTGHWWT  474

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD ++NPAK+ V FRGYS+SHFS
Sbjct  475  HDKTSKGKDYYQEGSHVYGELNVMEAFRKALTTWARWVDANVNPAKSLVFFRGYSSSHFS  534

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPI+NETY+  YPPKM VLE++L GMKTQV+YLN+TR+TD+RKD H
Sbjct  535  GGQWNSGGQCDGETEPIRNETYIPDYPPKMIVLEKILRGMKTQVTYLNITRITDYRKDGH  594

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            PS+YRKQ LS+EERRSPLR+QDCSHWCLPGVPD WNELLYAE+L++
Sbjct  595  PSIYRKQNLSDEERRSPLRFQDCSHWCLPGVPDAWNELLYAEILIR  640



>ref|XP_009122281.1| PREDICTED: protein trichome birefringence [Brassica rapa]
Length=644

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI+VFNTGHWWT
Sbjct  409  QDYNCTVEFFVSPFLVQETEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIVFNTGHWWT  467

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  468  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFS  527

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLERVL GM+T V+YLN+TR+TD+RKD H
Sbjct  528  GGQWNSGGACDSETEPIKNETYLTPYPSKMKVLERVLRGMRTPVTYLNITRLTDYRKDGH  587

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LS+ E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  588  PSVYRKHSLSDREKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  636



>emb|CDX70077.1| BnaA10g24260D [Brassica napus]
Length=583

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQE EI DKKG KK ETLRLDLV  S+++YK ADI++FNTGHWWT
Sbjct  348  QDYNCTVEFFVSPFLVQETEIVDKKGTKK-ETLRLDLVGKSSEQYKGADIIIFNTGHWWT  406

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRGYSASHFS
Sbjct  407  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFS  466

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLERVL GM+T V+YLN+TR+TD+RKD H
Sbjct  467  GGQWNSGGACDSETEPIKNETYLTPYPSKMKVLERVLRGMRTPVTYLNITRLTDYRKDGH  526

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LS+ E+++PL YQDCSHWCLPGVPD WNE+LYAELLVK  Q
Sbjct  527  PSVYRKHSLSDREKKTPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQ  575



>ref|XP_010111373.1| hypothetical protein L484_028030 [Morus notabilis]
 gb|EXC30851.1| hypothetical protein L484_028030 [Morus notabilis]
Length=609

 Score =   394 bits (1011),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+CTVEFFV+PFLVQEWE+ DK G KKKETLRLDL+  S+++YK+AD +VFNTGHWWT
Sbjct  372  KDYDCTVEFFVSPFLVQEWELKDKNGTKKKETLRLDLIGRSSEQYKSADFIVFNTGHWWT  431

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGSHVY ELNV+EAFRKA+TTW RW+D ++NP K+ V FRGYS SHFS
Sbjct  432  HEKTSKGEDYYQEGSHVYKELNVLEAFRKAVTTWARWIDANVNPKKSLVFFRGYSHSHFS  491

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E  PIKNETYL PY  KM VLE+VL GMKT VSYLN+T+MTDFRKD H
Sbjct  492  GGQWNSGGACDSETVPIKNETYLRPYESKMAVLEKVLKGMKTHVSYLNITKMTDFRKDGH  551

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            PS+YRKQ LS EER+SPL +QDCSHWCLPG+PD WNE+LYAELLVK
Sbjct  552  PSIYRKQNLSPEERKSPLLFQDCSHWCLPGIPDAWNEMLYAELLVK  597



>ref|XP_009125778.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
Length=525

 Score =   390 bits (1003),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +++NCTVEFFV+PFLVQE EI DKKG KK ETLRLDL+  S+++YK ADI+VFNTGHWWT
Sbjct  296  QDFNCTVEFFVSPFLVQESEIVDKKGTKK-ETLRLDLIGKSSEQYKGADIIVFNTGHWWT  354

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VYHEL V+EAFRKALTTWGRWV+ ++NP K+ V FRG+SA+HFS
Sbjct  355  HEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGFSATHFS  414

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E EPIKNETYLTPYP KM+VLE VL GM+T V+YLN+TR+TD+RKD H
Sbjct  415  GGQWNSGGACDSETEPIKNETYLTPYPSKMKVLESVLKGMRTPVTYLNITRLTDYRKDGH  474

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS+EE+++PL YQDCSHWCLPGVPD WNE+LYAELL+K  Q
Sbjct  475  PSVYRKQILSDEEKKTPLLYQDCSHWCLPGVPDSWNEILYAELLLKLNQ  523



>ref|XP_004161492.1| PREDICTED: uncharacterized protein LOC101228487 [Cucumis sativus]
Length=613

 Score =   392 bits (1006),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN TVEFFV+PFLV+EWE+ DK G KKKETLRLDLV  S+D+YK AD++VFNTGHWWT
Sbjct  382  KDYNFTVEFFVSPFLVREWEMPDKNG-KKKETLRLDLVGKSSDQYKEADVIVFNTGHWWT  440

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY ELNV+EAFRKA+TTW RWVD +INP K+ V FRGYSASHFS
Sbjct  441  HEKTSLGKDYYQEGSHVYEELNVLEAFRKAITTWARWVDKNINPMKSIVFFRGYSASHFS  500

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PIKNETYL  YPPKM VLE++L GMKT V+YLN+T+MTDFRKD H
Sbjct  501  GGQWNSGGQCDSENQPIKNETYLRHYPPKMVVLEKILKGMKTHVTYLNITKMTDFRKDGH  560

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ L+EEER+SPLR+QDCSHWCLPGVPD WNE+LYAELL+KQ Q+
Sbjct  561  PSIYRKQKLTEEERKSPLRFQDCSHWCLPGVPDAWNEILYAELLMKQQQQ  610



>ref|XP_004136561.1| PREDICTED: uncharacterized protein LOC101220024 [Cucumis sativus]
 gb|KGN59288.1| hypothetical protein Csa_3G800710 [Cucumis sativus]
Length=613

 Score =   392 bits (1006),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN TVEFFV+PFLV+EWE+ DK G KKKETLRLDLV  S+D+YK AD++VFNTGHWWT
Sbjct  382  KDYNFTVEFFVSPFLVREWEMPDKNG-KKKETLRLDLVGKSSDQYKEADVIVFNTGHWWT  440

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY ELNV+EAFRKA+TTW RWVD +INP K+ V FRGYSASHFS
Sbjct  441  HEKTSLGKDYYQEGSHVYEELNVLEAFRKAITTWARWVDKNINPMKSIVFFRGYSASHFS  500

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PIKNETYL  YPPKM VLE++L GMKT V+YLN+T+MTDFRKD H
Sbjct  501  GGQWNSGGQCDSENQPIKNETYLRHYPPKMVVLEKILKGMKTHVTYLNITKMTDFRKDGH  560

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ L+EEER+SPLR+QDCSHWCLPGVPD WNE+LYAELL+KQ Q+
Sbjct  561  PSIYRKQKLTEEERKSPLRFQDCSHWCLPGVPDAWNEILYAELLMKQQQQ  610



>ref|XP_008789200.1| PREDICTED: protein trichome birefringence [Phoenix dactylifera]
Length=670

 Score =   393 bits (1010),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 200/229 (87%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE+    G K KETLRLD++  S+ KYK+ADILVFNTGHWWT
Sbjct  440  KDYNCSVEFFRSPFLVQEWEMPVSSG-KTKETLRLDIIERSSPKYKDADILVFNTGHWWT  498

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEG+HVY ELNVVEAF KALTTW +WVDT++NP KT V FRGYSASHFS
Sbjct  499  HEKTSKGKDYYQEGNHVYSELNVVEAFHKALTTWAKWVDTNVNPKKTLVFFRGYSASHFS  558

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPIKNE YL+PYPPKM VLE V+ GMKT VSYLN+TRMTD+RKDAH
Sbjct  559  GGQWNSGGQCDQETEPIKNEKYLSPYPPKMHVLETVIKGMKTPVSYLNITRMTDYRKDAH  618

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ L+EEERRSP RYQDCSHWCLPGVPD WNELLY +L +KQ+Q
Sbjct  619  PSIYRKQNLTEEERRSPERYQDCSHWCLPGVPDSWNELLYIQLSIKQHQ  667



>gb|KJB16333.1| hypothetical protein B456_002G223800 [Gossypium raimondii]
Length=620

 Score =   391 bits (1005),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 202/230 (88%), Gaps = 4/230 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN T+EFFV+PFLV+EWE+ DK G KK ETLRLDLV  SAD+YK+ADILVFNTGHWWT
Sbjct  381  KDYNFTLEFFVSPFLVREWEMPDKNGGKK-ETLRLDLVGKSADQYKSADILVFNTGHWWT  439

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RW+D ++NP KT V FRGYSASHFS
Sbjct  440  HEKTSKGKDYYQEGSHVYEELNVLEAFRKALTTWSRWIDANVNPMKTMVFFRGYSASHFS  499

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD+E  PIKNE YLTPYP KM VLE VL GMKT V+YLN+TR+TDFRKD H
Sbjct  500  GGQWNSGGACDNETNPIKNEKYLTPYPSKMLVLELVLKGMKTHVTYLNITRLTDFRKDGH  559

Query  262  PSMYR---KQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YR   KQ LSE+ER+ PL+YQDCSHWCLPGVPD WNELLYAELLVK+
Sbjct  560  PSIYRKHPKQKLSEDERKEPLKYQDCSHWCLPGVPDSWNELLYAELLVKE  609



>ref|XP_007204224.1| hypothetical protein PRUPE_ppa002919mg [Prunus persica]
 gb|EMJ05423.1| hypothetical protein PRUPE_ppa002919mg [Prunus persica]
Length=621

 Score =   391 bits (1004),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 198/228 (87%), Gaps = 1/228 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLV+EWE+ +K G K+ ETLRLDLV  S+D YK+ADI++FNTGHWWT
Sbjct  380  KDYNCTVEFFVSPFLVREWEMPEKDGSKR-ETLRLDLVGRSSDLYKDADIVIFNTGHWWT  438

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD  INP K+ V FRGYSASHFS
Sbjct  439  HEKTSKGKDYYQEGSHVYGELNVLEAFRKALTTWARWVDAKINPRKSIVFFRGYSASHFS  498

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PI NETYL PYPPKM VLE+VL  MKT V+YLN+TRMTDFRKD H
Sbjct  499  GGQWNSGGQCDSETLPISNETYLRPYPPKMLVLEKVLRNMKTHVTYLNITRMTDFRKDGH  558

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQY  119
            PS+YRKQ+LS+ ERRSP  +QDCSHWCLPGVPD WNE+LYAELLVK Y
Sbjct  559  PSIYRKQHLSDAERRSPKSFQDCSHWCLPGVPDAWNEVLYAELLVKLY  606



>ref|XP_003625280.1| hypothetical protein MTR_7g093450 [Medicago truncatula]
 gb|AES81498.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=601

 Score =   390 bits (1002),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y  +VE FV+PFLVQEWE+ DK G KK ETLRLDLV  S+D+YK+ADI+VFNTGHWWT
Sbjct  366  KDYKFSVELFVSPFLVQEWEMPDKNGTKK-ETLRLDLVGRSSDQYKDADIIVFNTGHWWT  424

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFR+A+TTWGRWVD ++NP K+ VLFRGYSASHFS
Sbjct  425  HDKTSKGKDYYQEGSHVYDELNVLEAFRRAITTWGRWVDANVNPTKSIVLFRGYSASHFS  484

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CDHE  PI NE YLT YPPKM VLE+VL  MK  VSYLN+TRMTDFRKD H
Sbjct  485  GGQWNSGGQCDHETAPIDNEKYLTEYPPKMRVLEKVLKNMKNPVSYLNITRMTDFRKDGH  544

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS EER+SPLR+QDCSHWCLPGVPD WNE+LYAELL+++Y+
Sbjct  545  PSIYRKQNLSPEERKSPLRFQDCSHWCLPGVPDAWNEILYAELLMREYR  593



>gb|KJB76673.1| hypothetical protein B456_012G100000 [Gossypium raimondii]
Length=652

 Score =   392 bits (1006),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 201/230 (87%), Gaps = 4/230 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN T+EFFV+PFLV+EWE+ DK G KK ETLRLDLV  S+D+YK+ADIL+FNTGHWWT
Sbjct  413  KDYNFTIEFFVSPFLVREWEMPDKTGAKK-ETLRLDLVGKSSDQYKSADILIFNTGHWWT  471

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSHVY+ELNV+EAFRKALTTW RWVD  +NP KT V FRGYSASHFS
Sbjct  472  HEKTSKGKDYYQEGSHVYNELNVLEAFRKALTTWARWVDASVNPMKTMVFFRGYSASHFS  531

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGGACD E  PIKNETYL PYPPKM VLE VL GMKT V+YLN+TR+TDFRKD H
Sbjct  532  GGQWNSGGACDSETRPIKNETYLKPYPPKMLVLESVLKGMKTHVTYLNITRLTDFRKDGH  591

Query  262  PSMYR---KQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YR   KQ L E+ER +PL+YQDCSHWCLPGVPD WNELLYAELLVK+
Sbjct  592  PSIYRKHLKQTLPEDERVAPLKYQDCSHWCLPGVPDSWNELLYAELLVKE  641



>ref|XP_008240911.1| PREDICTED: protein trichome birefringence [Prunus mume]
Length=618

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLV+EWE+ +K G K+ ETLRLDLV  S+D YK+ADI++FNTGHWWT
Sbjct  379  KDYNCTVEFFVSPFLVREWEMPEKDGSKR-ETLRLDLVGRSSDLYKDADIVIFNTGHWWT  437

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD  INP K+ V FRGYSASHFS
Sbjct  438  HEKTSKGKDYYQEGSHVYGELNVLEAFRKALTTWARWVDAKINPRKSIVFFRGYSASHFS  497

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PI NETYL PYPPKM VLE+VL  MKT V+YLN+TRMTDFRKD H
Sbjct  498  GGQWNSGGQCDSETLPISNETYLRPYPPKMLVLEKVLRNMKTHVTYLNITRMTDFRKDGH  557

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQY  119
            PS+YRKQ+LS  ERRSP  +QDCSHWCLPGVPD WNE+LYAELLVK Y
Sbjct  558  PSIYRKQHLSNAERRSPKSFQDCSHWCLPGVPDAWNEVLYAELLVKLY  605



>ref|XP_010058223.1| PREDICTED: protein trichome birefringence [Eucalyptus grandis]
 gb|KCW90320.1| hypothetical protein EUGRSUZ_A02463 [Eucalyptus grandis]
Length=643

 Score =   389 bits (999),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+ TVEFFV+PFLV+EWE+ DK G KK ETLRLDLV  S+D+YK+ADI++FNTGHWWT
Sbjct  415  KDYDFTVEFFVSPFLVREWEMPDKNGSKK-ETLRLDLVGRSSDQYKDADIIIFNTGHWWT  473

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  474  HDKTSKGKDYYQEGSHVYGELNVLEAFRKALTTWGRWVDANVNPMKSIVFFRGYSDSHFS  533

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CDHE +PIKN+TYL  YPPKM VLE+V  GMKT V+YLNVT+MTD+RKD H
Sbjct  534  GGQWNSGGQCDHETQPIKNDTYLRQYPPKMIVLEKVFRGMKTHVNYLNVTKMTDYRKDGH  593

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRKQ+L++ ERRSPLR+QDCSHWCLPGVPD WNE+LYAELLVK  QK
Sbjct  594  PSIYRKQHLTDVERRSPLRFQDCSHWCLPGVPDAWNEILYAELLVKLNQK  643



>ref|XP_004493599.1| PREDICTED: uncharacterized protein LOC101511851 [Cicer arietinum]
Length=617

 Score =   388 bits (997),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y  +VE FV+PFLVQEWE+ DK G KK ETLRLDLV  S+D+YK+ADI+VFNTGHWWT
Sbjct  382  QDYKFSVELFVSPFLVQEWEMPDKNGTKK-ETLRLDLVGRSSDQYKDADIIVFNTGHWWT  440

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFR+A+TTW RWVD ++NP+K+ VLFRGYSASHFS
Sbjct  441  HDKTSKGKDYYQEGSHVYDELNVLEAFRRAITTWSRWVDANVNPSKSIVLFRGYSASHFS  500

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PI NE YLT YPPKM VLE+VLN MKT V+YLN+TRMTDFRKD H
Sbjct  501  GGQWNSGGQCDSETAPIDNEKYLTEYPPKMRVLEKVLNNMKTHVTYLNITRMTDFRKDGH  560

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRK  LS EE++SPLR+QDCSHWCLPGVPD WNE+LYAELL+++Y+   +K
Sbjct  561  PSIYRKHNLSPEEQKSPLRFQDCSHWCLPGVPDTWNEILYAELLIREYRNQQQK  614



>ref|XP_002323329.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
 gb|EEF05090.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
Length=592

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 198/227 (87%), Gaps = 1/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWE+ +K G KK ETLRLDLV  S+ +YK AD++VFNTGHWWT
Sbjct  357  KDYNCTVEFFVSPFLVQEWELPEKDGSKK-ETLRLDLVGRSSSQYKGADVIVFNTGHWWT  415

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD ++NP K+ VLFRGYSASHFS
Sbjct  416  HDKTSKGKDYYQEGSHVYDELNVLEAFRKALTTWARWVDANVNPMKSLVLFRGYSASHFS  475

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD EVEPIKN TYL  YPPKM VLE+VL  MKT V YLNVT+MTDFRKD H
Sbjct  476  GGQWNSGGQCDSEVEPIKNVTYLREYPPKMLVLEKVLRNMKTHVRYLNVTQMTDFRKDGH  535

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ LS EER+SPL +QDCSHWCLPGVPD WNE+LYAELLV +
Sbjct  536  PSVYRKQNLSPEERKSPLLFQDCSHWCLPGVPDAWNEILYAELLVNE  582



>ref|XP_011005287.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=624

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 203/238 (85%), Gaps = 1/238 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCT+EFFV+PFLVQEWE+ +K G  K ETLRLDLV  S+ +YK+ADI+VFNTGHWWT
Sbjct  388  KDYNCTIEFFVSPFLVQEWEMHEKDGSMK-ETLRLDLVGRSSSQYKSADIIVFNTGHWWT  446

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY+ELNV+EAFRKALTTW RWVD +++P K+ V FRGYSASHFS
Sbjct  447  HDKTSKGKDYYQEGSHVYNELNVLEAFRKALTTWARWVDANVDPMKSLVFFRGYSASHFS  506

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD EVEPIKN T+L  YPPKM VLE+VL  MKT V+YLNVT+MTD+RKD H
Sbjct  507  GGQWNSGGQCDSEVEPIKNVTFLRQYPPKMLVLEKVLRNMKTHVTYLNVTQMTDYRKDGH  566

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKKAGHR  89
            PS+YRKQ LS EER+SPL +QDCSHWCLPGVPD WNE+LYA LLV + QK   +  HR
Sbjct  567  PSVYRKQKLSPEERKSPLHFQDCSHWCLPGVPDAWNEILYANLLVNEKQKQQAQKRHR  624



>ref|XP_010917266.1| PREDICTED: protein trichome birefringence [Elaeis guineensis]
Length=678

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE+    G K KETLRLD +  S+ +YKNAD++VFNTGHWWT
Sbjct  448  KDYNCSVEFFRSPFLVQEWEMPVSNG-KTKETLRLDTIERSSPRYKNADVIVFNTGHWWT  506

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEG HVY ELNVVEAF KAL TW +WVDT++NP KT V FRGYSASHFS
Sbjct  507  HEKTSKGKDYYQEGDHVYGELNVVEAFHKALNTWAKWVDTNVNPKKTLVFFRGYSASHFS  566

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPIKN+ YL+ YPPKM VLE+V+ GMKT VSYLN+TRMTD+RKDAH
Sbjct  567  GGQWNSGGQCDKETEPIKNKKYLSTYPPKMLVLEKVIKGMKTPVSYLNITRMTDYRKDAH  626

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ L+EEERRSP RYQDCSHWCLPGVPD WNELLYA+LL+KQ+Q
Sbjct  627  PSIYRKQNLTEEERRSPERYQDCSHWCLPGVPDSWNELLYAQLLIKQHQ  675



>gb|ABK28553.1| unknown [Arabidopsis thaliana]
Length=557

 Score =   384 bits (987),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF +PFLVQEWE+ +K G KK ETLRLDLV  S+++YK ADILVFNTGHWWT
Sbjct  314  KDYNCTVEFFASPFLVQEWEVTEKNGTKK-ETLRLDLVGKSSEQYKGADILVFNTGHWWT  372

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS V+ +L+V EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  373  HEKTSKGEDYYQEGSTVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  432

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPY  KME+LERVL GMKT V+YLN+TR+TD+RKDAH
Sbjct  433  GGQWNAGGACDDETEPIKNETYLTPYMLKMEILERVLRGMKTPVTYLNITRLTDYRKDAH  492

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ LS EE +SPL YQDCSHWCLPGVPD WNE+ YAELLVK  Q   K+
Sbjct  493  PSIYRKQKLSAEESKSPLLYQDCSHWCLPGVPDSWNEIFYAELLVKLDQLGGKR  546



>ref|NP_187813.1| protein TRICHOME BIREFRINGENCE-LIKE 1 [Arabidopsis thaliana]
 sp|Q9LHL6.1|TBL1_ARATH RecName: Full=Protein trichome birefringence-like 1 [Arabidopsis 
thaliana]
 gb|AAG51057.1|AC069473_19 unknown protein; 38990-36982 [Arabidopsis thaliana]
 dbj|BAB03118.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65935.1| unknown [Arabidopsis thaliana]
 gb|AEE75143.1| uncharacterized protein AT3G12060 [Arabidopsis thaliana]
Length=556

 Score =   384 bits (987),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF +PFLVQEWE+ +K G KK ETLRLDLV  S+++YK ADILVFNTGHWWT
Sbjct  314  KDYNCTVEFFASPFLVQEWEVTEKNGTKK-ETLRLDLVGKSSEQYKGADILVFNTGHWWT  372

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS V+ +L+V EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  373  HEKTSKGEDYYQEGSTVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  432

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPY  KME+LERVL GMKT V+YLN+TR+TD+RKDAH
Sbjct  433  GGQWNAGGACDDETEPIKNETYLTPYMLKMEILERVLRGMKTPVTYLNITRLTDYRKDAH  492

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ LS EE +SPL YQDCSHWCLPGVPD WNE+ YAELLVK  Q   K+
Sbjct  493  PSIYRKQKLSAEESKSPLLYQDCSHWCLPGVPDSWNEIFYAELLVKLDQLGGKR  546



>ref|XP_011039468.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=619

 Score =   385 bits (990),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 198/227 (87%), Gaps = 1/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLVQEWE+ +K G KK ETLRLDLV  S+ +YK+AD++VFNTGHWWT
Sbjct  384  KDYNCTVEFFVSPFLVQEWELPEKDGSKK-ETLRLDLVGRSSSQYKDADVIVFNTGHWWT  442

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD ++NP K+ VLFRGYSASHFS
Sbjct  443  HDKTSKGKDYYQEGSHVYGELNVLEAFRKALTTWARWVDANVNPTKSLVLFRGYSASHFS  502

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD EVEPIKN TYL  YPPKM VLE+VL  MKT V YLNVT+MTDFRKD H
Sbjct  503  GGQWNSGGQCDSEVEPIKNVTYLREYPPKMLVLEKVLRNMKTHVRYLNVTQMTDFRKDGH  562

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ LS  ER+SPL +QDCSHWCLPGVPD WNE+LYAELLV +
Sbjct  563  PSVYRKQNLSPVERKSPLLFQDCSHWCLPGVPDAWNEILYAELLVNE  609



>ref|XP_002882764.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 202/234 (86%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF  PFLVQEWE+ +  G KK ETLRLDLV  S+++YK ADILVFNTGHWWT
Sbjct  317  KDYNCTVEFFALPFLVQEWEVTENNGTKK-ETLRLDLVGKSSEQYKGADILVFNTGHWWT  375

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+V+ +L+V EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  376  HEKTSKGEDYYQEGSNVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  435

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPY  KME+LERVL+GMKT V+YLN+TR+TD+RKDAH
Sbjct  436  GGQWNAGGACDDETEPIKNETYLTPYMLKMEILERVLSGMKTPVTYLNITRLTDYRKDAH  495

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ LS EE +SPL YQDCSHWCLPGVPD WNE+LYAE+LVK  Q   ++
Sbjct  496  PSIYRKQKLSAEESKSPLLYQDCSHWCLPGVPDSWNEILYAEILVKLDQLGGRR  549



>ref|XP_009391441.1| PREDICTED: protein trichome birefringence-like [Musa acuminata 
subsp. malaccensis]
Length=715

 Score =   388 bits (996),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +++NC+VEFF +PFLVQEWE+    G KKKETLRLD++  S+ KYK+AD+++FNTGHWWT
Sbjct  486  KDFNCSVEFFRSPFLVQEWEMPVSNG-KKKETLRLDIIERSSSKYKDADVIIFNTGHWWT  544

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEG+H+Y ELNVVEAF KAL TW +WVDT++NP K+ V FRGYSASHFS
Sbjct  545  HEKTSKGKDYYQEGNHIYSELNVVEAFHKALDTWSKWVDTNVNPKKSLVFFRGYSASHFS  604

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPIKNETYL+ YP KM VLE V+ GMKT  SYLN+TRMTD+RKDAH
Sbjct  605  GGQWNSGGQCDKETEPIKNETYLSSYPSKMTVLESVIKGMKTPASYLNITRMTDYRKDAH  664

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ+L+EEERRSP RYQDCSHWCLPGVPD WNELLYA+L++KQ+Q
Sbjct  665  PSIYRKQHLTEEERRSPERYQDCSHWCLPGVPDSWNELLYAQLIIKQHQ  713



>ref|XP_003535115.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN35654.1| hypothetical protein glysoja_041356 [Glycine soja]
Length=588

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN +VE FV+PFLVQEWE+  K G KK ETLRLDLV  S+ +YKNADI++FNTGHWWT
Sbjct  353  KDYNFSVELFVSPFLVQEWEVQIKNGTKK-ETLRLDLVGKSSVQYKNADIIIFNTGHWWT  411

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFR+A+TTW RW+D +INP+K+ V FRGYSASHFS
Sbjct  412  HDKTSKGKDYYQEGSHVYDELNVLEAFRRAITTWSRWIDANINPSKSMVFFRGYSASHFS  471

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PIKNE YL  YPPKM VLE+VL  MKT V+YLNVT+MTDFRKD H
Sbjct  472  GGQWNSGGQCDSETVPIKNEKYLREYPPKMRVLEKVLKNMKTHVTYLNVTKMTDFRKDGH  531

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS EER+SPLRYQDCSHWCLPGVPD WNE+LYAELL+K+YQ
Sbjct  532  PSIYRKQNLSPEERKSPLRYQDCSHWCLPGVPDAWNEILYAELLLKEYQ  580



>ref|XP_002308359.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
 gb|EEE91882.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
Length=611

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 202/238 (85%), Gaps = 1/238 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCT++FFV+PFLVQEWE+ +K G  K ETLRLDLV  S+ +YK+ADI+VFNTGHWWT
Sbjct  375  KDYNCTIDFFVSPFLVQEWEMHEKDGSMK-ETLRLDLVGRSSSQYKSADIIVFNTGHWWT  433

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEG+HVY+ELNV+EAFRKALTTW RWVD +++P K+ V FRGYSASHFS
Sbjct  434  HDKTSKGKDYYQEGNHVYNELNVLEAFRKALTTWARWVDANVDPMKSLVFFRGYSASHFS  493

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPIKN TYL  YPPKM VLE+VL  MKT V+YLNVT+MTD+RKD H
Sbjct  494  GGQWNSGGQCDSEAEPIKNVTYLRQYPPKMLVLEKVLRNMKTHVTYLNVTQMTDYRKDGH  553

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKKAGHR  89
            PS+YRKQ LS EER+SPL +QDCSHWCLPGVPD WNE+LYA LLV + QK   +  HR
Sbjct  554  PSVYRKQNLSPEERKSPLHFQDCSHWCLPGVPDAWNEILYANLLVNEKQKQQAQKRHR  611



>emb|CDY72094.1| BnaCnng75930D [Brassica napus]
Length=535

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF +PFLVQEWE++DK G KK ETLRLD+V  S+++YK ADILVFNTGHWWT
Sbjct  296  KDYNCTVEFFASPFLVQEWEVSDKNGTKK-ETLRLDVVGKSSEQYKGADILVFNTGHWWT  354

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEGS+V+ +L+V EAFRKALTTWG+WVD ++NP K+ V FRGYS SHFS
Sbjct  355  HDKTSKGEDYYQEGSNVHPKLDVDEAFRKALTTWGQWVDENVNPKKSLVFFRGYSPSHFS  414

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPYP KM +LERVL GMK+ V+YLN+TR+TD+RKDAH
Sbjct  415  GGQWNAGGACDDETEPIKNETYLTPYPSKMLILERVLKGMKSPVTYLNITRLTDYRKDAH  474

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LS +ER+SPL YQDCSHWCLPGVPD WNE+LYAE+LVK +Q
Sbjct  475  PSVYRKHKLSAKERKSPLLYQDCSHWCLPGVPDSWNEILYAEMLVKLHQ  523



>ref|XP_010486896.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=546

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+CTVEF+ +PFLV+EWEI DK G KK ETLRLDLV  S+++YK ADILVFNTGHWWT
Sbjct  310  KDYSCTVEFYASPFLVREWEIMDKNGMKK-ETLRLDLVGKSSEQYKGADILVFNTGHWWT  368

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEGS+VY +L+V EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  369  HDKTSKGEDYYQEGSNVYRKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  428

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYL PY  KME+LERVL GMK  V+YLN+TR+TD+RKDAH
Sbjct  429  GGQWNAGGACDDETEPIKNETYLAPYMLKMEILERVLRGMKAPVTYLNITRLTDYRKDAH  488

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ L+ EE +SPL YQDCSHWCLPGVPD WNE+LYAELLVK  Q   K+
Sbjct  489  PSIYRKQKLTAEESKSPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQLGGKR  542



>ref|XP_010498482.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=552

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEF+ +PFLV+EWEI DK G KK ETLRLDLV  S+++YK ADILVFNTGHWWT
Sbjct  310  KDYNCTVEFYASPFLVREWEIMDKNGTKK-ETLRLDLVGKSSEQYKGADILVFNTGHWWT  368

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEGS+VY +L+V EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  369  HDKTSKGEDYYQEGSNVYPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  428

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGAC+ E EPIKNETYL PY  KME+LERVL GMK  V+YLN+TR+TD+RKDAH
Sbjct  429  GGQWNAGGACNDETEPIKNETYLAPYMLKMEILERVLKGMKAPVTYLNITRLTDYRKDAH  488

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ L+ EE +SPL YQDCSHWCLPGVPD WNE+LYAELLVK  Q   KK
Sbjct  489  PSIYRKQKLTAEESKSPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQLGGKK  542



>emb|CDY08459.1| BnaA05g26950D [Brassica napus]
Length=580

 Score =   381 bits (979),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF +PFLVQEWE+ DK G KK ETLRLD+V  S+++YK ADILVFNTGHWWT
Sbjct  309  KDYNCTVEFFASPFLVQEWELTDKNGTKK-ETLRLDVVGKSSEQYKGADILVFNTGHWWT  367

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEGS+V+ +L+V EAF+KALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  368  HDKTSKGEDYYQEGSNVHPKLDVDEAFKKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  427

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPYP KM +LE VL GMKT V+YLN+TR+TD+RKDAH
Sbjct  428  GGQWNAGGACDDETEPIKNETYLTPYPSKMLILETVLKGMKTPVTYLNITRLTDYRKDAH  487

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LS +ER+SPL YQDCSHWCLPGVPD WNE+LYAE+LVK +Q
Sbjct  488  PSVYRKHKLSAKERKSPLLYQDCSHWCLPGVPDSWNEILYAEMLVKLHQ  536



>ref|XP_006575204.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN41712.1| hypothetical protein glysoja_041257 [Glycine soja]
Length=596

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 199/234 (85%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN +VE FV+PFLVQEWE+  K G KK ETLRLDLV  S+ +YKNADI++FNTGHWWT
Sbjct  363  KDYNFSVELFVSPFLVQEWEVQVKNGTKK-ETLRLDLVGKSSVQYKNADIIIFNTGHWWT  421

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFR+A+TTW RW+D +IN +K+ V FRGYSASHFS
Sbjct  422  HDKTSKGKDYYQEGSHVYDELNVLEAFRRAITTWSRWIDANINQSKSMVFFRGYSASHFS  481

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PIKNE YL  YPPKM VLE+VL  MK  V+YLNVT+MTDFRKD H
Sbjct  482  GGQWNSGGQCDSETVPIKNEKYLREYPPKMRVLEKVLKNMKAHVTYLNVTKMTDFRKDGH  541

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ LS EER+SPLRYQDCSHWCLPGVPD WNE+LYAELL+KQYQ   K+
Sbjct  542  PSIYRKQNLSPEERKSPLRYQDCSHWCLPGVPDAWNEILYAELLLKQYQNQQKR  595



>ref|XP_006407376.1| hypothetical protein EUTSA_v10020451mg [Eutrema salsugineum]
 gb|ESQ48829.1| hypothetical protein EUTSA_v10020451mg [Eutrema salsugineum]
Length=548

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+CTVEF+ +PFLVQEWE++DK G KK ETLRLDL+  S+++YK AD+LVFNTGHWWT
Sbjct  307  KDYDCTVEFYASPFLVQEWEVSDKNGTKK-ETLRLDLMGKSSEQYKGADVLVFNTGHWWT  365

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEG++VY +L+V EAF+KALTTWG+WVD ++   KT V FRGYS SHFS
Sbjct  366  HDKTSKGEDYYQEGNNVYPKLDVDEAFQKALTTWGQWVDKNVKQKKTLVFFRGYSPSHFS  425

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPYPPKME+LERV+ GMKT V+YLN+TR+TD+RKDAH
Sbjct  426  GGQWNAGGACDDETEPIKNETYLTPYPPKMEILERVIKGMKTPVTYLNITRLTDYRKDAH  485

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS EE  SPL YQDCSHWCLPGVPD WNE+LYAELLVK +Q
Sbjct  486  PSIYRKQKLSLEESESPLLYQDCSHWCLPGVPDSWNEILYAELLVKLHQ  534



>ref|XP_009146650.1| PREDICTED: protein trichome birefringence-like 1 [Brassica rapa]
Length=535

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF +PFLVQEWE+ DK G KK ETLRLD+V  S+++YK ADILVFNTGHWWT
Sbjct  296  KDYNCTVEFFASPFLVQEWELTDKNGTKK-ETLRLDVVGKSSEQYKGADILVFNTGHWWT  354

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEG++VY +L+V EAF KALTTWG+WVD ++NP K+FV FRGYS SHFS
Sbjct  355  HDKTSKGEDYYQEGNNVYPKLDVDEAFGKALTTWGQWVDKNVNPKKSFVFFRGYSPSHFS  414

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPYP KM +LE VL GMKT V+YLN+TR+TD+RKDAH
Sbjct  415  GGQWNAGGACDDETEPIKNETYLTPYPSKMLILETVLKGMKTPVTYLNITRLTDYRKDAH  474

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LS +ER+SPL YQDCSHWCLPGVPD WNE+LYAE+LVK +Q
Sbjct  475  PSVYRKHKLSAKERKSPLLYQDCSHWCLPGVPDSWNEILYAEMLVKLHQ  523



>ref|XP_006299462.1| hypothetical protein CARUB_v10015627mg [Capsella rubella]
 gb|EOA32360.1| hypothetical protein CARUB_v10015627mg [Capsella rubella]
Length=546

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 201/234 (86%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEF+ +PFLV+EWE+ DK G KK ETLRLDLV  S+++Y+ ADILVFNTGHWWT
Sbjct  310  KDYNCTVEFYASPFLVREWEVMDKNGTKK-ETLRLDLVGKSSEQYRGADILVFNTGHWWT  368

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEG ++Y +L+V EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  369  HEKTSKGEDYYQEGRNLYPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  428

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPY  KM++LERVL GMK  V+YLN+TR+TD+RKDAH
Sbjct  429  GGQWNAGGACDDETEPIKNETYLTPYMLKMQILERVLRGMKAPVTYLNITRLTDYRKDAH  488

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ LS EE +SPL YQDCSHWCLPGVPD WNE+LYAELLVK  Q   K+
Sbjct  489  PSIYRKQKLSAEESKSPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQLGGKR  542



>ref|NP_001057100.1| Os06g0207500 [Oryza sativa Japonica Group]
 dbj|BAF19014.1| Os06g0207500, partial [Oryza sativa Japonica Group]
Length=720

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 198/228 (87%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KKKETLRLD+V  S+ KYK+AD L+FNTGHWWTH
Sbjct  490  DYNCSVEFFRSPFLVQEWEMKVSNG-KKKETLRLDIVEQSSPKYKDADFLIFNTGHWWTH  548

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS G+DYYQEG+HVY ELNVV+AF KAL TW RW+D ++NP KT VLFRGYSASHFSG
Sbjct  549  EKTSLGKDYYQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSG  608

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPI+NE YL+ YPPKM +LE V++ MKT V YLN+TRMTD+RKDAHP
Sbjct  609  GQWNSGGSCDKETEPIRNEQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHP  668

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRK+ L+E+ERRSP RYQDCSHWCLPGVPD WNELLYA+LL+KQ+Q
Sbjct  669  SIYRKRNLTEDERRSPERYQDCSHWCLPGVPDSWNELLYAQLLIKQHQ  716



>ref|XP_006656749.1| PREDICTED: mucin-19-like [Oryza brachyantha]
Length=802

 Score =   386 bits (991),  Expect = 8e-125, Method: Composition-based stats.
 Identities = 171/228 (75%), Positives = 198/228 (87%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KKKETLRLD+V  S+ KYK+AD L+FNTGHWWTH
Sbjct  572  DYNCSVEFFRSPFLVQEWEMKVSNG-KKKETLRLDIVEQSSPKYKDADFLIFNTGHWWTH  630

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS G+DYYQEG+HVY ELNVV+AF KAL TW RW+D ++NP KT VLFRGYSASHFSG
Sbjct  631  EKTSLGKDYYQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSG  690

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPI+NE YL+ YPPKM +LE V++ MKT V YLN+TRMTD+RKDAHP
Sbjct  691  GQWNSGGSCDKETEPIRNEQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHP  750

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRK+ L+EEERRSP RYQDCSHWCLPGVPD WNELLYAELL+KQ+Q
Sbjct  751  SIYRKRNLTEEERRSPERYQDCSHWCLPGVPDSWNELLYAELLIKQHQ  798



>ref|XP_010464957.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=547

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 200/234 (85%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEF+ +PFLV+EWEI DK G KK ETLRLDLV  S+++YK ADILVFNTGHWWT
Sbjct  311  KDYNCTVEFYASPFLVREWEIMDKNGTKK-ETLRLDLVGKSSEQYKGADILVFNTGHWWT  369

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEGS+VY +L+V EAFRKALTTWGRWVD ++NP K+ V FRGYS SHFS
Sbjct  370  HDKTSKGEDYYQEGSNVYPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFS  429

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYL P   KME+LERVL GMK  V++LN+TR+TD+RKDAH
Sbjct  430  GGQWNAGGACDDETEPIKNETYLAPNMLKMEILERVLRGMKAPVTFLNITRLTDYRKDAH  489

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YRKQ L+ EE +SPL YQDCSHWCLPGVPD WNE+LYAELLVK  Q   K+
Sbjct  490  PSIYRKQKLTAEESKSPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQLGGKR  543



>ref|XP_010932482.1| PREDICTED: protein trichome birefringence-like 1 [Elaeis guineensis]
Length=677

 Score =   382 bits (980),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE+    G K KETLRLD++  S+ KYK+AD+LVFNTGHWWT
Sbjct  447  KDYNCSVEFFRSPFLVQEWEMPVSNG-KTKETLRLDIIERSSPKYKDADVLVFNTGHWWT  505

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEG HVY ELNVVEAF KALTTW +WVDT++NP KT V FRGYSASHFS
Sbjct  506  HEKTSKGKDYYQEGDHVYSELNVVEAFHKALTTWAKWVDTNVNPKKTLVFFRGYSASHFS  565

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C +E EPIKNE YL PYPPKM+VLE V+  MKT VSYLN+TRMTD+RKDAH
Sbjct  566  GGQWNSGGQCHNETEPIKNEKYLYPYPPKMQVLETVIKEMKTPVSYLNITRMTDYRKDAH  625

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ L+EEER+SP  YQDCSHWCLPGVPD WNELLY +LL+KQ Q
Sbjct  626  PSIYRKQNLTEEERKSPEMYQDCSHWCLPGVPDSWNELLYVQLLIKQRQ  674



>gb|KFK38572.1| hypothetical protein AALP_AA3G130900 [Arabis alpina]
Length=530

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 201/236 (85%), Gaps = 3/236 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+CTVEF+ +PFLVQEWE+ DK G KK ETLRLDLV  S+ +YK ADILVFNTGHWWT
Sbjct  288  KDYDCTVEFYASPFLVQEWEVEDKNGTKK-ETLRLDLVGKSSKQYKGADILVFNTGHWWT  346

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VY +L+  EAFRKALTTW RW+D ++NP K+ V FRG + SHFS
Sbjct  347  HEKTSKGEDYYQEGSNVYPKLDADEAFRKALTTWSRWIDKNVNPKKSLVFFRGLAPSHFS  406

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPYP KME+LERVL GMKT V+Y+N+TR+TD+RKDAH
Sbjct  407  GGQWNAGGACDDETEPIKNETYLTPYPSKMEILERVLRGMKTPVTYINITRLTDYRKDAH  466

Query  262  PSMY--RKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+Y  RKQ LS EE +SPL YQDCSHWCLPGVPD WNE+LYAELLVK  Q S K+
Sbjct  467  PSIYRKRKQKLSVEESKSPLLYQDCSHWCLPGVPDSWNEILYAELLVKLNQLSGKR  522



>ref|XP_003553434.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN45423.1| hypothetical protein glysoja_028430 [Glycine soja]
Length=615

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+ +VE FV+PFLVQE E+ DK G KK ETLRLDLV  S+ +YK+ADILVFNTGHWWT
Sbjct  380  KDYHFSVELFVSPFLVQEGEMTDKNGTKK-ETLRLDLVGKSSSQYKDADILVFNTGHWWT  438

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFR+ALTTW +WVD +INP+KT V FRGYSASHFS
Sbjct  439  HDKTSKGQDYYQEGSHVYAELNVLEAFRRALTTWSKWVDANINPSKTMVFFRGYSASHFS  498

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PI NE YLT YP KM+VLE+VL  MKT V+Y N+TRMTDFRKD H
Sbjct  499  GGQWNSGGQCDSETDPIDNEKYLTEYPDKMKVLEKVLKNMKTHVTYQNITRMTDFRKDGH  558

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS EER+SPLR+QDCSHWCLPGVPD WNE+LYAELL+++YQ
Sbjct  559  PSIYRKQNLSPEERKSPLRFQDCSHWCLPGVPDLWNEVLYAELLLREYQ  607



>ref|XP_009369426.1| PREDICTED: protein trichome birefringence [Pyrus x bretschneideri]
Length=628

 Score =   379 bits (972),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 196/226 (87%), Gaps = 1/226 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLV+EWE+ +K G K+ ETLRLDLV  S++ YK+AD+++FNTGHWWT
Sbjct  388  KDYNCTVEFFVSPFLVREWEMPEKDGSKR-ETLRLDLVGRSSELYKDADVVIFNTGHWWT  446

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD  ++P K+ + FRGYSASHFS
Sbjct  447  HEKTSKGKDYYQEGSHVYGELNVLEAFRKALTTWARWVDAKVDPKKSIIFFRGYSASHFS  506

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PI NE+YL PY PKM VLE+VL  MKT V+YLN+TRMTDFRKD H
Sbjct  507  GGQWNSGGQCDSETVPIFNESYLRPYLPKMVVLEKVLRNMKTHVTYLNITRMTDFRKDGH  566

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            PS+YRKQ LSEEERRSP  +QDCSHWCLPGVPD WNE+LYAELLVK
Sbjct  567  PSIYRKQKLSEEERRSPTSFQDCSHWCLPGVPDAWNEVLYAELLVK  612



>ref|XP_007145701.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
 gb|ESW17695.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
Length=670

 Score =   380 bits (975),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 198/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN + E FV+PFLVQEWE+  K G KK ETLRLDLV  S+ +YKNADI++FNTGHWWT
Sbjct  435  KDYNFSAELFVSPFLVQEWEVQVKNGTKK-ETLRLDLVGKSSVQYKNADIIIFNTGHWWT  493

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY+ELNV+EAFRKA+TTW RW+D +++ +K+ + FRGYSASHFS
Sbjct  494  HDKTSKGKDYYQEGSHVYNELNVLEAFRKAITTWSRWIDANVDSSKSMIFFRGYSASHFS  553

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PIKNE YL  YPPKM VLE+VL  MKTQV+YLNVT+MTD RKD H
Sbjct  554  GGQWNSGGQCDSETVPIKNEKYLKEYPPKMRVLEKVLKNMKTQVTYLNVTKMTDLRKDGH  613

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS EER+SPLR+QDCSHWCLPGVPD WNE+LYAELL+KQYQ
Sbjct  614  PSIYRKQNLSAEERKSPLRFQDCSHWCLPGVPDTWNEILYAELLLKQYQ  662



>ref|XP_003560946.2| PREDICTED: protein trichome birefringence-like 1 [Brachypodium 
distachyon]
Length=829

 Score =   384 bits (986),  Expect = 7e-124, Method: Composition-based stats.
 Identities = 164/228 (72%), Positives = 199/228 (87%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KK ETLRLD+V  S+ KYK+AD ++FNTGHWWTH
Sbjct  599  DYNCSVEFFRSPFLVQEWEMRVSNGNKK-ETLRLDIVEQSSPKYKDADFIIFNTGHWWTH  657

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKT+ G+DYYQEG+H+Y ELNVV+AFRKAL TW +W+D ++NP KT V+FRGYSASHFSG
Sbjct  658  EKTALGKDYYQEGNHIYSELNVVDAFRKALVTWSKWIDANVNPKKTTVMFRGYSASHFSG  717

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPIKNE YL+ YPPKM +LE V++ MKT V YLN+TR+TD+RKDAHP
Sbjct  718  GQWNSGGSCDKETEPIKNEQYLSTYPPKMSILEDVIHKMKTPVVYLNITRLTDYRKDAHP  777

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ+L+EEERRSP RYQDCSHWCLPGVPD WNEL+YA+LL++Q+Q
Sbjct  778  SIYRKQHLTEEERRSPERYQDCSHWCLPGVPDSWNELVYAQLLIRQHQ  825



>ref|XP_003520540.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN07442.1| hypothetical protein glysoja_012740 [Glycine soja]
Length=622

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 202/237 (85%), Gaps = 3/237 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+Y+ +VE FV+PFLVQE E+ DK G KK ETLRLDLV  S+ +YK+ADILVFNTGHWWT
Sbjct  387  EDYHFSVELFVSPFLVQEGEMTDKNGTKK-ETLRLDLVGKSSSQYKDADILVFNTGHWWT  445

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEG+HVY ELNV+EAFR+ALTTW RWVD +INP+KT V FRGYSASHFS
Sbjct  446  HDKTSKGQDYYQEGNHVYSELNVLEAFRRALTTWSRWVDANINPSKTTVFFRGYSASHFS  505

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PI NE YLT YP KM+VLE+VL  MKT+V+Y N+TRMTDFRKD H
Sbjct  506  GGQWNSGGQCDSETDPIDNEKYLTEYPDKMKVLEKVLKNMKTRVTYQNITRMTDFRKDGH  565

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQY--QKSSKKA  98
            PS+YRKQ LS EE +SPLR+QDCSHWCLPGVPD WNE+LYAELL+++Y  Q   KKA
Sbjct  566  PSIYRKQNLSPEELKSPLRFQDCSHWCLPGVPDLWNEILYAELLLREYRNQHEQKKA  622



>dbj|BAD35858.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAD35885.1| lustrin A-like [Oryza sativa Japonica Group]
 gb|EAZ00091.1| hypothetical protein OsI_22096 [Oryza sativa Indica Group]
Length=847

 Score =   384 bits (986),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 198/228 (87%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KKKETLRLD+V  S+ KYK+AD L+FNTGHWWTH
Sbjct  617  DYNCSVEFFRSPFLVQEWEMKVSNG-KKKETLRLDIVEQSSPKYKDADFLIFNTGHWWTH  675

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS G+DYYQEG+HVY ELNVV+AF KAL TW RW+D ++NP KT VLFRGYSASHFSG
Sbjct  676  EKTSLGKDYYQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSG  735

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPI+NE YL+ YPPKM +LE V++ MKT V YLN+TRMTD+RKDAHP
Sbjct  736  GQWNSGGSCDKETEPIRNEQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHP  795

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRK+ L+E+ERRSP RYQDCSHWCLPGVPD WNELLYA+LL+KQ+Q
Sbjct  796  SIYRKRNLTEDERRSPERYQDCSHWCLPGVPDSWNELLYAQLLIKQHQ  843



>gb|EAZ36212.1| hypothetical protein OsJ_20530 [Oryza sativa Japonica Group]
Length=847

 Score =   383 bits (984),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 198/228 (87%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KKKETLRLD+V  S+ KYK+AD L+FNTGHWWTH
Sbjct  617  DYNCSVEFFRSPFLVQEWEMKVSNG-KKKETLRLDIVEQSSPKYKDADFLIFNTGHWWTH  675

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS G+DYYQEG+HVY ELNVV+AF KAL TW RW+D ++NP KT VLFRGYSASHFSG
Sbjct  676  EKTSLGKDYYQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSG  735

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPI+NE YL+ YPPKM +LE V++ MKT V YLN+TRMTD+RKDAHP
Sbjct  736  GQWNSGGSCDKETEPIRNEQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHP  795

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRK+ L+E+ERRSP RYQDCSHWCLPGVPD WNELLYA+LL+KQ+Q
Sbjct  796  SIYRKRNLTEDERRSPERYQDCSHWCLPGVPDSWNELLYAQLLIKQHQ  843



>ref|XP_007162340.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
 gb|ESW34334.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
Length=633

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+ +VE FV+PFLVQE E+ DK G KK ETLRLDLV  S+ +YK+ADI++FNTGHWWT
Sbjct  398  KDYHFSVELFVSPFLVQEGEMTDKNGTKK-ETLRLDLVGQSSSQYKDADIIIFNTGHWWT  456

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY ELNV+EAFR+ALTTW RWVD +INP+KT V FRGYSASHFS
Sbjct  457  HDKTSKGQDYYQEGSHVYSELNVLEAFRRALTTWSRWVDANINPSKTVVFFRGYSASHFS  516

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PI NE YLT YP KM VLE+VL  MK +V Y NVTRMTDFRKD H
Sbjct  517  GGQWNSGGQCDSETDPIDNEKYLTQYPDKMIVLEKVLKNMKNRVIYQNVTRMTDFRKDGH  576

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS EER+SPLRYQDCSHWCLPGVPD WNE+LYAELL+++Y+
Sbjct  577  PSIYRKQNLSPEERKSPLRYQDCSHWCLPGVPDIWNEILYAELLMREYR  625



>ref|XP_004497886.1| PREDICTED: uncharacterized protein LOC101512080 [Cicer arietinum]
Length=529

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 167/229 (73%), Positives = 196/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN ++EFFV PFLVQEWE+  K G KK ETLRLDLV  S+D+YK+ADI++FNTGHWWT
Sbjct  294  KDYNFSIEFFVLPFLVQEWEVLVKNGTKK-ETLRLDLVGRSSDQYKDADIIIFNTGHWWT  352

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSH+Y+ELNV+EAFRKA+TTW RWVD +IN +K+ V FRGYS+SHFS
Sbjct  353  HDKTSKGKDYYQEGSHIYNELNVLEAFRKAITTWSRWVDANINTSKSMVFFRGYSSSHFS  412

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E+ PI+N+ YL  YPPKM VLE+VL  MK  V+YLNVT MTDFRKD H
Sbjct  413  GGQWNSGGQCDSEIVPIQNKKYLREYPPKMRVLEKVLKNMKNHVTYLNVTTMTDFRKDGH  472

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ LS EER+SPL YQDCSHWCLPGVPD WNE+LY ELL+K YQ
Sbjct  473  PSVYRKQNLSPEERKSPLMYQDCSHWCLPGVPDTWNEILYVELLLKNYQ  521



>gb|KEH16599.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=526

 Score =   373 bits (957),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 198/226 (88%), Gaps = 1/226 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN +VE FV+PFLVQEWE+  K G KK ETLRLDLV  S+++YK+ADI++FNTGHWWT
Sbjct  288  KDYNFSVELFVSPFLVQEWEMLVKNGTKK-ETLRLDLVGRSSNQYKDADIIIFNTGHWWT  346

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKG+DYYQEGSHVY+ELNV+EAFRKA+TTW RWVD +IN +K+ V FRGYS+SHFS
Sbjct  347  HDKTSKGKDYYQEGSHVYNELNVLEAFRKAITTWSRWVDANINTSKSMVFFRGYSSSHFS  406

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C+ E+ PIKNE YL  YPPKM VLE+VL  MKT+V+YLNVT+MTDFRKD H
Sbjct  407  GGQWNSGGQCNSEIVPIKNEKYLRQYPPKMRVLEKVLRNMKTRVTYLNVTKMTDFRKDGH  466

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            PS+YRKQ LS +ER+SPL YQDCSHWCLPGVPD WNE+LYAELL+K
Sbjct  467  PSIYRKQNLSPDERKSPLMYQDCSHWCLPGVPDTWNEILYAELLMK  512



>gb|EMT28814.1| hypothetical protein F775_14799 [Aegilops tauschii]
Length=705

 Score =   378 bits (971),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 196/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE     G KK ETLRLD+V  S+ KYK+AD ++FNTGHWWTH
Sbjct  475  DYNCSVEFFRSPFLVQEWETRVSNGNKK-ETLRLDIVEQSSPKYKDADFIIFNTGHWWTH  533

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKT+ G+DYYQEGSH+Y ELNVV+AF KAL TW RW+D ++NP KT V+FRGYSASHFSG
Sbjct  534  EKTALGKDYYQEGSHIYSELNVVDAFHKALITWSRWIDGNVNPKKTTVMFRGYSASHFSG  593

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPIKNE YL+ YPPKM +LE V++ M+T V YLN+TR+TD+RKDAHP
Sbjct  594  GQWNSGGSCDKETEPIKNEQYLSTYPPKMSILEDVIHKMRTPVVYLNITRLTDYRKDAHP  653

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ+LSEEERRSP RYQDCSHWCLPGVPD WNEL+YA+LL+ Q+Q
Sbjct  654  SIYRKQHLSEEERRSPERYQDCSHWCLPGVPDSWNELVYAQLLISQHQ  701



>ref|XP_008387218.1| PREDICTED: protein trichome birefringence-like [Malus domestica]
Length=629

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 194/226 (86%), Gaps = 1/226 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFV+PFLV+EWE+ +K G K+ ETLRLDLV  S++ YK+AD+++FNTGHWWT
Sbjct  389  KDYNCTVEFFVSPFLVREWEMPEKDGSKR-ETLRLDLVGRSSELYKDADVVIFNTGHWWT  447

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY ELNV+EAFRKALTTW RWVD  ++P K+   FRGYSASHFS
Sbjct  448  HEKTSXGKDYYQEGSHVYGELNVLEAFRKALTTWARWVDAKVDPKKSIXFFRGYSASHFS  507

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PI NE+YL PY PKM VLE+VL  MKT V+YLN+TRMTDFRKD H
Sbjct  508  GGQWNSGGQCDSETVPIFNESYLRPYLPKMVVLEKVLKNMKTHVTYLNITRMTDFRKDGH  567

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            PS+YRKQ LSEEERRSP  +QDCSHWCLPGVPD WNE+LYAELLVK
Sbjct  568  PSIYRKQKLSEEERRSPTSFQDCSHWCLPGVPDAWNEVLYAELLVK  613



>gb|EYU39954.1| hypothetical protein MIMGU_mgv1a008556mg [Erythranthe guttata]
Length=369

 Score =   364 bits (935),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 196/230 (85%), Gaps = 7/230 (3%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY C VEFFV+PFLV+EWE   K G KK ETLRLDLV   ADKYKNAD++VFNTGHWWT
Sbjct  141  EEYKCRVEFFVSPFLVEEWESKGKNGTKK-ETLRLDLVNGFADKYKNADVIVFNTGHWWT  199

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY +LNV+EAFRKALTTWGRW+D ++NP K+ V FRGYSASHFS
Sbjct  200  HEKTSTGKDYYQEGSHVYSDLNVLEAFRKALTTWGRWIDANVNPMKSHVFFRGYSASHFS  259

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CDHE EPIKN+TYL+ YP KM++LE+VL GMKT+V+YLNVTRMTD+RKD H
Sbjct  260  GGQWNSGGQCDHETEPIKNDTYLSHYPSKMQILEKVLKGMKTKVTYLNVTRMTDYRKDGH  319

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS++RKQ+ ++      L +QDCSHWCLPGVPD WNE+LYAELLVK + +
Sbjct  320  PSIFRKQHSAD------LSFQDCSHWCLPGVPDTWNEILYAELLVKLHHQ  363



>ref|XP_002436669.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor]
 gb|EER88036.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor]
Length=869

 Score =   380 bits (975),  Expect = 1e-121, Method: Composition-based stats.
 Identities = 167/228 (73%), Positives = 198/228 (87%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KKKETLRLDLV  S+ KYK+AD L+FNTGHWWTH
Sbjct  639  DYNCSVEFFRSPFLVQEWEMKVSSG-KKKETLRLDLVEQSSLKYKDADFLIFNTGHWWTH  697

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS G+DYYQEG+HVY+ELNV++AF KAL TW +W+D ++NP KT VLFRGYSASHFSG
Sbjct  698  EKTSLGKDYYQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTAVLFRGYSASHFSG  757

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPI NE YL+ YPPKM +LE V++ MKT V YLN+TRMTD+RKDAHP
Sbjct  758  GQWNSGGSCDKESEPITNEQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHP  817

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ L++EERRSP RYQDCSHWCLPGVPD WNEL+YA+LL++Q+Q
Sbjct  818  SIYRKQNLTDEERRSPERYQDCSHWCLPGVPDSWNELVYAQLLIRQHQ  865



>ref|XP_008791924.1| PREDICTED: protein trichome birefringence-like 1 [Phoenix dactylifera]
Length=780

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 190/221 (86%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWEI    G K KETLRLD +  S+ KYKNA ++VFNTGHWWT
Sbjct  550  KDYNCSVEFFRSPFLVQEWEIPVSNG-KTKETLRLDTIERSSPKYKNAHVIVFNTGHWWT  608

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEG HVY ELNVVEAF KAL TW +WVD ++NP KT V FRGYSASHFS
Sbjct  609  HEKTSKGKDYYQEGDHVYSELNVVEAFHKALNTWAKWVDAYVNPKKTLVFFRGYSASHFS  668

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD+E EPIKN+ YL+ YPPKM VLE+V+ GMKT VSYLNVTRMTD+RKDAH
Sbjct  669  GGQWNSGGQCDNETEPIKNKNYLSAYPPKMRVLEKVIKGMKTPVSYLNVTRMTDYRKDAH  728

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYA  140
            PS+YRKQ L+EEERRSP RYQDCSHWCLPGVPD WNELLYA
Sbjct  729  PSIYRKQNLTEEERRSPERYQDCSHWCLPGVPDSWNELLYA  769



>ref|XP_004303340.1| PREDICTED: protein trichome birefringence-like [Fragaria vesca 
subsp. vesca]
Length=610

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 199/231 (86%), Gaps = 3/231 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN TVEFFV+PFLV+EWE+ DK G KK ETLRLDLV  S++ YK+ADIL+FNTGHWWT
Sbjct  371  KDYNFTVEFFVSPFLVREWEMPDKDGSKK-ETLRLDLVGRSSELYKDADILIFNTGHWWT  429

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT+KG+DYYQEGSHVY ELNV+EAFRKALTTW RWVD  ++ AK+ V FRGYSASHFS
Sbjct  430  HDKTAKGKDYYQEGSHVYGELNVLEAFRKALTTWSRWVDASVDTAKSMVFFRGYSASHFS  489

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E  PI NETYL PYPPKM VLE+VL  MK  ++YLN+TR+TDFRKD H
Sbjct  490  GGQWNSGGQCDSETLPIFNETYLRPYPPKMLVLEKVLKNMKHHITYLNITRLTDFRKDGH  549

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKS  110
            PS+YRKQ+LS EER+SP+  QDCSHWCLPGVPD WNE+LYAELLVK ++KS
Sbjct  550  PSIYRKQHLSPEERKSPI--QDCSHWCLPGVPDAWNEVLYAELLVKLHKKS  598



>ref|XP_009146094.1| PREDICTED: protein trichome birefringence-like 1 [Brassica rapa]
Length=256

 Score =   359 bits (922),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 191/228 (84%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            EYNCTVEFF +PFLV+EWE+ DK G KK ETLRLD++  S+ +Y  AD+LVFNTG WWT 
Sbjct  17   EYNCTVEFFASPFLVREWEVTDKNGTKK-ETLRLDMMGSSSKQYIGADVLVFNTGAWWTD  75

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            + TSKGEDY+QE S VY +LNV EAFRKALTTWGRWVD ++NP K+ V FRG+S SHFSG
Sbjct  76   DITSKGEDYFQERSTVYPKLNVDEAFRKALTTWGRWVDKYVNPKKSLVFFRGFSLSHFSG  135

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            G+WN+GGACD E EPIKNE YL PYP KME+LERVL GMKT V+YLN+TR+TD+RKDAHP
Sbjct  136  GRWNAGGACDDETEPIKNEAYLMPYPSKMEILERVLRGMKTPVTYLNITRLTDYRKDAHP  195

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ  + EE +SPL YQDCSHWCLPGVPD WNE+LYAE+LVK  Q
Sbjct  196  SVYRKQKFTAEESKSPLLYQDCSHWCLPGVPDSWNEILYAEMLVKLDQ  243



>ref|XP_010672635.1| PREDICTED: protein trichome birefringence-like 1 [Beta vulgaris 
subsp. vulgaris]
Length=602

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 197/231 (85%), Gaps = 1/231 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFFVAPFLVQ W++ DK G  K ETLRLD+V   A  +K+AD +VFNTGHWWT
Sbjct  373  KDYNCTVEFFVAPFLVQPWDVKDKNGTMK-ETLRLDVVVEEAIHFKDADFVVFNTGHWWT  431

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VY +L+V EAFRKA+TTWGRWVD +INP +T V FRGYS++HFS
Sbjct  432  HEKTSKGEDYYQEGSNVYKQLDVQEAFRKAVTTWGRWVDANINPQRTHVFFRGYSSTHFS  491

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPI+N+TYLT YP KM  LE V+ GMKT VSYLN+T++TD+RKDAH
Sbjct  492  GGQWNSGGQCDSETEPIRNDTYLTKYPWKMRTLETVMKGMKTPVSYLNITKLTDYRKDAH  551

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKS  110
            PS+YRKQ  S EE+R+PLR+QDCSHWCLPGVPD WNELLYAE+L KQ+Q +
Sbjct  552  PSIYRKQRPSTEEKRTPLRFQDCSHWCLPGVPDSWNELLYAEILRKQFQNT  602



>ref|XP_004964924.1| PREDICTED: fibroin heavy chain-like [Setaria italica]
Length=907

 Score =   379 bits (973),  Expect = 3e-121, Method: Composition-based stats.
 Identities = 168/228 (74%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLV+EWE+    G KKKETLRLDLV  S+ KYK+AD L+FNTGHWWTH
Sbjct  677  DYNCSVEFFRSPFLVREWEMKVSDG-KKKETLRLDLVEQSSPKYKDADFLIFNTGHWWTH  735

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKT+ G+DYYQEG+HVY ELNVV+AF KAL TW +W+D ++NP KT VLFRGYSASHFSG
Sbjct  736  EKTALGKDYYQEGNHVYSELNVVDAFHKALLTWSKWIDANVNPKKTTVLFRGYSASHFSG  795

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPI NE YL+ YPPKM +LE V++ MKT V YLN+TRMTD+RKDAHP
Sbjct  796  GQWNSGGSCDKESEPITNEQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHP  855

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ L++EERRSP RYQDCSHWCLPGVPD WNELLYA+LL+KQ+Q
Sbjct  856  SIYRKQNLTDEERRSPERYQDCSHWCLPGVPDSWNELLYAQLLIKQHQ  903



>ref|NP_001141610.1| uncharacterized protein LOC100273728 [Zea mays]
 gb|ACF86715.1| unknown [Zea mays]
Length=353

 Score =   361 bits (927),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 196/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KKKETLRLDLV  S+ KYK+AD ++FNTGHWWTH
Sbjct  123  DYNCSVEFFRSPFLVQEWEMQVSSG-KKKETLRLDLVEQSSLKYKDADFIIFNTGHWWTH  181

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKT+ G+DYYQEG+HVY+ELNV++AF KAL TW +W+D ++NP KT VLFRGYSASHFSG
Sbjct  182  EKTALGKDYYQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTLVLFRGYSASHFSG  241

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG CD E +PI N+ YL+ YPPKM +LE V++ MKT V YLN+TRM D+RKDAHP
Sbjct  242  GQWNSGGGCDKESKPITNDQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMADYRKDAHP  301

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ L++EERRSP R+QDCSHWCLPGVPD WNEL+YA+LL+KQ+Q
Sbjct  302  SIYRKQNLTDEERRSPERFQDCSHWCLPGVPDSWNELVYAQLLIKQHQ  349



>gb|EPS65088.1| hypothetical protein M569_09686, partial [Genlisea aurea]
Length=524

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 194/226 (86%), Gaps = 5/226 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEY CTVEFFVAPFLVQEWE+ADK G KK ETLRLD+++H+AD+YK ADI+VFNTGHWWT
Sbjct  298  EEYKCTVEFFVAPFLVQEWEVADKNGTKK-ETLRLDMISHTADEYKTADIVVFNTGHWWT  356

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEGSHVY ELNV+EAFR+ALT WGRW+D+++NP K+ + FRGYSASHFS
Sbjct  357  HEKTSLGKDYYQEGSHVYGELNVLEAFRRALTHWGRWIDSNMNPTKSLLFFRGYSASHFS  416

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C HE EPIKNETYL PYP KM VLE+VL GM+T V+YLN+TRMTD+RKD H
Sbjct  417  GGQWNSGGQCHHETEPIKNETYLVPYPQKMLVLEKVLKGMRTHVTYLNLTRMTDYRKDGH  476

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            PS+YRK  ++  E       QDCSHWCLPGVPD WNE+LYA+L++K
Sbjct  477  PSIYRKLKITGNED----AVQDCSHWCLPGVPDSWNEILYAQLILK  518



>gb|AFW85381.1| putative DUF231 domain containing family protein [Zea mays]
Length=865

 Score =   376 bits (965),  Expect = 3e-120, Method: Composition-based stats.
 Identities = 162/228 (71%), Positives = 196/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE+    G KKKETLRLDLV  S+ KYK+AD ++FNTGHWWTH
Sbjct  635  DYNCSVEFFRSPFLVQEWEMQVSSG-KKKETLRLDLVEQSSLKYKDADFIIFNTGHWWTH  693

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKT+ G+DYYQEG+HVY+ELNV++AF KAL TW +W+D ++NP KT VLFRGYSASHFSG
Sbjct  694  EKTALGKDYYQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTLVLFRGYSASHFSG  753

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG CD E +PI N+ YL+ YPPKM +LE V++ MKT V YLN+TRM D+RKDAHP
Sbjct  754  GQWNSGGGCDKESKPITNDQYLSTYPPKMSILEDVIHKMKTPVVYLNITRMADYRKDAHP  813

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ L++EERRSP R+QDCSHWCLPGVPD WNEL+YA+LL+KQ+Q
Sbjct  814  SIYRKQNLTDEERRSPERFQDCSHWCLPGVPDSWNELVYAQLLIKQHQ  861



>ref|XP_009120981.1| PREDICTED: protein trichome birefringence-like 1 [Brassica rapa]
 emb|CDY47898.1| BnaAnng09300D [Brassica napus]
Length=529

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 192/229 (84%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EYNCTVEFF +PFLV+EWE+ DK G KK ETLRLD++  S+ +Y  AD+LVFNTG WWT
Sbjct  289  KEYNCTVEFFASPFLVREWEVTDKNGTKK-ETLRLDMMGSSSKQYIGADVLVFNTGAWWT  347

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
             + TSKGEDY+QE S VY +LNV EAFRKALTTWGRWVD ++NP K+ V FRG+S SHFS
Sbjct  348  DDITSKGEDYFQERSTVYPKLNVDEAFRKALTTWGRWVDKYVNPKKSLVFFRGFSLSHFS  407

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WN+GGACD E EPIKNE YL PYP KME+LERVL GMKT V+YLN+TR+TD+RKDAH
Sbjct  408  GGRWNAGGACDDETEPIKNEAYLMPYPSKMEILERVLRGMKTPVTYLNITRLTDYRKDAH  467

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ  + EE +SPL YQDCSHWCLPGVPD WNE+LYAE+LVK  Q
Sbjct  468  PSVYRKQKFTAEESKSPLLYQDCSHWCLPGVPDSWNEILYAEMLVKLDQ  516



>gb|KJB15004.1| hypothetical protein B456_002G154200 [Gossypium raimondii]
Length=546

 Score =   363 bits (932),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 196/231 (85%), Gaps = 4/231 (2%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFFV+PFLV++W++ D+ G KK  TLRLDL+  S++ YK+ADILVFNTGHWW H
Sbjct  308  DYNCSVEFFVSPFLVRQWQMPDRNGTKK-NTLRLDLIGRSSEIYKSADILVFNTGHWWNH  366

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTSKGEDYYQEG HVY ELNVVEAFR+ALTTW +WVD ++NP+KT V FRGYSA+HFSG
Sbjct  367  EKTSKGEDYYQEGDHVYEELNVVEAFRRALTTWSKWVDDNVNPSKTMVFFRGYSATHFSG  426

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG CD E+EPI+NET L PY P M VLE VL GMKT V+YLN+TR+TDFRKD HP
Sbjct  427  GQWNSGGVCDSEMEPIRNETLLRPYMPMMAVLESVLEGMKTHVTYLNITRLTDFRKDGHP  486

Query  259  SMYR---KQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YR   K  ++E+ER   ++YQDCSHWCLPGVPD WNELLY+ELLVK+Y+
Sbjct  487  SIYRRYHKHGITEKERTESVKYQDCSHWCLPGVPDTWNELLYSELLVKEYK  537



>gb|EAY87710.1| hypothetical protein OsI_09124 [Oryza sativa Indica Group]
Length=700

 Score =   367 bits (943),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE   +KG  K ETLRLD++++S  +YKNADI++FNTGHWWT
Sbjct  469  QDYNCSVEFFRSPFLVQEWEFPVRKGLTK-ETLRLDMISNSFPRYKNADIIIFNTGHWWT  527

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG+ VY ELNV +AF+KAL TW +WVD+ +NP KT V FRGYS+SHFS
Sbjct  528  HEKTSLGKDYYQEGNRVYSELNVDDAFQKALITWAKWVDSSVNPKKTTVFFRGYSSSHFS  587

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E EPI NE +LTPYP KM +LE VL+GMKT V YLN+TRMTD+RK+AH
Sbjct  588  GGQWNSGGSCDKETEPITNEKFLTPYPRKMSILEDVLSGMKTPVVYLNITRMTDYRKEAH  647

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ L+EEE++SP  YQDCSHWCLPGVPD WNELLYA+++VKQ+Q
Sbjct  648  PSVYRKQKLTEEEKKSPQIYQDCSHWCLPGVPDSWNELLYAQIMVKQHQ  696



>ref|XP_004954083.1| PREDICTED: cell wall protein AWA1-like [Setaria italica]
Length=736

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF +PFLVQEWE+    G   +ETLRLD+V  +  +YKNADI++FNTGHWWT
Sbjct  504  QDYNCTVEFFRSPFLVQEWEMPIGNGNGTRETLRLDIVDRAFPRYKNADIIIFNTGHWWT  563

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS G+DYYQEG+ VY EL+V +A+R+AL TW +WVD+++NP KT V FRGYSASHFS
Sbjct  564  HDKTSLGKDYYQEGNRVYSELDVHDAYRRALNTWAKWVDSNVNPKKTTVFFRGYSASHFS  623

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E EPI NE YLTPYP KM +LE VL+GMKT V YLN+TRMTD+RK+AH
Sbjct  624  GGQWNSGGSCDKETEPITNEQYLTPYPTKMSILEEVLHGMKTPVVYLNITRMTDYRKEAH  683

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ LSEEER+SP  YQDCSHWCLPGVPD WNELLYA++LVKQ
Sbjct  684  PSVYRKQKLSEEERKSPELYQDCSHWCLPGVPDSWNELLYAQILVKQ  730



>ref|XP_009417662.1| PREDICTED: protein trichome birefringence-like [Musa acuminata 
subsp. malaccensis]
Length=719

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 192/229 (84%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E++NC+VEFF +PFLVQEWE     G KK ETLRLD++  S+ KYK+AD+LVFNTGHWWT
Sbjct  490  EDFNCSVEFFRSPFLVQEWETPGSNGNKK-ETLRLDIIERSSAKYKDADVLVFNTGHWWT  548

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEG+H+Y +LNVV AF KAL TW +WVD ++N   + V FRGYS +HFS
Sbjct  549  HEKTSKGKDYYQEGNHIYSDLNVVNAFHKALNTWAKWVDANVNSKNSLVFFRGYSVTHFS  608

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG CD E EPIKNE YL+ YP KM VLE V+ GMKT V+YLN+T MTD+RKDAH
Sbjct  609  GGRWNSGGQCDKETEPIKNEKYLSSYPWKMTVLESVIKGMKTPVAYLNITTMTDYRKDAH  668

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ L+EEERRSP RYQDCSHWCLPGVPD WNELLYA+L+VKQ+Q
Sbjct  669  PSIYRKQNLTEEERRSPERYQDCSHWCLPGVPDSWNELLYAQLIVKQHQ  717



>ref|XP_003573026.1| PREDICTED: protein trichome birefringence [Brachypodium distachyon]
Length=753

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE   + G K KETLRLD++ HS+ +YK+ADI+VFNTGHWWT
Sbjct  522  QDYNCSVEFFRSPFLVQEWETPARHG-KNKETLRLDVIDHSSPRYKSADIIVFNTGHWWT  580

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG+HVY ELNV +A+R+AL TW +WVD ++NP +T V FRGYSASHFS
Sbjct  581  HEKTSLGKDYYQEGNHVYSELNVDDAYRRALNTWAKWVDANVNPRRTTVFFRGYSASHFS  640

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E +PI+NE YL PYP KM +LE VL+ MKT V Y+N+TRMTD+RK+AH
Sbjct  641  GGQWNSGGSCDKETKPIRNEHYLVPYPQKMSILEEVLHEMKTPVVYMNITRMTDYRKEAH  700

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YR+Q LSEEER+SP  YQDCSHWCLPGVPD WNELLYA++LVKQ+Q
Sbjct  701  PSVYRRQKLSEEERKSPELYQDCSHWCLPGVPDSWNELLYAQILVKQHQ  749



>ref|XP_006649087.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=696

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 195/229 (85%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE   +KG  K ETLRLD++++S  +YK ADI++FNTGHWWT
Sbjct  466  QDYNCSVEFFRSPFLVQEWEFPVRKGLIK-ETLRLDMISNSFPRYKGADIIIFNTGHWWT  524

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG+ VY ELNV +AF+KAL TW +WVD+ +NP KT V FRGYSASHFS
Sbjct  525  HEKTSLGKDYYQEGNRVYSELNVDDAFQKALQTWAKWVDSSVNPKKTTVFFRGYSASHFS  584

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E EPI NE YLTPYP KM VLE VL+GMKT V YLN+TRMTD+RK+AH
Sbjct  585  GGQWNSGGSCDKETEPITNEKYLTPYPRKMSVLEDVLHGMKTPVVYLNITRMTDYRKEAH  644

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ L+EEE +SP  YQDCSHWCLPGVPD WNELLYA++LVKQ+Q
Sbjct  645  PSVYRKQKLTEEEMKSPQIYQDCSHWCLPGVPDSWNELLYAQILVKQHQ  693



>gb|KHG20627.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=546

 Score =   361 bits (926),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 195/231 (84%), Gaps = 4/231 (2%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFFV+PFLV++W++ DK G KK  TLRLDL+  S++ YK+ADILVFNTGHWW H
Sbjct  308  DYNCSVEFFVSPFLVRQWQMLDKNGTKK-NTLRLDLIGRSSEIYKSADILVFNTGHWWNH  366

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTSKG+DYYQEG HVY ELNV EAFR+A+TTW +WVD ++NP+KT V FRGYSA HFSG
Sbjct  367  EKTSKGKDYYQEGDHVYEELNVFEAFRRAVTTWSKWVDDNVNPSKTMVFFRGYSAIHFSG  426

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG CD E+EPI+NET+L PY P M VLE VL GMKT V+YLN+TR+TDFRKD HP
Sbjct  427  GQWNSGGMCDSEMEPIRNETFLKPYMPMMAVLESVLEGMKTHVTYLNITRLTDFRKDGHP  486

Query  259  SMYR---KQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YR   K  ++E+ER   ++YQDCSHWCLPGVPD WNELLY+ELLVKQY+
Sbjct  487  SIYRRYHKHGITEKERTESVKYQDCSHWCLPGVPDTWNELLYSELLVKQYK  537



>dbj|BAD16880.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD17136.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ24784.1| hypothetical protein OsJ_08560 [Oryza sativa Japonica Group]
 dbj|BAH01510.1| unnamed protein product [Oryza sativa Japonica Group]
Length=700

 Score =   365 bits (938),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE   +KG  K ETLRLD++++S  +YK+ADI++FNTGHWWT
Sbjct  469  QDYNCSVEFFRSPFLVQEWEFPVRKGLTK-ETLRLDMISNSFPRYKDADIIIFNTGHWWT  527

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG+ VY ELNV +AF+KAL TW +WVD+ +NP KT V FRGYS+SHFS
Sbjct  528  HEKTSLGKDYYQEGNRVYSELNVDDAFQKALITWAKWVDSSVNPKKTTVFFRGYSSSHFS  587

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E EPI NE +LTPYP KM +LE VL+GMKT V YLN+TRMTD+RK+AH
Sbjct  588  GGQWNSGGSCDKETEPITNEKFLTPYPRKMSILEDVLSGMKTPVVYLNITRMTDYRKEAH  647

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRKQ L+EEE++SP  YQDCSHWCLPGVPD WNELLYA+++VKQ+Q
Sbjct  648  PSVYRKQKLTEEEKKSPQIYQDCSHWCLPGVPDSWNELLYAQIMVKQHQ  696



>ref|XP_009414351.1| PREDICTED: protein trichome birefringence-like 1 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 195/230 (85%), Gaps = 1/230 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+VEFF +PFLVQEWE+    G+K+ ETLRLD+V  S+ KYK+AD+++FNTGHWWT
Sbjct  438  EDYNCSVEFFRSPFLVQEWEMPITNGEKR-ETLRLDIVERSSSKYKDADVIIFNTGHWWT  496

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKT+KG+DYYQEG+H+Y ELNV EA RKAL+TW +WVDT++N  K+ V+FRGYS SHFS
Sbjct  497  HEKTAKGKDYYQEGNHIYSELNVEEALRKALSTWAKWVDTNVNREKSLVVFRGYSNSHFS  556

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPI+N+ YLT YP  M +LE V+ GMKT VSYLN+TRMTD+RKDAH
Sbjct  557  GGQWNSGGQCDQETEPIQNDEYLTTYPSMMTLLESVIKGMKTPVSYLNITRMTDYRKDAH  616

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YR Q ++EEE R P +YQDCSHWCLPGVPD WNELLYA+L++KQ+ +
Sbjct  617  PSIYRTQNMTEEEMRDPEKYQDCSHWCLPGVPDSWNELLYAQLIIKQHNQ  666



>ref|XP_002454638.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor]
 gb|EES07614.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor]
Length=733

 Score =   363 bits (933),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE+    G+  +ETLRLD++  +  +YKNADI++FNTGHWWT
Sbjct  501  QDYNCSVEFFRSPFLVQEWEMPISNGKGTRETLRLDIIDSAFPRYKNADIVIFNTGHWWT  560

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS G+DYYQEG  VY EL+V +AFR+AL TW +WVD+++NP KT V FRGYSASHFS
Sbjct  561  HDKTSLGKDYYQEGDRVYSELDVHDAFRRALNTWAKWVDSNVNPKKTTVFFRGYSASHFS  620

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E EPI N+ YLTPYP KM +LE VL+GMKT V YLN+TRMTD+RK+AH
Sbjct  621  GGQWNSGGSCDKETEPIMNDQYLTPYPTKMSILEEVLHGMKTPVVYLNITRMTDYRKEAH  680

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ L+EEER+SP  YQDCSHWCLPGVPD WNELLYA++L+KQ
Sbjct  681  PSVYRKQKLTEEERKSPELYQDCSHWCLPGVPDSWNELLYAQILLKQ  727



>dbj|BAK01401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=753

 Score =   364 bits (934),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 193/229 (84%), Gaps = 1/229 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVEFF +PFLVQEWE+    G KKKETLRLD +  S+ +YKNAD++VFNTGHWW 
Sbjct  522  QDYNCTVEFFRSPFLVQEWEMHVTHG-KKKETLRLDKIDRSSSRYKNADVIVFNTGHWWI  580

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG  VY ELNV +A+R+AL TW +WVD++INP KT V FRGYSASHFS
Sbjct  581  HEKTSLGKDYYQEGDQVYSELNVHDAYRRALNTWAKWVDSNINPKKTTVFFRGYSASHFS  640

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E EPI N+ YL PYP KM +LE VL+GMKT V+YLN+TR+TD+RK+ H
Sbjct  641  GGQWNSGGSCDKETEPITNQQYLMPYPQKMSILEEVLHGMKTPVAYLNITRLTDYRKEGH  700

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            PS+YRK  LSEEER+SP  YQDCSHWCLPGVPD WNELLYA++LVKQ+Q
Sbjct  701  PSVYRKHKLSEEERKSPELYQDCSHWCLPGVPDSWNELLYAQILVKQHQ  749



>ref|XP_008679266.1| PREDICTED: protein trichome birefringence-like 1 [Zea mays]
 gb|AFW64296.1| putative DUF231 domain containing family protein [Zea mays]
Length=731

 Score =   362 bits (928),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE+    G+  +ETLRLD++  S  +YKNADI++FNTGHWWT
Sbjct  499  QDYNCSVEFFRSPFLVQEWEMPVSNGKGTRETLRLDIIDPSFPRYKNADIVIFNTGHWWT  558

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS G+DYYQEG+ VY EL+V +AFR+AL TW +WVD+++NP KT V FRGYSASHFS
Sbjct  559  HDKTSLGKDYYQEGNRVYSELDVHDAFRRALNTWAKWVDSNVNPKKTTVFFRGYSASHFS  618

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E EPI ++ YLTPYP KM +LE VL GMKT V YLN+TRMTD+RK+AH
Sbjct  619  GGQWNSGGSCDRETEPITDDQYLTPYPTKMSILEEVLRGMKTPVVYLNITRMTDYRKEAH  678

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS+YRKQ L+EEER+SP  YQDCSHWCLPGVPD WNELLYA++L+ Q
Sbjct  679  PSVYRKQKLTEEERKSPELYQDCSHWCLPGVPDSWNELLYAQILLTQ  725



>ref|XP_006849537.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
 gb|ERN11118.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
Length=718

 Score =   357 bits (915),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 188/226 (83%), Gaps = 1/226 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEF  +PFLVQEWEI +  G  K ETLRLD++ +SA KYKNADI+VFNTGHWWTH
Sbjct  492  DYNCSVEFVRSPFLVQEWEIPEPNGTMK-ETLRLDIIENSASKYKNADIIVFNTGHWWTH  550

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+G+DYYQEG+HVY ELNVV+A+RKAL TW +WVD ++NP KT V FRGYSASHFSG
Sbjct  551  EKTSRGKDYYQEGNHVYGELNVVDAYRKALKTWAKWVDINVNPKKTQVFFRGYSASHFSG  610

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG C  E EPI  E YLT YPPKM VLE V+  MKT V YLN+TRMTD+RKDAHP
Sbjct  611  GQWNSGGQCHKETEPIYKEKYLTMYPPKMRVLESVMREMKTPVFYLNITRMTDYRKDAHP  670

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            S+YRK+ L+ EER SP R+QDCSHWCLPGVPD WNELLYA +L ++
Sbjct  671  SVYRKKNLTPEERTSPERFQDCSHWCLPGVPDIWNELLYAAILKRE  716



>gb|EPS66265.1| hypothetical protein M569_08511, partial [Genlisea aurea]
Length=354

 Score =   343 bits (881),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 189/223 (85%), Gaps = 1/223 (0%)
 Frame = -1

Query  793  NCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTHEK  614
            N TVEFFV+PFLVQEW + D  G +K ETLRLDL+  ++ +YK+AD++VFNTGHWWTHEK
Sbjct  130  NFTVEFFVSPFLVQEWHVFDSNGTRK-ETLRLDLMNKASARYKDADVIVFNTGHWWTHEK  188

Query  613  TSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSGGQ  434
            TS G+DYYQEG HV+ +LN +EAFR+ALTTWGRWVD++++  K+ V FRGYSASHFSGGQ
Sbjct  189  TSTGKDYYQEGRHVHQDLNALEAFRRALTTWGRWVDSNVDRDKSLVFFRGYSASHFSGGQ  248

Query  433  WNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPSM  254
            WNSGG CD++ EPIK E YL+PY  KM VLE+VL GMKT+V YLNVTRMTD+RKD HPS+
Sbjct  249  WNSGGQCDNQTEPIKKEEYLSPYMDKMIVLEQVLMGMKTRVHYLNVTRMTDYRKDGHPSI  308

Query  253  YRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            YRK+  SE ERRSP  +QDCSHWCLPGVPD WNE+L+A+L+VK
Sbjct  309  YRKRSYSEVERRSPRSFQDCSHWCLPGVPDAWNEILFAQLMVK  351



>gb|EMS48369.1| hypothetical protein TRIUR3_11824 [Triticum urartu]
Length=426

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = -1

Query  763  FLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTHEKTSKGEDYYQE  584
            FL QEWEI    G KKKETLRLD +  S+ +YKNAD++VFNTGHWWTHEKTS G+DYYQE
Sbjct  208  FLFQEWEIPVTHG-KKKETLRLDKIDQSSSRYKNADVIVFNTGHWWTHEKTSLGKDYYQE  266

Query  583  GSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSGGQWNSGGACDHE  404
            G+ VY ELNV +AFR+AL TW +WVD++INP KT VLFRGYS+SHFSGGQWNSGG+CD E
Sbjct  267  GNQVYSELNVHDAFRRALNTWAKWVDSNINPKKTTVLFRGYSSSHFSGGQWNSGGSCDKE  326

Query  403  VEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPSMYRKQYLSEEE  224
             EPI NE +L PYP KM +LE VL+GMKT V+YLN+TRMTD+RK+ HPS+YRKQ LSEEE
Sbjct  327  TEPITNEKFLMPYPQKMSILEEVLHGMKTPVAYLNITRMTDYRKEGHPSVYRKQKLSEEE  386

Query  223  RRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            R+SP  YQDCSHWCLPGVPD WNELLYA++LVKQ+Q
Sbjct  387  RKSPELYQDCSHWCLPGVPDSWNELLYAQILVKQHQ  422



>ref|XP_008646340.1| PREDICTED: protein trichome birefringence [Zea mays]
Length=710

 Score =   354 bits (908),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE+    G+  +ETLRLD++  +  +YKNADI++FNTGHWWT
Sbjct  476  QDYNCSVEFFRSPFLVQEWEMPISNGKGTRETLRLDVIDPAFPRYKNADIIIFNTGHWWT  535

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS G+DYYQEG+ VY EL+V +AFR+AL TW +WVD+ +NP KT V FRGYSASHFS
Sbjct  536  HDKTSLGKDYYQEGNRVYSELDVHDAFRRALNTWAKWVDSSVNPKKTTVFFRGYSASHFS  595

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E +PI +  YLTPYP KM +LE VL  MKT V YLN+TRMTD+RK+AH
Sbjct  596  GGQWNSGGSCDKETDPITDGQYLTPYPEKMSILEEVLREMKTPVVYLNITRMTDYRKEAH  655

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS YRKQ L+EEER+SP  YQDCSHWCLPGVPD WNELLYA++L+KQ
Sbjct  656  PSAYRKQELTEEERQSPELYQDCSHWCLPGVPDSWNELLYAQILLKQ  702



>gb|AFW73695.1| putative DUF231 domain containing family protein, partial [Zea 
mays]
Length=706

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLVQEWE+    G+  +ETLRLD++  +  +YKNADI++FNTGHWWT
Sbjct  476  QDYNCSVEFFRSPFLVQEWEMPISNGKGTRETLRLDVIDPAFPRYKNADIIIFNTGHWWT  535

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS G+DYYQEG+ VY EL+V +AFR+AL TW +WVD+ +NP KT V FRGYSASHFS
Sbjct  536  HDKTSLGKDYYQEGNRVYSELDVHDAFRRALNTWAKWVDSSVNPKKTTVFFRGYSASHFS  595

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E +PI +  YLTPYP KM +LE VL  MKT V YLN+TRMTD+RK+AH
Sbjct  596  GGQWNSGGSCDKETDPITDGQYLTPYPEKMSILEEVLREMKTPVVYLNITRMTDYRKEAH  655

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            PS YRKQ L+EEER+SP  YQDCSHWCLPGVPD WNELLYA++L+KQ
Sbjct  656  PSAYRKQELTEEERQSPELYQDCSHWCLPGVPDSWNELLYAQILLKQ  702



>ref|XP_008352647.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=356

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 184/224 (82%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EYNC+VEFF +PFLVQEWE+AD  G  K ETLRLDL+  S+DKYK AD+L+FNTGHWWT
Sbjct  115  KEYNCSVEFFRSPFLVQEWEMADANGSIK-ETLRLDLIEXSSDKYKTADVLIFNTGHWWT  173

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+G+ YYQEGS++Y  LNV EAFRKALTTW RWVDT+INP KT V FRG+S +HF 
Sbjct  174  HEKTSRGKGYYQEGSYIYDVLNVKEAFRKALTTWARWVDTNINPEKTIVFFRGFSPNHFR  233

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C   +EP+  ET    Y  K+ + + V+ GMKT + YLN+TRMTDFR+DAH
Sbjct  234  GGRWNSGGQCHDLIEPLAKETNRGKYASKLRIFDSVITGMKTPIFYLNITRMTDFRRDAH  293

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRKQ  +EEER+SPLR+QDCSHWCLPGVPD WNELLYA+L+
Sbjct  294  PSIYRKQNFTEEERKSPLRHQDCSHWCLPGVPDTWNELLYAQLV  337



>ref|XP_009375160.1| PREDICTED: protein trichome birefringence-like [Pyrus x bretschneideri]
Length=454

 Score =   342 bits (878),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 182/224 (81%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EYNC+VEFF +PFLVQEWE+AD  G  K ETLRLDL+  S+DKYK AD+L+FNTGHWWT
Sbjct  213  KEYNCSVEFFRSPFLVQEWEMADANGSIK-ETLRLDLIERSSDKYKTADVLIFNTGHWWT  271

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+G+ YYQEGS++Y  LNV EAFRKALTTW RWVDT++NP KT V FR YS +HF 
Sbjct  272  HEKTSRGKGYYQEGSYIYDVLNVKEAFRKALTTWARWVDTNLNPEKTIVFFRAYSPNHFR  331

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C   +EP+  ET    Y  K+ + + V+ GMKT + YLN+TRMTDFR+DAH
Sbjct  332  GGRWNSGGQCHDLIEPLAKETTRGKYASKLRIFDSVITGMKTPIFYLNITRMTDFRRDAH  391

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRKQ  +EEER+SP RYQDCSHWCLPGVPD WNELLYA+L+
Sbjct  392  PSIYRKQNFTEEERKSPFRYQDCSHWCLPGVPDTWNELLYAQLV  435



>ref|XP_009587467.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=541

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 189/231 (82%), Gaps = 3/231 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEF  + FLVQEWE+ D  G  K ETLRLDLV  S DKYK ADILVFNTGHWWTH
Sbjct  309  DYNCSVEFVRSTFLVQEWEMPDGNGSTK-ETLRLDLVERSCDKYKGADILVFNTGHWWTH  367

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+G+ YYQEGSHVY ELNVVEAFRKA+TTW RW++T+++P KT V FRGYS SHFSG
Sbjct  368  EKTSEGKGYYQEGSHVYGELNVVEAFRKAMTTWARWIETNVDPLKTDVFFRGYSVSHFSG  427

Query  439  GQWNSGGACDHEVEPIKNETYLTP--YPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
            G+W +GG CD + EP+++E  L+P  YPP M +LE V+  MKT V YLNVT M+DFRKD 
Sbjct  428  GEWYAGGKCDSDTEPLQDEKDLSPSLYPPIMGMLEDVIRWMKTPVYYLNVTIMSDFRKDG  487

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            HPS+YRK  +++EERR+ +RYQDCSHWCLPGVPD WNELLYA+LL+K YQK
Sbjct  488  HPSIYRKPNMTDEERRTTIRYQDCSHWCLPGVPDTWNELLYAQLLMKHYQK  538



>ref|XP_007011182.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007011183.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19992.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19993.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=602

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 182/228 (80%), Gaps = 1/228 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC++E+F +PFLVQEW+  +K G K+ ETLRLD++   + KYK AD+L+FNTGHWWTH
Sbjct  361  DYNCSIEYFRSPFLVQEWKSLEKNGSKR-ETLRLDMMDKLSYKYKKADVLIFNTGHWWTH  419

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTSKG+ YYQEG+ +Y  LNV EAFRKALTTW RW+DT+I+P KT V FRG+SASHF G
Sbjct  420  EKTSKGKGYYQEGTTIYDRLNVKEAFRKALTTWARWIDTNIDPMKTLVFFRGFSASHFRG  479

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            G+WNSGG CD E EPI NE YL  YP KM + E V+ GM   V YLNV+RMT FRKDAHP
Sbjct  480  GRWNSGGQCDGETEPITNEKYLKKYPSKMRIFESVIKGMNKPVLYLNVSRMTGFRKDAHP  539

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S+YRKQ L+EEER SP R QDCSHWCLPGVPD WNEL+YA+L VK  Q
Sbjct  540  SIYRKQNLTEEERSSPTRIQDCSHWCLPGVPDTWNELVYAQLFVKHNQ  587



>ref|XP_008363351.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 183/224 (82%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EYNC+VEFF +PFLVQEWE+AD  G  K ETLRLDL+  S+DKYK AD+L+FNTGHWWT
Sbjct  322  KEYNCSVEFFRSPFLVQEWEMADANGSIK-ETLRLDLIEXSSDKYKTADVLIFNTGHWWT  380

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+G+ YYQEGS++Y  LNV EAFR ALTTW RWVDT+INP KT V FRG+S +HF 
Sbjct  381  HEKTSRGKGYYQEGSYIYDVLNVKEAFRXALTTWARWVDTNINPEKTIVFFRGFSPNHFR  440

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C   +EP+  ET    Y  K+ + + V+ GMKT + YLN+TRMTDFR+DAH
Sbjct  441  GGRWNSGGQCHDLIEPLAKETNRGKYASKLRIFDSVITGMKTPIFYLNITRMTDFRRDAH  500

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRKQ  +EEER+SPLR+QDCSHWCLPGVPD WNELLYA+L+
Sbjct  501  PSIYRKQNFTEEERKSPLRHQDCSHWCLPGVPDTWNELLYAQLV  544



>ref|XP_010044971.1| PREDICTED: protein trichome birefringence-like 1 [Eucalyptus 
grandis]
 gb|KCW87107.1| hypothetical protein EUGRSUZ_B03636 [Eucalyptus grandis]
Length=520

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 188/230 (82%), Gaps = 3/230 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLV+EWE     G K+ ETLRLDL   S++KYK+ADIL+FNTGHWWT
Sbjct  288  QDYNCSVEFFQSPFLVREWETPMANGSKR-ETLRLDLFEGSSEKYKDADILIFNTGHWWT  346

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG+DYYQEGSH+Y +L+V  AF+KALTTWGRW+DT+I+ +KT V FRGYS  HF 
Sbjct  347  HEKTSKGKDYYQEGSHIYSQLHVKVAFQKALTTWGRWIDTNIDSSKTLVFFRGYSYGHFR  406

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG CD E +P K ETY   YP KM +LE V+ GMKT V YLN+TR+T  RKDAH
Sbjct  407  GGRWNSGGRCDRETDPFKEETYAFKYPRKMRILEYVMKGMKTPVFYLNITRITGLRKDAH  466

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            PS+YRK  L+EEERRSP+  QDCSHWCLPGVPD WNELLY+++L+K+ +K
Sbjct  467  PSIYRKPNLTEEERRSPV--QDCSHWCLPGVPDTWNELLYSQILIKEIEK  514



>ref|XP_008352661.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   338 bits (866),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 182/224 (81%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EYNC+VEFF +PFLVQEWE+AD  G  K ETLRLDL+  S+DKYK AD+L+FNTGHWWT
Sbjct  322  KEYNCSVEFFRSPFLVQEWEMADANGSIK-ETLRLDLIEXSSDKYKTADVLIFNTGHWWT  380

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+G+ YYQEGS++Y  LNV EAFR ALTTW RWVDT+INP KT V FRG+S +HF 
Sbjct  381  HEKTSRGKGYYQEGSYIYDVLNVKEAFRXALTTWARWVDTNINPEKTIVFFRGFSPNHFR  440

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C   +EP+  ET    Y  K+ + + V+ GMKT + YLN+TRMTDFR+DAH
Sbjct  441  GGRWNSGGQCHDLIEPLAKETNRGKYASKLRIXDSVITGMKTPIFYLNITRMTDFRRDAH  500

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRKQ  +EEE +SPLR+QDCSHWCLPGVPD WNELLYA+L+
Sbjct  501  PSIYRKQNFTEEEXKSPLRHQDCSHWCLPGVPDTWNELLYAQLV  544



>ref|XP_004228795.2| PREDICTED: protein trichome birefringence-like [Solanum lycopersicum]
Length=363

 Score =   331 bits (848),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 185/226 (82%), Gaps = 3/226 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEF  + FLVQEWEI D  G  K ETLRLDLV  S DKYK AD+LVFNTGHWWTH
Sbjct  123  DYNCSVEFVRSTFLVQEWEIPDGNGSTK-ETLRLDLVERSCDKYKGADVLVFNTGHWWTH  181

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+G+ YYQEGSHVY ELNVVEAFRKA+TTW RW++ +++P+KT V FRGYS SHFSG
Sbjct  182  EKTSEGKGYYQEGSHVYGELNVVEAFRKAMTTWARWIEANVDPSKTDVFFRGYSVSHFSG  241

Query  439  GQWNSGGACDHEVEPIKNETYLTP--YPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
            G+W +GG CD + EP+K+E  L+P  YPP M +LE V+  MK+ V YLNVT M+DFRKD 
Sbjct  242  GEWYAGGKCDSDTEPLKDEKDLSPSLYPPIMGMLEDVIKWMKSPVYYLNVTIMSDFRKDG  301

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            HPS+YRK  +++EERR+ LR+QDCSHWCLPGVPD WNELLYA+LL+
Sbjct  302  HPSIYRKPNMTDEERRTTLRFQDCSHWCLPGVPDTWNELLYAQLLM  347



>gb|KJB73054.1| hypothetical protein B456_011G212300 [Gossypium raimondii]
Length=552

 Score =   333 bits (853),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 180/224 (80%), Gaps = 1/224 (0%)
 Frame = -1

Query  796  YNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTHE  617
            YNC++E+F + FLVQEWE+  + G KK ETLRLD++  SADKYK+AD+L+FNTGHWWTH+
Sbjct  311  YNCSIEYFRSAFLVQEWEMVWRNGSKK-ETLRLDMIDKSADKYKDADVLIFNTGHWWTHD  369

Query  616  KTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSGG  437
            KTSKG  YYQEG+ +Y+ L+V  AFRKALTTW +W+DT+I+  KT V FRG+SASHF GG
Sbjct  370  KTSKGNSYYQEGNTIYNRLHVKVAFRKALTTWAKWIDTNIDSTKTLVFFRGFSASHFRGG  429

Query  436  QWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPS  257
            +WNSGG C  E EPI NE YL  YP KM + E V+NGM   V YLNV+RMT FRKDAHPS
Sbjct  430  RWNSGGQCHGETEPITNEKYLKKYPSKMRIFESVINGMTNPVLYLNVSRMTGFRKDAHPS  489

Query  256  MYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            +YRKQ L+EEE+ SP R QDCSHWCLPGVPD WNEL+Y +LL+K
Sbjct  490  VYRKQNLTEEEKTSPTRIQDCSHWCLPGVPDTWNELVYTQLLIK  533



>ref|XP_006357865.1| PREDICTED: uncharacterized protein LOC102596807 [Solanum tuberosum]
Length=673

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 183/226 (81%), Gaps = 3/226 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEF  + FLVQEWEI D  G  K ETLRLDLV  S DKYK AD+LVFNTGHWWTH
Sbjct  433  DYNCSVEFVRSTFLVQEWEIPDGNGSTK-ETLRLDLVERSCDKYKGADVLVFNTGHWWTH  491

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+G+ YYQEG HVY ELNVVEAFRKA+TTW RW++ +++P KT V FRGYS SHFSG
Sbjct  492  EKTSEGKGYYQEGGHVYGELNVVEAFRKAMTTWARWIEANVDPQKTDVFFRGYSVSHFSG  551

Query  439  GQWNSGGACDHEVEPIKNETYLTP--YPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
            G+W +GG CD + EP+++E  L+P  YPP M +LE V+  MK+ V YLNVT M+DFRKD 
Sbjct  552  GEWYAGGKCDSDTEPLQDEKDLSPSLYPPIMGMLEDVIKWMKSPVHYLNVTIMSDFRKDG  611

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            HPS+YRK  +++EERR+ LRYQDCSHWCLPGVPD WNELLYA+LL+
Sbjct  612  HPSVYRKPNMTDEERRTTLRYQDCSHWCLPGVPDTWNELLYAQLLM  657



>ref|XP_007204980.1| hypothetical protein PRUPE_ppa003027mg [Prunus persica]
 gb|EMJ06179.1| hypothetical protein PRUPE_ppa003027mg [Prunus persica]
Length=610

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF +PFLV+EWE+ D  G  K ETLRLDL+  S+DKYK+AD+L+FNTGHWWT
Sbjct  369  KDYNCSVEFFRSPFLVREWEMPDANGSLK-ETLRLDLIERSSDKYKSADVLIFNTGHWWT  427

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+G+ YYQEGSH+Y ELNV EAFRKAL TW RWV+ +IN  KT V FRGYS +HF 
Sbjct  428  HEKTSRGKGYYQEGSHIYGELNVKEAFRKALMTWARWVNININLEKTIVFFRGYSPNHFR  487

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C  E EP   E     Y  KM +L+ V+  MK  + YLN+TRMTDFR+DAH
Sbjct  488  GGRWNSGGQCHGETEPTAKEANKGKYMSKMRILDSVIIEMKMPILYLNITRMTDFRRDAH  547

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRKQ  +EEER+SPLRYQDCSHWCLPGVPD WNELLYA+L+
Sbjct  548  PSIYRKQNFTEEERKSPLRYQDCSHWCLPGVPDTWNELLYAQLI  591



>gb|EMS61403.1| hypothetical protein TRIUR3_19587 [Triticum urartu]
Length=744

 Score =   334 bits (857),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 176/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+VEFF +PFLVQEWE     G KK ETLRLD+V  S+ KYK+AD ++FNTGHWWTH
Sbjct  420  DYNCSVEFFRSPFLVQEWETRVSNGNKK-ETLRLDIVEQSSPKYKDADFIIFNTGHWWTH  478

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKT+ G+DYYQEGSH+Y ELNVV+AF KAL TW RW+D ++NP KT V+FRGYSASHFSG
Sbjct  479  EKTALGKDYYQEGSHIYSELNVVDAFHKALITWSRWIDGNVNPKKTTVMFRGYSASHFSG  538

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG+CD E EPIKNE YL+ YPPKM +LE V++ M+T V YLN+TR+TD+RKDAHP
Sbjct  539  GQWNSGGSCDKETEPIKNEQYLSTYPPKMSILEDVIHKMRTPVVYLNITRLTDYRKDAHP  598

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCL  179
            S+YRKQ+LSEEERRSP RYQDCSHW +
Sbjct  599  SIYRKQHLSEEERRSPERYQDCSHWIM  625



>ref|XP_002534436.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27946.1| conserved hypothetical protein [Ricinus communis]
Length=566

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 184/231 (80%), Gaps = 2/231 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+VEFF + FLV+EWE+    G KK ETLR+D+V  SADKYKNAD+LVFNTGHWWT
Sbjct  332  EDYNCSVEFFRSNFLVREWEMLGTNGSKK-ETLRIDMVESSADKYKNADVLVFNTGHWWT  390

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+ YYQEG H+Y ELNV  AFRKA+TTW  WV+ +++P KT V+FR YS SHF 
Sbjct  391  HEKTSSGKGYYQEGDHIYDELNVDVAFRKAMTTWANWVEANVDPVKTLVVFRSYSVSHFR  450

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVS-YLNVTRMTDFRKDA  266
            GG+WNSGG CD E +P+K E      P  +++LE VL  MK   + YLNVTRMT+FRKDA
Sbjct  451  GGEWNSGGRCDGETKPLKEENEFEDDPSMVKILESVLQKMKKPAAFYLNVTRMTNFRKDA  510

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            HPS+YR+Q LSEEE+RSPLRYQDCSHWCLPGVPD WNE++Y++LL+K  +K
Sbjct  511  HPSVYREQNLSEEEKRSPLRYQDCSHWCLPGVPDTWNEIIYSQLLLKHREK  561



>gb|KHG04354.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=552

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -1

Query  796  YNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTHE  617
            YNC++E+F + FLVQEWE+  + G KK ETLRLD++  SADKYK+AD+L+FNTGHWWTH+
Sbjct  311  YNCSIEYFRSAFLVQEWEMVWRNGSKK-ETLRLDMIDKSADKYKDADVLIFNTGHWWTHD  369

Query  616  KTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSGG  437
            KTSKG  YYQEG+ +Y+ L+V  AFRKALTTW +W+DT+I+  KT V FRG+SASHF GG
Sbjct  370  KTSKGNSYYQEGNTIYNRLHVKVAFRKALTTWAKWIDTNIDSTKTLVFFRGFSASHFRGG  429

Query  436  QWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPS  257
            +WNSGG C  E +PI N  YL  YP KM + E V+NG+   V YLNV+RMT FRKDAHPS
Sbjct  430  RWNSGGQCHGETKPITNGKYLKKYPSKMRIFESVINGITNPVLYLNVSRMTGFRKDAHPS  489

Query  256  MYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVK  125
            +YRKQ L+EEE+ SP R QDCSHWCLPGVPD WNEL+Y +LL+K
Sbjct  490  VYRKQNLTEEEKTSPTRIQDCSHWCLPGVPDTWNELVYTQLLIK  533



>ref|XP_009783417.1| PREDICTED: protein trichome birefringence-like 4 [Nicotiana sylvestris]
Length=564

 Score =   328 bits (840),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 183/226 (81%), Gaps = 3/226 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YN +VEF  + FLVQEWE+ D  G  K ETLRLDLV  S DKYK ADILVFNTGHWWTH
Sbjct  324  DYNFSVEFVRSTFLVQEWEMPDGNGSTK-ETLRLDLVERSCDKYKGADILVFNTGHWWTH  382

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+G+ YYQEGSHVY ELNVVEAFRKA+TTW RW++T+++P KT V FRGYS SHFSG
Sbjct  383  EKTSEGKGYYQEGSHVYGELNVVEAFRKAMTTWARWIETNVDPLKTDVFFRGYSVSHFSG  442

Query  439  GQWNSGGACDHEVEPIKNETYLTP--YPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
            G+W +GG CD + EP+++E  L+P  YP  M +LE VL  MKT V YLNVT M+DFRKD 
Sbjct  443  GEWYAGGKCDSDTEPLQDEKDLSPSLYPSIMGMLEDVLRWMKTPVYYLNVTIMSDFRKDG  502

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            HPS+YRK  +++EERR+ +RYQDCSHWCLPGVPD WNELLYA+LL+
Sbjct  503  HPSIYRKPNMTDEERRTTIRYQDCSHWCLPGVPDTWNELLYAQLLM  548



>ref|XP_008360191.1| PREDICTED: protein trichome birefringence-like 4 [Malus domestica]
Length=544

 Score =   327 bits (837),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 181/227 (80%), Gaps = 5/227 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEYNC+VEFF + FLVQEWE+ +  G KK ETLR+DL+  S+D YKNAD+L+FNTGHWWT
Sbjct  301  EEYNCSVEFFQSRFLVQEWEMPEPSGSKK-ETLRIDLIERSSDNYKNADVLIFNTGHWWT  359

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+ YYQEGSH+Y ELNV +AFRKALTTW +W+DT++NP KT V FRGYS SHF 
Sbjct  360  HEKTSSGKGYYQEGSHIYGELNVDDAFRKALTTWAQWIDTNVNPKKTAVFFRGYSPSHFR  419

Query  442  GGQWNSGGACDHEVEP---IKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            GG WNSGG C  E +P   +++  Y   YP  M++ + VL GMKT V+YLN+T MTDFRK
Sbjct  420  GGAWNSGGHCHGETKPTTSLESTEYGGEYPTNMKIFDSVLKGMKTPVNYLNITTMTDFRK  479

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            DAHPS+YRK  L+EEER+ P+  QDCSHWCLPGVPD WNEL+YA+LL
Sbjct  480  DAHPSIYRKPNLTEEERKXPM-IQDCSHWCLPGVPDTWNELIYAQLL  525



>ref|XP_004497358.1| PREDICTED: uncharacterized protein LOC101512304 [Cicer arietinum]
Length=517

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 179/223 (80%), Gaps = 1/223 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC++EFF +PFLVQEWEI D+KG  K ETLRLDLV  S DKYKNAD+L+FNTGHWWTH
Sbjct  284  DYNCSIEFFRSPFLVQEWEIPDRKGSIK-ETLRLDLVERSCDKYKNADVLIFNTGHWWTH  342

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EK  +G++YYQEG+H++ +LNV EAF KAL TW  WVDT+INP KT V FRGYS SHF G
Sbjct  343  EKRIEGKEYYQEGNHIHGQLNVEEAFSKALFTWSHWVDTNINPKKTIVFFRGYSPSHFRG  402

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            G+W SGG C++E EP+KNE+ L+  PP M+ +E V+  MKT V YLN+T+MTDFR DAHP
Sbjct  403  GEWFSGGQCENETEPMKNESDLSENPPMMKTIESVIERMKTPVFYLNITKMTDFRLDAHP  462

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            SMYR   +SEE ++  L +QDCSHWCLPGVPD WNEL+YA LL
Sbjct  463  SMYRNMNMSEENKKYMLTHQDCSHWCLPGVPDLWNELVYARLL  505



>ref|XP_009376704.1| PREDICTED: protein trichome birefringence-like 4 [Pyrus x bretschneideri]
Length=621

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 180/227 (79%), Gaps = 5/227 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEYNC+VEFF + FLVQEWE+ +  G KK ETLR+DL+  S+D YKNAD+L+FNTGHWWT
Sbjct  378  EEYNCSVEFFQSRFLVQEWEMLEPSGSKK-ETLRIDLIERSSDNYKNADVLIFNTGHWWT  436

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+ YYQEGSH+Y EL V  AFRKALTTW RW+DT++NP KT V FRGYS SHF 
Sbjct  437  HEKTSSGKGYYQEGSHIYGELKVDNAFRKALTTWARWIDTNVNPKKTAVFFRGYSPSHFR  496

Query  442  GGQWNSGGACDHEVEP---IKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            GG WNSGG C  E +P   +++  Y   YP  M++L+ VL GMKT V+YLN+T MTDFRK
Sbjct  497  GGAWNSGGHCHGETKPTTSLESTEYGGEYPTNMKILDSVLKGMKTPVNYLNITTMTDFRK  556

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            DAHPS+YRK  L+EEER+ P+  QDCSHWCLPGVPD WNEL+YA+LL
Sbjct  557  DAHPSIYRKPNLTEEERKPPM-IQDCSHWCLPGVPDTWNELIYAQLL  602



>ref|XP_009364158.1| PREDICTED: protein trichome birefringence-like 1 [Pyrus x bretschneideri]
Length=620

 Score =   327 bits (837),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 188/237 (79%), Gaps = 5/237 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +EYNC+VEFF + FLVQEWE+ +  G KK ETLR+DL+  S+D YKNAD+L+FNTGHWWT
Sbjct  377  KEYNCSVEFFQSRFLVQEWEMPEPSGSKK-ETLRIDLIERSSDNYKNADVLIFNTGHWWT  435

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKT  G+ YYQEGSH+Y EL+V +AFRKAL+TW RW+DT++NP KT V FRGYS SHF 
Sbjct  436  HEKTLSGKGYYQEGSHIYGELDVDDAFRKALSTWARWIDTNVNPKKTAVFFRGYSPSHFR  495

Query  442  GGQWNSGGACDHEVEP---IKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            GG+WNSGG C  E++P   +++  Y   YP  M++L+ VL GMKT V+YLN+T MTDFRK
Sbjct  496  GGEWNSGGHCHGEIKPTTSLESTEYGGEYPTNMKILDSVLKGMKTPVNYLNITTMTDFRK  555

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            DAHPS+YRK  L+EEER+ P+  QDCSHWCLPGVPD WNEL+Y++LL +  ++  +K
Sbjct  556  DAHPSIYRKPNLTEEERKPPM-IQDCSHWCLPGVPDTWNELIYSQLLKRNQKQHREK  611



>ref|XP_010673529.1| PREDICTED: protein trichome birefringence-like [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score =   318 bits (816),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 184/230 (80%), Gaps = 5/230 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+VEFF +PFLV+EWEI D+ G KK ETLRLDLV  S++KYK+AD L+FNTGHWW+
Sbjct  147  EDYNCSVEFFRSPFLVREWEIPDENGLKK-ETLRLDLVESSSEKYKDADFLIFNTGHWWS  205

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GE YYQEGSHVY +L V EA R+A+TTWGRW+D ++N  KT V FRGYS SHF 
Sbjct  206  HEKTSRGESYYQEGSHVYTQLEVNEAIRRAVTTWGRWLDANVNHTKTQVFFRGYSNSHFG  265

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WN+GG CD   EPIKN+T L   PP ++V+E V+   K  V YLN+T +TD+RKDAH
Sbjct  266  GGKWNAGGKCDMYTEPIKNDTDLPEQPPMIKVVENVIKWTKVPVYYLNITTLTDYRKDAH  325

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQK  113
            P+ YR Q    +ERR+P RYQDC+HWCLPGVPD WNEL+Y+++L++ +QK
Sbjct  326  PAAYRTQ----QERRAPSRYQDCAHWCLPGVPDTWNELVYSQILIRLHQK  371



>ref|XP_008361466.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=621

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 187/237 (79%), Gaps = 5/237 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEYNC+VEFF + FLVQEWE+ +  G KK ETLR+DL+  S++ YKNAD+L+FNTGHWWT
Sbjct  378  EEYNCSVEFFQSRFLVQEWEMPEPSGSKK-ETLRIDLIERSSBNYKNADVLIFNTGHWWT  436

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKT  G+ YYQEGSH+Y EL+V +AFRKAL+TW RW+DT++NP KT V FRGYS SHF 
Sbjct  437  HEKTLSGKGYYQEGSHIYGELDVDDAFRKALSTWARWIDTNVNPKKTAVFFRGYSPSHFR  496

Query  442  GGQWNSGGACDHEVEP---IKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            GG+WNSGG C  E +P   +++  Y   YP  M++L+ VL GMKT V+YLN+T MTDFRK
Sbjct  497  GGEWNSGGHCHGETKPTTSLESTEYGGEYPTNMKILDSVLKGMKTPVNYLNITTMTDFRK  556

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            DAHPS+YRK  L+EEER+ P+  QDCSHWCLPGVPD WNEL+YA+LL +  ++  +K
Sbjct  557  DAHPSIYRKPNLTEEERKPPM-IQDCSHWCLPGVPDTWNELIYAQLLKRNQKQHREK  612



>ref|XP_011037956.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=554

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 180/233 (77%), Gaps = 2/233 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YN +VEFF +PFLVQEWE+  K G KK ETLRLD++  S+DKYK AD+L+FNTGHWWT
Sbjct  311  EDYNSSVEFFQSPFLVQEWEMEGKNGSKK-ETLRLDMLERSSDKYKTADVLIFNTGHWWT  369

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKT  G  YYQEGSHVY +LNV +AFRKAL TW RWV+T  +P KT V FRGYS SHF 
Sbjct  370  HEKTLDGRGYYQEGSHVYSQLNVDKAFRKALRTWARWVETKTDPFKTLVFFRGYSVSHFR  429

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+W+SGG CD E +P+  ETY    PP +++LE  L  MKT V YLNVTRMT+FR+DAH
Sbjct  430  GGEWDSGGKCDSETKPLMEETYFEEDPPMVKILESTLKRMKTPVFYLNVTRMTNFRRDAH  489

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSK  104
            PS+YR+Q ++EEER S  R QDCSHWCLPGVPD WNE++Y+ LL K  QK  K
Sbjct  490  PSVYREQNMTEEERSSS-RVQDCSHWCLPGVPDTWNEIIYSHLLFKHKQKELK  541



>ref|XP_008363352.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=342

 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 177/227 (78%), Gaps = 5/227 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            EEYNC+VEFF + FLVQEWE+ +  G KK ETLR+DL+  S+D YKNAD+L+FNTGHW T
Sbjct  99   EEYNCSVEFFQSRFLVQEWEMXEPSGSKK-ETLRIDLIERSSDNYKNADVLIFNTGHWXT  157

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+ YYQEGSH+Y ELNV +AFRKALTTW  W+DT++NP KT V FRGYS SHF 
Sbjct  158  HEKTSSGKGYYQEGSHIYGELNVDDAFRKALTTWAXWIDTNVNPKKTAVFFRGYSPSHFR  217

Query  442  GGQWNSGGACDHEVEP---IKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            GG WNSGG C  E +P   +++  Y   YP  M++ + VL GMKT V+YLN+T MTDFRK
Sbjct  218  GGAWNSGGHCHGETKPTTSLESTEYGGAYPTNMKIFDSVLKGMKTPVNYLNITTMTDFRK  277

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            DAHPS+YRK  L+EEER+ P+   DCSHWCLPGVPD WN L+YA+LL
Sbjct  278  DAHPSIYRKPNLTEEERKXPM-IXDCSHWCLPGVPDTWNXLIYAQLL  323



>gb|AES97753.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
 gb|AES63045.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=528

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 178/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC++EFF +PFLVQEWE+  KKG KK ETLRLDLV  S DKYKNAD+L+FNTGHWWTH
Sbjct  294  DYNCSIEFFRSPFLVQEWEMPGKKGSKK-ETLRLDLVERSCDKYKNADVLIFNTGHWWTH  352

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKT +G++YYQEG+H++ +LNV EA  KA  TW RWVDT+I+P KT V FRGYS SHF G
Sbjct  353  EKTMEGKEYYQEGNHIHGQLNVEEAISKAFLTWSRWVDTNIDPKKTIVFFRGYSPSHFRG  412

Query  439  GQWNSGGACDHEVEPIKNE-TYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            G+W+SGG C+ E EP+K E T L+  PP M  +E V+ GMKT V YLN+++MTDFR DAH
Sbjct  413  GEWDSGGRCESETEPMKTESTDLSENPPMMRTIESVIKGMKTPVVYLNISKMTDFRHDAH  472

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PSMYR   +SEE ++  L++QDCSHWCLPGVPD WNE +YA LL
Sbjct  473  PSMYRNMNMSEETKKYMLKHQDCSHWCLPGVPDLWNEFVYAHLL  516



>ref|XP_008229144.1| PREDICTED: protein trichome birefringence-like 4 [Prunus mume]
Length=616

 Score =   325 bits (832),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 178/227 (78%), Gaps = 5/227 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+VEFF + FLVQEWE+ +  G KK ETLR+DL+  S+D YKNAD+L+FNTGHWWT
Sbjct  373  EDYNCSVEFFQSRFLVQEWEMPEPSGSKK-ETLRIDLIERSSDNYKNADVLIFNTGHWWT  431

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+ YYQEGSHVY ELNV +AF KALTTW RWVDT+INP KT V FRGYS SHF 
Sbjct  432  HEKTSSGKGYYQEGSHVYGELNVDDAFEKALTTWARWVDTNINPKKTAVFFRGYSPSHFR  491

Query  442  GGQWNSGGACDHEVEPIKN---ETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            GG+WNSGG C  E +P  N     Y   YP  M++L+ V+  MKT + YLN+T MTDFRK
Sbjct  492  GGEWNSGGHCHGETKPTTNMESTEYGGEYPSNMKILDSVVKKMKTPIFYLNITTMTDFRK  551

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            DAHPS+YRK  L+EEER+ P+  QDCSHWCLPGVPD WNEL+YA+LL
Sbjct  552  DAHPSIYRKPNLTEEERKPPM-IQDCSHWCLPGVPDTWNELIYAQLL  597



>ref|XP_007207689.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
 gb|EMJ08888.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
Length=541

 Score =   322 bits (825),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 180/227 (79%), Gaps = 5/227 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+VEFF + FLVQEWE+ +  G KK ETLR+DL+  S+D YKNAD+L+FNTGHWWT
Sbjct  298  EDYNCSVEFFQSRFLVQEWEMPEPSGSKK-ETLRIDLIERSSDNYKNADVLIFNTGHWWT  356

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+ YYQEGSHVY ELNV +AF KALTTW RWVDT++NP KT V FRGYS SHF 
Sbjct  357  HEKTSSGKGYYQEGSHVYGELNVDDAFEKALTTWARWVDTNVNPNKTAVFFRGYSPSHFR  416

Query  442  GGQWNSGGACDHEVEP---IKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            GG+WNSGG C  E +P   +++  Y   YP  M++L+ V+  MKT + YLN+T MTDFRK
Sbjct  417  GGEWNSGGHCHGETKPTTKMESTEYGGEYPSNMKILDSVVKKMKTPIFYLNITTMTDFRK  476

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            DAHPS+YRK  L+EEER+ P+  QDCSHWCLPGVPD WNEL+YA+LL
Sbjct  477  DAHPSIYRKPNLTEEERKPPM-IQDCSHWCLPGVPDTWNELIYAQLL  522



>ref|XP_006841061.1| hypothetical protein AMTR_s00085p00172090 [Amborella trichopoda]
 gb|ERN02736.1| hypothetical protein AMTR_s00085p00172090 [Amborella trichopoda]
Length=495

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 179/228 (79%), Gaps = 1/228 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E YNC+VEF  APFLVQEW +    G ++ ETLRLDL+     KY+ AD++VFNTGHWWT
Sbjct  269  EGYNCSVEFVRAPFLVQEWSVNGTNGTEE-ETLRLDLMDKKTLKYREADVIVFNTGHWWT  327

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+DYYQEG +VY  LNV+EA+RKALTT  +WVD +IN  KT+V FRG+S +HFS
Sbjct  328  HEKTSLGKDYYQEGDYVYPSLNVMEAYRKALTTLAKWVDENINSTKTWVFFRGFSITHFS  387

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C  E EPI N  YL  YPPKM+VLE VL+ MKT V+YLN++RMTD+RKDAH
Sbjct  388  GGRWNSGGQCHKETEPIYNNAYLKKYPPKMKVLESVLHKMKTHVTYLNISRMTDYRKDAH  447

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQY  119
            PS+YRKQ+ S EE  +  + QDCSHWCLPGVPD WNELLYA LL+K +
Sbjct  448  PSVYRKQFKSPEEFAAAEKSQDCSHWCLPGVPDTWNELLYASLLIKGF  495



>ref|XP_004296154.1| PREDICTED: protein trichome birefringence-like 4 [Fragaria vesca 
subsp. vesca]
Length=520

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 175/224 (78%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEF  +PFLVQE E+    G KK ETL LD++  S D YK++D+LVFNTGHWWT
Sbjct  292  KDYNCSVEFVQSPFLVQESEVLTTNGSKK-ETLHLDMIHRSLDNYKSSDVLVFNTGHWWT  350

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+G+ YYQEG HVY +LNV EA+ KA+ TW RW+D +INP KT V FRGYS +HFS
Sbjct  351  HEKTSRGQGYYQEGDHVYDQLNVKEAYGKAIATWARWLDANINPEKTIVFFRGYSPNHFS  410

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WN+GG C    EPI+ E Y   YP KM +L+ V+  MKT + YLN+T+MTDFR+DAH
Sbjct  411  GGRWNTGGQCHGRTEPIQYEAYKGKYPAKMRILDSVIREMKTPIFYLNITKMTDFRRDAH  470

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRKQ L+EE+R+  LR QDCSHWCLPGVPD WNELLYA LL
Sbjct  471  PSVYRKQNLTEEDRQLSLRSQDCSHWCLPGVPDTWNELLYAHLL  514



>gb|KDP44302.1| hypothetical protein JCGZ_19169 [Jatropha curcas]
Length=419

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 181/234 (77%), Gaps = 1/234 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YN TVEF  + FLV+EWEI    G  K ETLR+D++  S DKYKNAD+LVFNTGHWWT
Sbjct  177  QDYNFTVEFSRSNFLVEEWEIPQTNGSVK-ETLRIDMLERSVDKYKNADVLVFNTGHWWT  235

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G+D+YQEG HVY EL V  AFRKA+TTW RWV+ +++P KT V+FR YS SHF 
Sbjct  236  HEKTSSGKDFYQEGDHVYDELKVEIAFRKAMTTWVRWVEANVDPFKTLVVFRSYSVSHFR  295

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG WNSGG CD E EP+K+ET     P  + +LE V+  MK  V +LNVTRMT+FRKDAH
Sbjct  296  GGVWNSGGHCDGETEPLKDETEFEADPFLVPILESVIEEMKAPVFFLNVTRMTNFRKDAH  355

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS+YR+Q + EEE+RSPL++QDCSHWCLPGVPD W E++YA+LL+K  Q+  ++
Sbjct  356  PSIYREQDIPEEEKRSPLKHQDCSHWCLPGVPDTWTEIIYAQLLLKHKQRKQQR  409



>ref|XP_002297655.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa]
 gb|EEE82460.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa]
Length=535

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 175/224 (78%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YN +VEFF +PFLVQEWE+  K G KK ETLRLD++  S+D YK AD+L+FNTGHWWT
Sbjct  299  EDYNSSVEFFQSPFLVQEWEMEGKNGSKK-ETLRLDMLERSSDNYKTADVLIFNTGHWWT  357

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKT  G  YYQEGSHVY +LNV +AFRKAL TW RWV+T  +P KT V FRGYS SHF 
Sbjct  358  HEKTLDGRGYYQEGSHVYSQLNVDKAFRKALRTWARWVETKTDPFKTLVFFRGYSVSHFR  417

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+W+SGG CD E +P+  ETY    PP +++LE  L  MKT V YLNVTRMT+FR+DAH
Sbjct  418  GGEWDSGGKCDSETKPLMEETYFEEDPPMVKILESTLKRMKTPVFYLNVTRMTNFRRDAH  477

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR+Q ++EEE RS  R QDCSHWCLPGVPD WNE++Y+ LL
Sbjct  478  PSVYREQNMTEEE-RSLSRVQDCSHWCLPGVPDTWNEIVYSHLL  520



>ref|XP_006854129.1| hypothetical protein AMTR_s00048p00162020 [Amborella trichopoda]
 gb|ERN15596.1| hypothetical protein AMTR_s00048p00162020 [Amborella trichopoda]
Length=533

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 177/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNCTVEFF APFLV+EW+  D     ++ETLRLD++  S+ KY +AD+++FNTGHWWTH
Sbjct  299  DYNCTVEFFRAPFLVREWKTPDPGSGARRETLRLDVIERSSSKYIDADMIIFNTGHWWTH  358

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            +KTSKG+DYYQEG+HVY EL V EAFR+AL TW  WVD +I+P +T + FRGYSASHF G
Sbjct  359  DKTSKGKDYYQEGNHVYSELKVAEAFRRALRTWAEWVDINIDPNRTKLFFRGYSASHFRG  418

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            G+WNSGG+C +E  PI NE++L PYP KM +LE VL+ M+T+V YLN+TRMTD+RKD HP
Sbjct  419  GRWNSGGSCRNETVPISNESHLMPYPAKMSILESVLSSMQTKVLYLNITRMTDYRKDGHP  478

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            S++R      ++  +  + QDCSHWCLPGVPD WNELLYA LL+
Sbjct  479  SVFRNPITGNQQFTN--KAQDCSHWCLPGVPDAWNELLYATLLI  520



>gb|KFK38571.1| hypothetical protein AALP_AA3G130800 [Arabis alpina]
Length=722

 Score =   317 bits (811),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 169/193 (88%), Gaps = 1/193 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y+CTVEF+ +PFLVQEWE+ DK G  KKETLRLDLV  S+++YK ADILVFNTGHWWT
Sbjct  288  KDYDCTVEFYASPFLVQEWEVEDKNG-TKKETLRLDLVGKSSEQYKGADILVFNTGHWWT  346

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEGS+VY +L+V EAF KALTTW RWVD ++NP K+ V FRGYS SHFS
Sbjct  347  HEKTSKGEDYYQEGSNVYPKLDVDEAFWKALTTWSRWVDKNVNPKKSLVFFRGYSPSHFS  406

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWN+GGACD E EPIKNETYLTPYP KME+LERVL GMKT V+Y+N+TR+TD+RKDAH
Sbjct  407  GGQWNAGGACDDETEPIKNETYLTPYPSKMEILERVLRGMKTPVTYVNITRLTDYRKDAH  466

Query  262  PSMYRKQYLSEEE  224
            PS+YRKQ LS EE
Sbjct  467  PSIYRKQKLSVEE  479



>ref|XP_010268038.1| PREDICTED: protein trichome birefringence-like 4 [Nelumbo nucifera]
Length=467

 Score =   309 bits (791),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            EYNC++EFF +PFLVQEW+I D  G  +KETLRLDL+  S+ KY NADI++FNTGHWWTH
Sbjct  244  EYNCSIEFFRSPFLVQEWKINDSTG-ARKETLRLDLIHGSSSKYFNADIIIFNTGHWWTH  302

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            +KTS+G+DY+QEG HV+ +L V EA+ KAL TW RWVD +I+  +T V FRGYSASHF G
Sbjct  303  QKTSRGKDYFQEGDHVHSKLGVAEAYTKALHTWARWVDGNIDSDRTRVFFRGYSASHFRG  362

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQW+SGG C++E +PI N +YL PYP  M +LE V+  M+T V YLNVTRMTD+RKD HP
Sbjct  363  GQWSSGGNCENETQPITNSSYLAPYPQMMNILESVIREMRTPVFYLNVTRMTDYRKDGHP  422

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            S++R+    +  R++    QDCSHWCLPGVPD WN+LLY  LL+   Q
Sbjct  423  SIFRQ---PKGHRQAAGMIQDCSHWCLPGVPDVWNQLLYTALLISSRQ  467



>gb|EMT28517.1| hypothetical protein F775_15700 [Aegilops tauschii]
Length=426

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 170/216 (79%), Gaps = 17/216 (8%)
 Frame = -1

Query  763  FLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTHEKTSKGEDYYQE  584
            FL QEW++   +G KKKETLRLD +  S+ +YKNAD++VFNTGHWWTHEKTS G+DYYQE
Sbjct  224  FLFQEWDMLVTRG-KKKETLRLDKIDQSSSRYKNADVIVFNTGHWWTHEKTSLGKDYYQE  282

Query  583  GSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSGGQWNSGGACDHE  404
            G+ VY +LNV +A+R+AL TW R                GYSASHFSGGQWNSGG+CD E
Sbjct  283  GNQVYSQLNVHDAYRRALNTWAR----------------GYSASHFSGGQWNSGGSCDKE  326

Query  403  VEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPSMYRKQYLSEEE  224
             EPI N  YL PYP KM +LE VL+GMKT V+YLN+TRMTD+RK+ HPS+YRKQ LSEEE
Sbjct  327  TEPITNGKYLMPYPQKMSILEEVLHGMKTPVAYLNITRMTDYRKEGHPSVYRKQKLSEEE  386

Query  223  RRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            R+SP  YQDCSHWCLPGVPD WNELLYA++LVKQ+Q
Sbjct  387  RKSPELYQDCSHWCLPGVPDSWNELLYAQILVKQHQ  422



>ref|XP_003592794.1| hypothetical protein MTR_1g116130 [Medicago truncatula]
 ref|XP_003614795.1| hypothetical protein MTR_5g059400 [Medicago truncatula]
Length=555

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 179/251 (71%), Gaps = 29/251 (12%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC++EFF +PFLVQEWE+  KKG KK ETLRLDLV  S DKYKNAD+L+FNTGHWWTH
Sbjct  294  DYNCSIEFFRSPFLVQEWEMPGKKGSKK-ETLRLDLVERSCDKYKNADVLIFNTGHWWTH  352

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS-  443
            EKT +G++YYQEG+H++ +LNV EA  KA  TW RWVDT+I+P KT V FRGYS SHFS 
Sbjct  353  EKTMEGKEYYQEGNHIHGQLNVEEAISKAFLTWSRWVDTNIDPKKTIVFFRGYSPSHFST  412

Query  442  --------------------------GGQWNSGGACDHEVEPIKNE-TYLTPYPPKMEVL  344
                                      GG+W+SGG C+ E EP+K E T L+  PP M  +
Sbjct  413  SLENKNIFEHLLALGFRIIPPCFCYRGGEWDSGGRCESETEPMKTESTDLSENPPMMRTI  472

Query  343  ERVLNGMKTQVSYLNVTRMTDFRKDAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPD  164
            E V+ GMKT V YLN+++MTDFR DAHPSMYR   +SEE ++  L++QDCSHWCLPGVPD
Sbjct  473  ESVIKGMKTPVVYLNISKMTDFRHDAHPSMYRNMNMSEETKKYMLKHQDCSHWCLPGVPD  532

Query  163  YWNELLYAELL  131
             WNE +YA LL
Sbjct  533  LWNEFVYAHLL  543



>ref|XP_004143065.1| PREDICTED: uncharacterized protein LOC101210768 [Cucumis sativus]
 ref|XP_004159591.1| PREDICTED: uncharacterized LOC101210768 [Cucumis sativus]
 gb|KGN62305.1| hypothetical protein Csa_2G348910 [Cucumis sativus]
Length=553

 Score =   309 bits (792),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 179/224 (80%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     K G    ETLRLDL+  + + Y+++D+LVFNTGHWWT
Sbjct  323  EDYNCSVDFVSSPFLVRESSFKRKNGTI--ETLRLDLMDPTTEMYRDSDVLVFNTGHWWT  380

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS+GEDYYQEG+HV+ +L V+EAF++ALTTWGRW+D +++  +T V FRGYS SHFS
Sbjct  381  HDKTSRGEDYYQEGNHVHSKLKVLEAFKRALTTWGRWIDNNVDKNRTLVFFRGYSYSHFS  440

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C+ E EPI N+T+L  YP KM  LE V+  MKT VSYLN+TR+T +RKDAH
Sbjct  441  GGEWNSGGQCNIETEPIYNKTHLGKYPKKMRALEYVIQEMKTPVSYLNITRLTHYRKDAH  500

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +E E+R+ LR QDCSHWCLPGVPD WNELLYA +L
Sbjct  501  PSIYRMEYKTEAEKRAGLRVQDCSHWCLPGVPDTWNELLYASVL  544



>gb|KHN27090.1| hypothetical protein glysoja_032858 [Glycine soja]
Length=295

 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 177/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF + FLVQEWEI D+KG  K ETLRLDL+  S DKYK+AD+L+FNTGHWWT
Sbjct  62   QDYNCSVEFFRSVFLVQEWEIPDQKGSTK-ETLRLDLLERSCDKYKDADVLIFNTGHWWT  120

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEK  +G+ YYQEG H+Y ++NV EAF KAL TW +W+D++++P KT V FRGYS SHF 
Sbjct  121  HEKRIEGKGYYQEGDHIYGQMNVEEAFHKALLTWAQWIDSNVDPKKTTVFFRGYSPSHFR  180

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG CD+E EP+++E+ L   P  M  ++ V+  MKT V YLN+T+MT FR+DAH
Sbjct  181  GGEWNSGGKCDNETEPMESESDLET-PEMMMTIDSVIKKMKTPVFYLNITKMTYFRRDAH  239

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS++R + ++EE +R  L +QDCSHWCLPGVPD WNEL+YA LL
Sbjct  240  PSLFRNENMTEETKRYMLSHQDCSHWCLPGVPDLWNELVYAHLL  283



>ref|XP_008444354.1| PREDICTED: protein trichome birefringence-like 2 [Cucumis melo]
Length=551

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 178/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     + G    ETLRLD +  + + Y++AD+LVFNTGHWWT
Sbjct  321  EDYNCSVDFVSSPFLVRESSFKRRNGTI--ETLRLDQMDPTTEMYRDADVLVFNTGHWWT  378

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+HV+ +L V+EAF++ALTTWGRW+D +++  +T V FRGYS SHFS
Sbjct  379  HEKTSRGEDYYQEGNHVHSKLKVLEAFKRALTTWGRWIDNNVDKNRTLVFFRGYSYSHFS  438

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG C+ E EPI N+T+L  YP KM  LE V+  MKT VSYLN+TR+T +RKDAH
Sbjct  439  GGEWNSGGQCNIETEPIYNKTHLGKYPKKMRALEYVIQEMKTPVSYLNITRLTHYRKDAH  498

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +E E+R+ LR QDCSHWCLPGVPD WNELLYA +L
Sbjct  499  PSIYRMEYKTEAEKRAGLRVQDCSHWCLPGVPDTWNELLYASVL  542



>ref|XP_008389689.1| PREDICTED: protein trichome birefringence-like 2 [Malus domestica]
Length=595

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 172/224 (77%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F V+PFLV+E     K G    ETLRLDL+  +   Y +AD++VFNTGHWWT
Sbjct  365  EDYNCSVDFVVSPFLVRESSFTSKNGTF--ETLRLDLMDRTTSMYHDADVIVFNTGHWWT  422

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+HV+  L V+EA+++ALTTW RWVD +I+  +T V FRGYS +HFS
Sbjct  423  HEKTSRGEDYYQEGNHVHPRLKVLEAYKRALTTWARWVDKYIDVNRTQVFFRGYSVTHFS  482

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  YP KM  LE VL  MK+ V YLN++R+TD+RKD H
Sbjct  483  GGQWNSGGQCHKETEPIFNETYLANYPSKMRALEHVLKEMKSPVIYLNISRLTDYRKDGH  542

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y + EE+ +  R QDCSHWCLPGVPD WNELLYA LL
Sbjct  543  PSIYRMKYKTVEEQITAERSQDCSHWCLPGVPDAWNELLYAALL  586



>ref|XP_007044711.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
 gb|EOY00543.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
Length=643

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 173/224 (77%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  APFLV+E     + G    ETLRLDL+  +   Y +A+++VFNTGHWWT
Sbjct  402  EDYNCSVDFVAAPFLVKESSFRGENGSI--ETLRLDLMDPATSMYHDAELMVFNTGHWWT  459

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEG +VY  L V++A++KALTTW RW+D +++ ++  + FRGYS +HF 
Sbjct  460  HEKTSKGEDYYQEGDYVYPRLKVLKAYQKALTTWSRWIDKNVDSSRAQIFFRGYSVTHFR  519

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYLT YP KM  +E VL   KT V YLN++R+TD+RKDAH
Sbjct  520  GGQWNSGGKCHQETEPISNETYLTKYPSKMRAVELVLQKTKTPVIYLNISRLTDYRKDAH  579

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR++Y +EEER + +R QDCSHWCLPGVPD WNELLYA LL
Sbjct  580  PSIYRREYKTEEERNAAVRVQDCSHWCLPGVPDTWNELLYASLL  623



>ref|XP_003555633.2| PREDICTED: protein YLS7-like [Glycine max]
Length=525

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 177/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF + FLVQEWEI D+KG  K ETLRLDL+  S DKYK+AD+L+FNTGHWWT
Sbjct  292  QDYNCSVEFFRSVFLVQEWEIPDQKGSTK-ETLRLDLLERSCDKYKDADVLIFNTGHWWT  350

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEK  +G+ YYQEG H+Y ++NV EAF KAL TW +W+D++++P KT V FRGYS SHF 
Sbjct  351  HEKRIEGKGYYQEGDHIYGQMNVEEAFHKALLTWAQWIDSNVDPKKTTVFFRGYSPSHFR  410

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG CD+E EP+++E+ L   P  M  ++ V+  MKT V YLN+T+MT FR+DAH
Sbjct  411  GGEWNSGGKCDNETEPMESESDLE-TPEMMMTIDSVIKKMKTPVFYLNITKMTYFRRDAH  469

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS++R + ++EE +R  L +QDCSHWCLPGVPD WNEL+YA LL
Sbjct  470  PSLFRNENMTEETKRYMLSHQDCSHWCLPGVPDLWNELVYAHLL  513



>ref|XP_004298485.1| PREDICTED: protein trichome birefringence-like 2 [Fragaria vesca 
subsp. vesca]
Length=611

 Score =   305 bits (782),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 175/225 (78%), Gaps = 4/225 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKK-KETLRLDLVAHSADKYKNADILVFNTGHWW  626
            EEYNC+V+F VAPFLV++   +  KG+    ETLRLDL+  +   Y++AD+LVFNTGHWW
Sbjct  381  EEYNCSVDFVVAPFLVRK---SSFKGKNSWFETLRLDLMDPTTKTYRDADVLVFNTGHWW  437

Query  625  THEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHF  446
            THEKTSKGEDYYQEG++V+  L  +EA+++ALTTW RWVDT+IN  KT V FRGYS +HF
Sbjct  438  THEKTSKGEDYYQEGNYVHPRLKALEAYKRALTTWARWVDTYINANKTRVFFRGYSVTHF  497

Query  445  SGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
            SGGQWNSGG C  E EPI NETYLT YP KM  LE VL  MKT V+YLN+TR+TD+RKD 
Sbjct  498  SGGQWNSGGQCHRETEPIFNETYLTHYPSKMRALESVLKEMKTPVTYLNITRLTDYRKDG  557

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +++ +    + QDCSHWCLPGVPD WNELLYA LL
Sbjct  558  HPSIYRTIYKTKQAQIKAEQSQDCSHWCLPGVPDTWNELLYALLL  602



>gb|EYU44005.1| hypothetical protein MIMGU_mgv1a026273mg [Erythranthe guttata]
Length=456

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 180/232 (78%), Gaps = 5/232 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +++NC+++F  +PFLVQEW+  DK G ++ ETLRLD++  S +KY +AD++VFNTGHWWT
Sbjct  226  KDFNCSIDFVKSPFLVQEWKFLDKAGTRR-ETLRLDMMEGSYNKYYDADVIVFNTGHWWT  284

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT +G+ Y+QEG+HVY++L V +A++KAL TW +WVD +I+ +KT V FRGYSASHF 
Sbjct  285  HQKTFQGKYYFQEGNHVYNKLAVADAYKKALKTWAQWVDENIDSSKTSVFFRGYSASHFK  344

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+CD E +PI NET L+PYP  M  LE VL  MKT V YLN+T+MTD+RKD H
Sbjct  345  GGQWNSGGSCDGETKPITNETQLSPYPWMMRALESVLMKMKTPVFYLNITKMTDYRKDGH  404

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSS  107
            PS++R+   + + R     +QDCSHWCLPGVPD WNELLYA L+  Q QK S
Sbjct  405  PSIFRRSSSNIKNR----VFQDCSHWCLPGVPDSWNELLYAILVQSQNQKLS  452



>ref|XP_004229072.1| PREDICTED: protein trichome birefringence-like 4 [Solanum lycopersicum]
Length=465

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 174/232 (75%), Gaps = 6/232 (3%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +++ C+++F  +PFLVQEW  +DK G ++ ETLRLD +  S  KY +ADI++FNTGHWWT
Sbjct  229  KDFKCSIDFIKSPFLVQEWRFSDKAGARR-ETLRLDTIHGSLTKYHDADIIIFNTGHWWT  287

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT K  +Y+QEG+HVY+ L V +A+ KAL TW  WVDT IN  KT V FRGYSASHF 
Sbjct  288  HQKTHKVSNYFQEGNHVYNRLEVADAYTKALKTWAHWVDTTINSTKTRVFFRGYSASHFK  347

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PI NET L PYP  M VLE V++ MKT V YLN+T+MTD+RK+ H
Sbjct  348  GGQWNSGGNCDGETKPITNETQLGPYPWMMRVLESVISEMKTPVVYLNITKMTDYRKEGH  407

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSS  107
            PS++R      + +R P  +QDCSHWCLPG+PD WN+LLYA LL + +QKSS
Sbjct  408  PSIFR----GAKSKRRPGMFQDCSHWCLPGIPDSWNQLLYATLL-QSHQKSS  454



>gb|KHN37297.1| hypothetical protein glysoja_013512 [Glycine soja]
Length=526

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 176/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF + FLVQEWE  D KG  K ETLRLD++  S DKYK+AD+L+FNTGHWWT
Sbjct  293  QDYNCSVEFFRSVFLVQEWETPDLKGSTK-ETLRLDVLERSCDKYKDADVLIFNTGHWWT  351

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEK  +G+ YYQEG+H+Y ++NV EAF KAL TW +W+D++I+P KT V FRGYS SHF 
Sbjct  352  HEKRIEGKGYYQEGNHIYGQMNVEEAFHKALLTWAQWIDSNIDPKKTTVFFRGYSPSHFR  411

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG CD+E EP+++E+ L   P  M  ++ V+  MKT V YLN+T+MT FR+DAH
Sbjct  412  GGEWNSGGKCDNETEPLESESDLE-TPEMMMTIDSVIKKMKTPVFYLNITKMTYFRRDAH  470

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS++R + ++EE +R  L +QDCSHWCLPGVPD WNEL+YA LL
Sbjct  471  PSLFRNENMTEETKRHMLTHQDCSHWCLPGVPDLWNELVYAHLL  514



>ref|XP_011461651.1| PREDICTED: protein trichome birefringence-like 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=776

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF + FLVQEWE  DK G KK ETLR+DL+  +AD YK+AD L+FNTGHWWT
Sbjct  542  QDYNCSVEFFQSQFLVQEWEGKDKNGSKK-ETLRIDLMESAADNYKDADFLIFNTGHWWT  600

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G  YYQEG HVY ELN  EA+R+AL+TWGRW+DT ++P KT V FRGYS SHF 
Sbjct  601  HEKTSNGLGYYQEGDHVYDELNGEEAYRRALSTWGRWLDTKVDPKKTAVFFRGYSLSHFR  660

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            G  WN+GG CD E +P     Y   YP  +++ E VL  MKT + YLN+T MTDFRKDAH
Sbjct  661  GAAWNAGGKCDGETKPTTETEYGGEYPSYVKIFESVLEKMKTPILYLNITAMTDFRKDAH  720

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS YRK  L+ EER++    QDCSHWCLPGVP+ WNELL+A+LL
Sbjct  721  PSFYRKPNLTAEERQA-TSIQDCSHWCLPGVPETWNELLFAQLL  763



>ref|XP_006590231.1| PREDICTED: protein YLS7-like [Glycine max]
Length=524

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 176/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF + FLVQEWE  D KG  K ETLRLD++  S DKYK+AD+L+FNTGHWWT
Sbjct  293  QDYNCSVEFFRSVFLVQEWETPDLKGSTK-ETLRLDVLERSCDKYKDADVLIFNTGHWWT  351

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEK  +G+ YYQEG+H+Y ++NV EAF KAL TW +W+D++I+P KT V FRGYS SHF 
Sbjct  352  HEKRIEGKGYYQEGNHIYGQMNVEEAFHKALLTWAQWIDSNIDPKKTTVFFRGYSPSHFR  411

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG+WNSGG CD+E EP+++E+ L   P  M  ++ V+  MKT V YLN+T+MT FR+DAH
Sbjct  412  GGEWNSGGKCDNETEPLESESDLE-TPEMMMTIDSVIKKMKTPVFYLNITKMTYFRRDAH  470

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS++R + ++EE +R  L +QDCSHWCLPGVPD WNEL+YA LL
Sbjct  471  PSLFRNENMTEETKRHMLIHQDCSHWCLPGVPDLWNELVYAHLL  514



>ref|XP_010920201.1| PREDICTED: protein trichome birefringence-like 4 [Elaeis guineensis]
Length=475

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 171/223 (77%), Gaps = 5/223 (2%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC++EFF +PFLVQ W   D  GQ++ ETLRLDL+  S+ K++NAD++VFN+GHWWTH
Sbjct  255  DYNCSIEFFRSPFLVQPWARVDANGQRR-ETLRLDLIEESSSKFQNADVIVFNSGHWWTH  313

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+G++YY+E  HVY +L+  EA+RKA+ TW RWVDTHI+  +T V FRGYS+SHFSG
Sbjct  314  EKTSRGKNYYEEDGHVYPQLSAAEAYRKAMRTWARWVDTHIDSKQTRVFFRGYSSSHFSG  373

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQW+SGG C+ E  PI N+ +   YP  M++LE V+  M+T V YLN+TRMTD+RKDAHP
Sbjct  374  GQWSSGGTCNGETLPIANDKHRAKYPALMQILESVIEEMRTPVLYLNITRMTDYRKDAHP  433

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            S+YR+       +R     QDCSHWCLPGVPD WNELLYA LL
Sbjct  434  SVYRQPM----AQRKTGALQDCSHWCLPGVPDAWNELLYAMLL  472



>ref|XP_004296155.1| PREDICTED: protein trichome birefringence-like 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=797

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNC+VEFF + FLVQEWE  DK G KK ETLR+DL+  +AD YK+AD L+FNTGHWWT
Sbjct  563  QDYNCSVEFFQSQFLVQEWEGKDKNGSKK-ETLRIDLMESAADNYKDADFLIFNTGHWWT  621

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS G  YYQEG HVY ELN  EA+R+AL+TWGRW+DT ++P KT V FRGYS SHF 
Sbjct  622  HEKTSNGLGYYQEGDHVYDELNGEEAYRRALSTWGRWLDTKVDPKKTAVFFRGYSLSHFR  681

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            G  WN+GG CD E +P     Y   YP  +++ E VL  MKT + YLN+T MTDFRKDAH
Sbjct  682  GAAWNAGGKCDGETKPTTETEYGGEYPSYVKIFESVLEKMKTPILYLNITAMTDFRKDAH  741

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS YRK  L+ EER++    QDCSHWCLPGVP+ WNELL+A+LL
Sbjct  742  PSFYRKPNLTAEERQA-TSIQDCSHWCLPGVPETWNELLFAQLL  784



>ref|XP_007142667.1| hypothetical protein PHAVU_007G006500g [Phaseolus vulgaris]
 gb|ESW14661.1| hypothetical protein PHAVU_007G006500g [Phaseolus vulgaris]
Length=528

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 174/224 (78%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++YNCTVE++ +PFLVQEWE  D KG  K ETLRLD+V  S DKYK+AD+L+FNTGHWWT
Sbjct  294  KDYNCTVEYYRSPFLVQEWETPDVKGSTK-ETLRLDMVERSCDKYKDADVLIFNTGHWWT  352

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H K ++G+ YYQEG+ ++ +++V EAF+KA+ TW RWVDT ++  KT V FRGYS SHF 
Sbjct  353  HTKLTEGKSYYQEGNRIHGQMSVEEAFQKAMQTWSRWVDTSVDRKKTTVFFRGYSPSHFR  412

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
             G+W+SGG CD+E EP+KNE+  T  PP M+ +E  L  MKT V YLN+T+MTD R DAH
Sbjct  413  DGEWDSGGHCDNETEPMKNESEFTERPPMMDSVEAALKKMKTPVFYLNITKMTDLRVDAH  472

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS +R++ ++EE ++    +QDCSHWCLPGVPD+WNELLYA LL
Sbjct  473  PSWFRRENMNEETKKIMHTHQDCSHWCLPGVPDFWNELLYAHLL  516



>ref|XP_006355406.1| PREDICTED: uncharacterized protein LOC102580314 [Solanum tuberosum]
Length=457

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 173/234 (74%), Gaps = 5/234 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +++ C+++F  +PFLVQEW  +DK G ++ ETLRLD +  S  KY +ADI++FNTGHWWT
Sbjct  229  KDFKCSIDFIKSPFLVQEWRFSDKAGARR-ETLRLDTIHGSLTKYHDADIIIFNTGHWWT  287

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT K  +Y+QEG+HVY+ L V +A+ KAL TW  WVDT IN  +T V FRGYSASHF 
Sbjct  288  HQKTQKVNNYFQEGNHVYNRLEVADAYTKALKTWANWVDTTINSTRTRVFFRGYSASHFK  347

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PI NET L PYP  M VLE V++ MKT V YLN+T+MTD+RK+ H
Sbjct  348  GGQWNSGGNCDGETKPIINETQLGPYPWMMRVLESVISEMKTPVVYLNITKMTDYRKEGH  407

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            PS++R+     + +R P  +QDCSHWCLPGVPD WN+LLYA LL  Q + S  K
Sbjct  408  PSIFRE----AKSKRRPGMFQDCSHWCLPGVPDSWNQLLYATLLQSQQKFSHPK  457



>ref|XP_007221982.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
 gb|EMJ23181.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
Length=629

 Score =   301 bits (771),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 172/224 (77%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     + G    ETLRLD++  +   Y +AD++VFNTGHWWT
Sbjct  399  EDYNCSVDFVASPFLVRESSFTGQNGSF--ETLRLDMMDRTTSMYHDADVIVFNTGHWWT  456

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEG++V+  L V+EA+++ALTTW RWVD +I+  +T V FRGYS +HFS
Sbjct  457  HEKTSKGEDYYQEGNYVHPRLKVLEAYKRALTTWARWVDKNIDVKRTQVFFRGYSVTHFS  516

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  YP KM  LE VL  MKT V+YLN++++TD+RKD H
Sbjct  517  GGQWNSGGQCHKEAEPIFNETYLGNYPSKMRALEHVLQEMKTPVTYLNISKLTDYRKDGH  576

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y + EE+ +  + QDCSHWCLPGVPD WNELLYA LL
Sbjct  577  PSIYRMKYKTVEEQITAEQSQDCSHWCLPGVPDTWNELLYASLL  620



>gb|KEH20203.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=526

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 168/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     K G    ETLRLDL+ H+  +Y++A+I+VFNTGHWWT
Sbjct  296  EDYNCSVDFVASPFLVRESTFKGKNGSF--ETLRLDLMDHTTSRYQDANIIVFNTGHWWT  353

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGE+YYQEG+HVY  L  ++A+ +ALTTW +WVD  IN   T V FRGYS +HF 
Sbjct  354  HEKTSKGEEYYQEGNHVYPRLKALDAYMRALTTWAKWVDRKINANHTQVFFRGYSVTHFW  413

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  +P KM  LE V+  MKT+V Y+N++R+TD+RKD H
Sbjct  414  GGQWNSGGQCHKETEPIYNETYLQKHPSKMRALEHVIQNMKTEVIYMNISRLTDYRKDGH  473

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK Y +  ++ S   Y+DCSHWCLPGVPD WNELLY  LL
Sbjct  474  PSVYRKDYKTSMKQNSSSLYEDCSHWCLPGVPDTWNELLYVSLL  517



>ref|XP_010682517.1| PREDICTED: protein trichome birefringence-like 2 [Beta vulgaris 
subsp. vulgaris]
Length=512

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCT+++  APFLV+E     K G     TLRLDL+  +   Y +A ILVFNTGHWWT
Sbjct  280  EDYNCTIDYVRAPFLVRESTYQKKNGSL--ATLRLDLMDQTTQMYHDAHILVFNTGHWWT  337

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GE+YYQEG HV+  L  ++A+RKAL TWGRWVD HI+  KT V FRGYS +HF 
Sbjct  338  HEKTSRGEEYYQEGDHVHPRLKALKAYRKALATWGRWVDRHIDYKKTLVFFRGYSGTHFR  397

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E +PI NETYL  YP KM  LE+VL  MKT V YLN++R+T++RKDAH
Sbjct  398  GGQWNSGGQCHKETKPIFNETYLAKYPSKMRALEQVLGKMKTPVMYLNISRLTNYRKDAH  457

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK Y +E+E     + QDCSHWCLPGVPD WNELLYA +L
Sbjct  458  PSIYRKSYETEKELIEAEQSQDCSHWCLPGVPDIWNELLYASVL  501



>gb|KJB31199.1| hypothetical protein B456_005G180600 [Gossypium raimondii]
Length=570

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 168/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     + G    ETLRLDL+  S   Y +AD++VFNTGHWWT
Sbjct  343  EDYNCSVDFVASPFLVKESSFKRENGSI--ETLRLDLMNPSTSMYHDADLMVFNTGHWWT  400

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQE  +VY  L V+ A++KALTTW RW+D +++  +T V FRGYS +HF 
Sbjct  401  HEKTSKGEDYYQERDYVYPRLKVLNAYQKALTTWSRWIDKNVDSRRTQVFFRGYSVTHFW  460

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPI NETYLT YP KM  +E V+   KT V YLN++R+TD+RKD H
Sbjct  461  GGQWNSGGQCDKETEPILNETYLTKYPSKMRAVEYVIQNTKTPVIYLNISRLTDYRKDGH  520

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR++Y +E E  +  R QDCSHWCLPGVPD WNELLYA L+
Sbjct  521  PSIYRREYKTEREGNAAGRVQDCSHWCLPGVPDTWNELLYASLV  564



>ref|XP_002525401.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37039.1| conserved hypothetical protein [Ricinus communis]
Length=581

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 170/224 (76%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E   + K G  K ETLRLDL+  +   Y++ADI+VFNTGHWWT
Sbjct  351  EDYNCSVDFVGSPFLVRESSFSSKNG--KLETLRLDLMDLTTKMYQDADIIVFNTGHWWT  408

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG +V+  L V+EA+++AL TW RWVD +I+  +T + FRGYS +HF 
Sbjct  409  HEKTSRGEDYYQEGDYVHPRLKVMEAYKRALLTWARWVDKNIDGNRTQIFFRGYSVTHFR  468

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N T++  YP KM V E VL  MK+ V YLN++R+TD+RKD H
Sbjct  469  GGQWNSGGQCHKETEPISNATHIRKYPSKMRVFEHVLKEMKSPVIYLNISRLTDYRKDGH  528

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS++R QY + EER +  R QDCSHWCLPGVPD WNELLYA LL
Sbjct  529  PSIFRMQYKTAEERNAAERSQDCSHWCLPGVPDTWNELLYASLL  572



>ref|XP_008221854.1| PREDICTED: protein trichome birefringence-like 2 [Prunus mume]
Length=620

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 171/224 (76%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     + G    ETLRLDL+  +   Y +AD++VFNTGHWWT
Sbjct  390  EDYNCSVDFVASPFLVRESSFTGRNGSF--ETLRLDLMDQTTSMYHDADVIVFNTGHWWT  447

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEG++V+  L V++A+++ALTTW RWVD +I+  +T V FRGYS +HFS
Sbjct  448  HEKTSKGEDYYQEGNYVHPRLKVLKAYKRALTTWARWVDKNIDVKRTQVFFRGYSVTHFS  507

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  YP KM  LE VL  MKT V+YLN++++TD+RKD H
Sbjct  508  GGQWNSGGQCHKEAEPIFNETYLGNYPSKMRALEHVLQEMKTPVTYLNISKLTDYRKDGH  567

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y + EE+ +  + QDCSHWCLPGVPD WNELLY  LL
Sbjct  568  PSIYRMKYKTVEEQITAEQSQDCSHWCLPGVPDTWNELLYVSLL  611



>ref|XP_010251171.1| PREDICTED: protein trichome birefringence-like 2 [Nelumbo nucifera]
Length=616

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 172/224 (77%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+++F   PFLV+E   ++K+     ETLRLDL+  +   Y+ ADI+VFNTGHWWT
Sbjct  386  EDYNCSLDFVSCPFLVRE--SSNKRKNGSIETLRLDLMDTTTSLYREADIVVFNTGHWWT  443

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG++V+ +L V+EA++KALTTW RWVD +IN ++T V FRGYS +HF 
Sbjct  444  HEKTSRGEDYYQEGNYVHPKLKVMEAYKKALTTWARWVDKNINASRTQVFFRGYSVTHFK  503

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  YP KM  L+ VL  M T V YLN++R+TD+RKD H
Sbjct  504  GGQWNSGGQCHKESEPIFNETYLGKYPSKMRALDHVLQQMHTPVIYLNISRLTDYRKDGH  563

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK Y + EE+ +  + QDCSHWCLPGVPD WNELLYA LL
Sbjct  564  PSIYRKVYKTVEEQIAAEKSQDCSHWCLPGVPDTWNELLYASLL  607



>ref|XP_008340353.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
2 [Malus domestica]
Length=483

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     + G    ETLRLDL+  +   Y +AD++VFNTG WWT
Sbjct  253  EDYNCSVDFVASPFLVRESSFTGQNGTF--ETLRLDLMDQTTSMYDDADVMVFNTGRWWT  310

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG++V+  L V+EA+++ALTTW RWVD +I+  +T V FRGYS +HFS
Sbjct  311  HEKTSRGEDYYQEGNYVHPRLQVLEAYKRALTTWARWVDENIDVDRTQVFFRGYSVTHFS  370

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  YP KM  LE V+  MKT V YLN++R+TD+RKD H
Sbjct  371  GGQWNSGGQCHKETEPIFNETYLGNYPSKMRALEHVIEEMKTPVIYLNISRLTDYRKDGH  430

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y + EER +    QDCSHWCLPGVPD WNELLYA LL
Sbjct  431  PSIYRMKYKTVEERITAEGSQDCSHWCLPGVPDAWNELLYAALL  474



>gb|KJB31198.1| hypothetical protein B456_005G180600 [Gossypium raimondii]
Length=593

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 168/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     + G    ETLRLDL+  S   Y +AD++VFNTGHWWT
Sbjct  366  EDYNCSVDFVASPFLVKESSFKRENGSI--ETLRLDLMNPSTSMYHDADLMVFNTGHWWT  423

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQE  +VY  L V+ A++KALTTW RW+D +++  +T V FRGYS +HF 
Sbjct  424  HEKTSKGEDYYQERDYVYPRLKVLNAYQKALTTWSRWIDKNVDSRRTQVFFRGYSVTHFW  483

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPI NETYLT YP KM  +E V+   KT V YLN++R+TD+RKD H
Sbjct  484  GGQWNSGGQCDKETEPILNETYLTKYPSKMRAVEYVIQNTKTPVIYLNISRLTDYRKDGH  543

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR++Y +E E  +  R QDCSHWCLPGVPD WNELLYA L+
Sbjct  544  PSIYRREYKTEREGNAAGRVQDCSHWCLPGVPDTWNELLYASLV  587



>ref|XP_010100425.1| hypothetical protein L484_027736 [Morus notabilis]
 gb|EXB82559.1| hypothetical protein L484_027736 [Morus notabilis]
Length=500

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 167/223 (75%), Gaps = 2/223 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNCTV+F  +PFLV+E     K G    ETLR+DL+  +   Y +ADI+VFNTGHWWTH
Sbjct  274  DYNCTVDFVGSPFLVRESSFTRKNGSF--ETLRIDLMDRTTSMYHDADIIVFNTGHWWTH  331

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+GEDYYQEG+HVY  L V+EA+++AL TW +WV+ +I+ A+T V FRGYS +HF G
Sbjct  332  EKTSRGEDYYQEGNHVYPRLKVLEAYKRALKTWAKWVNKNIDTARTKVFFRGYSVTHFKG  391

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG C  E EPI N+TYL  Y  KM   + VL  MKT V YLN++R+TD+RKD HP
Sbjct  392  GQWNSGGQCHKETEPIFNKTYLGKYTSKMRAFDNVLREMKTPVIYLNISRLTDYRKDGHP  451

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            S+YR  Y SEEE+ + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  452  SIYRMIYKSEEEQMAAVTSQDCSHWCLPGVPDTWNELLYASLL  494



>ref|XP_010940155.1| PREDICTED: protein trichome birefringence-like 2 [Elaeis guineensis]
Length=619

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 172/225 (76%), Gaps = 1/225 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y C+V+F  +PFLV+E    +  G +  E LRLD++  +   Y+ ADI+VFNTGHWWT
Sbjct  388  KDYKCSVDFVRSPFLVRELYYKNANGSED-EKLRLDVLDETTSSYREADIVVFNTGHWWT  446

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG DYYQEG HVY  L V+EA++KALTTW RWVD +IN  KT V+FRGYS +HF 
Sbjct  447  HEKTSKGIDYYQEGDHVYPVLKVMEAYKKALTTWARWVDKNINSKKTQVVFRGYSLTHFR  506

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E+EPI N++YL  YP KM  LE++L  MKT V YLN++R+TD+RKD H
Sbjct  507  GGQWNSGGQCHKEIEPIFNQSYLAHYPSKMRALEQILKQMKTTVVYLNISRLTDYRKDGH  566

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YRK+Y S EE+ +  + QDCSHWCLPG+PD WNELLYA LL+
Sbjct  567  PSIYRKKYQSVEEQIAAEKTQDCSHWCLPGIPDSWNELLYASLLM  611



>ref|XP_004509571.1| PREDICTED: uncharacterized protein LOC101508086 [Cicer arietinum]
Length=589

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     K G    ETLRLDL+ H+  +Y++A+I+VFNTGHWWT
Sbjct  359  EDYNCSVDFVASPFLVRESSFKGKNGSF--ETLRLDLMDHTTTRYQDANIIVFNTGHWWT  416

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEG HVY  L  ++A+ +ALTTW +WVD  IN  +T + FRGYS +HF 
Sbjct  417  HDKTSKGEDYYQEGKHVYPRLKALDAYMRALTTWAKWVDHKINSNQTQIFFRGYSVTHFW  476

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  YP KM  +E V+  MKT V Y+N++R+TD+RKD H
Sbjct  477  GGQWNSGGQCHKETEPIYNETYLQKYPSKMRAVEHVIQNMKTTVIYMNISRLTDYRKDGH  536

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK Y +  ++ +   Y+DCSHWCLPGVPD WNELLY  LL
Sbjct  537  PSVYRKDYKTSMKQNAASLYEDCSHWCLPGVPDTWNELLYVSLL  580



>gb|KDO82333.1| hypothetical protein CISIN_1g007771mg [Citrus sinensis]
Length=590

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PFLV+E     + G    ETLRLDL+  +   Y++AD+++FNTGHWWT
Sbjct  360  EDYNCTVDFVSSPFLVRESSFTGRNGTF--ETLRLDLMDRTTSMYQDADVIIFNTGHWWT  417

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+ V+  L V+EA+++ALTTW RWVD +++  +T V FRGYS +HF 
Sbjct  418  HEKTSRGEDYYQEGNFVHPRLKVLEAYKRALTTWARWVDKNVDHNRTKVFFRGYSVTHFK  477

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N TYL  YP KM  LE +L  MKT V YLN++R+TDFRKD H
Sbjct  478  GGQWNSGGQCHKETEPIFNVTYLAKYPSKMRALEYMLPEMKTPVVYLNISRLTDFRKDGH  537

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +++ER + +  QDCSHWCLPGVPD WNELLY  LL
Sbjct  538  PSIYRMEYKNDQERIAAVNAQDCSHWCLPGVPDTWNELLYVSLL  581



>ref|XP_006438320.1| hypothetical protein CICLE_v10031033mg [Citrus clementina]
 gb|ESR51560.1| hypothetical protein CICLE_v10031033mg [Citrus clementina]
Length=590

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PFLV+E     + G    ETLRLDL+  +   Y++AD+++FNTGHWWT
Sbjct  360  EDYNCTVDFVSSPFLVRESSFTGRNGTF--ETLRLDLMDRTTSMYQDADVIIFNTGHWWT  417

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+ V+  L V+EA+++ALTTW RWVD +++  +T V FRGYS +HF 
Sbjct  418  HEKTSRGEDYYQEGNFVHPRLKVLEAYKRALTTWARWVDKNVDHNRTKVFFRGYSVTHFK  477

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N TYL  YP KM  LE +L  MKT V YLN++R+TDFRKD H
Sbjct  478  GGQWNSGGQCHKETEPIFNVTYLAKYPSKMRALEYMLPEMKTLVVYLNISRLTDFRKDGH  537

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +++ER + +  QDCSHWCLPGVPD WNELLY  LL
Sbjct  538  PSIYRMEYKNDQERIAAVNAQDCSHWCLPGVPDTWNELLYVSLL  581



>ref|XP_006483906.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=590

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PFLV+E     + G    ETLRLDL+  +   Y++AD+++FNTGHWWT
Sbjct  360  EDYNCTVDFVSSPFLVRESSFTGRNGTF--ETLRLDLMDRTTSMYQDADVIIFNTGHWWT  417

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+ V+  L V+EA+++ALTTW RWVD +++  +T V FRGYS +HF 
Sbjct  418  HEKTSRGEDYYQEGNFVHPRLKVLEAYKRALTTWARWVDKNVDHNRTKVFFRGYSVTHFK  477

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N TYL  YP KM  LE +L  MKT V YLN++R+TDFRKD H
Sbjct  478  GGQWNSGGQCHKETEPIFNVTYLAKYPSKMRALEYMLPEMKTLVVYLNISRLTDFRKDGH  537

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +++ER + +  QDCSHWCLPGVPD WNELLY  LL
Sbjct  538  PSIYRMEYKNDQERIAAVNAQDCSHWCLPGVPDTWNELLYVSLL  581



>ref|XP_009393972.1| PREDICTED: protein trichome birefringence-like 4 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   294 bits (752),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 167/224 (75%), Gaps = 5/224 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC++EFF +PFLV+E    D +G K +ETLRLDL+  S+D Y+ ADILVFN+GHWWT
Sbjct  259  EDYNCSIEFFRSPFLVRESSWVDSQG-KSRETLRLDLIEASSDAYRTADILVFNSGHWWT  317

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG ++YQEG HVY +L+  +A+RKA+ TWG WVDT +N  +T V FRGYS SHFS
Sbjct  318  HEKTSKGRNFYQEGDHVYPQLSAEDAYRKAMRTWGTWVDTRVNSNRTRVFFRGYSWSHFS  377

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E EPI  + +L  Y     +LE V+  M T V YLN+TRMTD+RKDAH
Sbjct  378  GGQWNSGGNCDGETEPITEDKHLAKYLKLTGILESVIGEMTTPVLYLNITRMTDYRKDAH  437

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR        +R P  +QDCSHWCLPGVPD WNELLYA LL
Sbjct  438  PSVYR----VPAGKRKPGEFQDCSHWCLPGVPDAWNELLYAMLL  477



>gb|KCW59798.1| hypothetical protein EUGRSUZ_H02546 [Eucalyptus grandis]
Length=268

 Score =   286 bits (733),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E YNC+V+F  APFLV+E   ++  G     TLR+DL+  +   Y++ADI+VFNTGHWWT
Sbjct  39   EGYNCSVDFVGAPFLVRESSFSNGNGSFG--TLRIDLMDRTTRTYRDADIIVFNTGHWWT  96

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKT++GE YYQEG +V+  L V++A+++AL TW +W+D +I+  +T VLFRGYS +HF 
Sbjct  97   HEKTTRGEHYYQEGKYVHPRLKVLDAYKRALRTWAKWIDKNIHQTRTQVLFRGYSVTHFR  156

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NE+YL  YP KM VLE VL  M+T V+YLN++R+TD+RKD H
Sbjct  157  GGQWNSGGQCHKETEPIFNESYLENYPSKMRVLENVLQEMRTPVTYLNISRLTDYRKDGH  216

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y + +E+ +  + QDCSHWCLPGVPD WNELLYA LL
Sbjct  217  PSVYRTAYRTAQEQMAAEQSQDCSHWCLPGVPDTWNELLYASLL  260



>ref|XP_011045285.1| PREDICTED: protein trichome birefringence-like 2 [Populus euphratica]
Length=549

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PFLV+E     K G    ETLRLDL+  +   Y +AD+++FNTGHWWT
Sbjct  319  EDYNCTVDFVSSPFLVRESSFESKNGTF--ETLRLDLMDQTTSMYHDADVIIFNTGHWWT  376

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS+GEDYYQEG+H++  L V+EA+++AL TW RW+D +I+  +T VLFRGYS +HF 
Sbjct  377  HDKTSRGEDYYQEGNHIHRRLKVLEAYKRALLTWARWIDKNIDRNRTLVLFRGYSVTHFR  436

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N TYL  YP KM  L+ VL   KT V YLN++R+T +RKDAH
Sbjct  437  GGQWNSGGRCHKETEPIFNTTYLGKYPSKMRALQHVLQETKTPVIYLNISRLTAYRKDAH  496

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y + EER +  R QDCSHWCLPGVPD WNELLYA LL
Sbjct  497  PSIYRMTYNTAEERIAAERSQDCSHWCLPGVPDTWNELLYASLL  540



>ref|XP_008791066.1| PREDICTED: protein trichome birefringence-like 4 [Phoenix dactylifera]
Length=473

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 171/224 (76%), Gaps = 6/224 (3%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC++EFF +PFLVQ W   D KG +++ETLRLDL+  S+ K+++AD++VFN+GHWWTH
Sbjct  245  DYNCSIEFFRSPFLVQPWARVDAKG-RRRETLRLDLIEESSSKFEDADVIVFNSGHWWTH  303

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTSKG++YY+E  HVY +L   EA+ KA+ TW RW+DTHI+  +T V FRGYS+SHFSG
Sbjct  304  EKTSKGKNYYEEDGHVYPQLRAAEAYGKAMRTWARWIDTHIDSKRTRVFFRGYSSSHFSG  363

Query  439  G-QWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            G +W+SGG CD E  PI N+ +L  YP  M++L  V+  M+T V YLN+TRMTD+RKDAH
Sbjct  364  GRRWSSGGTCDGETLPITNDKHLAKYPALMQILGSVIKEMRTPVLYLNITRMTDYRKDAH  423

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR+       +R P   QDCSHWCLPGVPD WNELLYA LL
Sbjct  424  PSVYRQ----PAAQRKPGAVQDCSHWCLPGVPDAWNELLYAMLL  463



>ref|XP_004489803.1| PREDICTED: uncharacterized protein LOC101513224 [Cicer arietinum]
Length=528

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 168/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PF+V+E     K G    ETLRLDL+  +   Y +ADI+VFNTGHWWT
Sbjct  298  EDYNCSVDFVSSPFIVRESTFKGKNGSF--ETLRLDLMDQTTTTYHDADIIVFNTGHWWT  355

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEG+HVY  L V++A+++ALTTW RW+D +I+  +T V FRGYS +HF 
Sbjct  356  HEKTSKGEDYYQEGNHVYPRLKVLDAYKRALTTWARWIDNNIDVNRTQVFFRGYSVTHFR  415

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI    +L  YP KM  L+ V+  MKT V Y+N++RMTD+RKD H
Sbjct  416  GGQWNSGGQCHKETEPIFKGAHLRKYPSKMRALDYVIPKMKTPVIYMNISRMTDYRKDGH  475

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +E ER +  ++QDCSHWCLPGVPD WNELLYA LL
Sbjct  476  PSIYRMEYKTEAERTAAEQHQDCSHWCLPGVPDTWNELLYASLL  519



>ref|XP_008229347.1| PREDICTED: protein trichome birefringence-like [Prunus mume]
Length=763

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 166/211 (79%), Gaps = 4/211 (2%)
 Frame = -1

Query  715  KETLRLDLVAHSADKYKNADILVFNTGHWWTHEKTSKGEDYYQEGSHVYHELNVVEAFRK  536
            K TLRLDL+  S+DKYK+AD+L+FNTGHWWTHEKTS+G+ YYQEGSH+Y ELNV EAFRK
Sbjct  547  KHTLRLDLIERSSDKYKSADVLIFNTGHWWTHEKTSRGKGYYQEGSHIYVELNVKEAFRK  606

Query  535  ALTTWGRWVDTHINPAKTFVLFRGYSASHFSGGQWNSGGACDHEVEPIKNETYLTPYPPK  356
            AL TW RWVD +IN  KT V FRGYS +HF GG+WNSGG C  E EP   E     Y  K
Sbjct  607  ALMTWARWVDININLEKTIVFFRGYSPNHFRGGRWNSGGQCHGETEPTAKEANKGKYMSK  666

Query  355  MEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPSMYRKQYLSEEERRSPLRYQDCSHWCLP  176
            M +L+ V+  MKT + YLN+T+MTDFR+DAHPS+YRKQ  +EE+R+SPLRYQDCSHWCLP
Sbjct  667  MRILDSVIIEMKTPIFYLNITKMTDFRRDAHPSIYRKQNFTEEDRKSPLRYQDCSHWCLP  726

Query  175  GVPDYWNELLYAELL----VKQYQKSSKKAG  95
            GVPD WNELLYA+L+     +Q Q++S+ AG
Sbjct  727  GVPDTWNELLYAQLIRHNQKQQKQQASRTAG  757



>emb|CDO98793.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 174/231 (75%), Gaps = 5/231 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +++N +V+F  +PFLVQEW++  K G ++ ETLRLD++  S+ KY +ADI++FNTGHWWT
Sbjct  238  QDFNLSVDFIKSPFLVQEWKLTTKAGMRR-ETLRLDMIQASSTKYHDADIIIFNTGHWWT  296

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KTSKG +Y+QEG+ VY+ L V +AF KAL TW RWVD++IN ++T V FRGYSASHF 
Sbjct  297  HHKTSKGNNYFQEGNRVYNTLGVTDAFTKALKTWARWVDSNINSSQTTVFFRGYSASHFK  356

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+C+ E  PI ++TYL+P+P  M +LE V++ MKT V  LN+T+MTD+RKD H
Sbjct  357  GGQWNSGGSCEGETVPITSDTYLSPHPWMMTILESVISEMKTPVFLLNITKMTDYRKDGH  416

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKS  110
            PS++ +     E  R P   QDCSHWCLPG+PD WNELLY  LL  + + S
Sbjct  417  PSIFSQ----PEAIRRPGMIQDCSHWCLPGIPDSWNELLYVSLLASRNKFS  463



>gb|KDP26622.1| hypothetical protein JCGZ_17780 [Jatropha curcas]
Length=584

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 166/224 (74%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PFLV+E     + G    ETLRLDL+ H+   Y++ADI+VFNTGHWWT
Sbjct  354  EDYNCTVDFVGSPFLVRESSFNSQNGTF--ETLRLDLMDHTTKMYQDADIIVFNTGHWWT  411

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+ V+  L V+EA+R+AL TW RWVD +I+  +T V FRGYS +HF 
Sbjct  412  HEKTSRGEDYYQEGNFVHPRLKVLEAYRRALLTWARWVDNNIDRNRTQVFFRGYSVTHFR  471

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N  YL  YP KM   E VL  MK  V Y+N++R+TD+RKD H
Sbjct  472  GGQWNSGGQCHKETEPIFNAKYLAKYPSKMRAFEHVLGEMKNPVIYMNISRLTDYRKDGH  531

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y + EE+ +  R QDCSHWCLPGVPD WNELLYA LL
Sbjct  532  PSIYRMKYKTAEEQIAAERSQDCSHWCLPGVPDTWNELLYASLL  575



>ref|XP_008812175.1| PREDICTED: protein trichome birefringence-like 2 [Phoenix dactylifera]
Length=612

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 172/225 (76%), Gaps = 1/225 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y C+V+F  +PFLV+E    +  G +  E LRLD++  +   Y+ ADI+VFNTGHWWT
Sbjct  381  KDYECSVDFVRSPFLVRELYYKNTNGSED-EKLRLDMLDETTSSYRGADIVVFNTGHWWT  439

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKG DYYQEG+HVY  L V+EA++KA+TTW RWVD +IN  +T V+FRGYS +HF 
Sbjct  440  HEKTSKGIDYYQEGNHVYPVLKVMEAYKKAITTWARWVDKNINSKQTQVIFRGYSLTHFR  499

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N++YL  YP KM  LE+++  MKT + YLN++R+TD+RKD H
Sbjct  500  GGQWNSGGQCHKEAEPIFNQSYLAHYPSKMRALEQIIKQMKTPIIYLNISRLTDYRKDGH  559

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YRK+Y S EE+ +  + QDCSHWCLPG+PD WNELLYA LL+
Sbjct  560  PSIYRKKYQSVEEQIAAEKTQDCSHWCLPGIPDSWNELLYASLLM  604



>ref|XP_009392183.1| PREDICTED: protein trichome birefringence-like 2 [Musa acuminata 
subsp. malaccensis]
Length=718

 Score =   298 bits (763),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 176/225 (78%), Gaps = 1/225 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+Y C+V+F  +PFLV+E +  +  G +  E LRLD++  +   Y+ AD++VFNTGHWWT
Sbjct  487  EDYQCSVDFVRSPFLVREMQYKNVHGSED-ERLRLDILDETTLAYREADVIVFNTGHWWT  545

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HE+TS+G +YYQEG+HVY  L V+EA++KALTTW RW+D +I+ +KT V+FRGYS +HF 
Sbjct  546  HEQTSRGRNYYQEGNHVYPVLKVMEAYKKALTTWSRWIDMNIDSSKTQVVFRGYSLTHFR  605

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N++YL+ YP KM V+E++L   +T V YLN++R+TD+RKD H
Sbjct  606  GGQWNSGGQCHKETEPIFNQSYLSKYPSKMRVVEQILKQTRTPVIYLNISRLTDYRKDGH  665

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YRK+Y+S EE+ +  + QDCSHWCLPG+PD WNELLYA LL+
Sbjct  666  PSIYRKKYMSVEEQIAAEKSQDCSHWCLPGIPDSWNELLYASLLI  710



>emb|CBI28569.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   287 bits (735),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  APFLVQE     +   +  ETLRLD +  S   + +ADI+VFNTGHWWT
Sbjct  127  EDYNCSVDFVNAPFLVQESSFNGR--NRTFETLRLDEMDKSTTTFHDADIIVFNTGHWWT  184

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GE YYQEG++V+  L V++A+ KALTTW RWVD +IN   T V FRGYS +HF 
Sbjct  185  HEKTSRGEYYYQEGNYVHPRLKVLKAYTKALTTWARWVDKNINSNMTQVFFRGYSITHFK  244

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  EVEPI NE ++  YP KM  LE VL  M+T V+YLNV+R+TD+RKD H
Sbjct  245  GGQWNSGGQCHKEVEPIFNEAFIRKYPSKMRALEPVLQMMRTPVTYLNVSRLTDYRKDGH  304

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK+Y + EE  + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  305  PSIYRKEYKTVEEEIAAVHSQDCSHWCLPGVPDTWNELLYASLL  348



>ref|XP_007035738.1| Trichome birefringence-like 4 [Theobroma cacao]
 gb|EOY06664.1| Trichome birefringence-like 4 [Theobroma cacao]
Length=453

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 169/225 (75%), Gaps = 7/225 (3%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y C+++F  +PFLVQEW+I+DK G ++ ETLRLD++  S  KY +ADI+VFNTGHWWT
Sbjct  233  KDYKCSIDFVKSPFLVQEWKISDKIGTRR-ETLRLDIIQGS--KYSDADIIVFNTGHWWT  289

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT+KG++Y+QEGSHVY  L V EAF KAL TW +WVD +I+  +T V F GYSASHF 
Sbjct  290  HQKTNKGKNYFQEGSHVYSRLEVKEAFAKALRTWAKWVDVNIDRNRTRVFFVGYSASHFR  349

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
             GQW++GG CD E EPI NE    PYP  M +LE V+ GMKT V YLN+T+MT +RKD H
Sbjct  350  KGQWDTGGHCDGETEPIANEASPAPYPWMMNILESVIAGMKTPVFYLNITKMTAYRKDGH  409

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YR      E  R+P   QDCSHWCLPGVPD WNELLYA LL+
Sbjct  410  PSIYRP----AEIPRNPSMIQDCSHWCLPGVPDSWNELLYATLLI  450



>ref|XP_011100832.1| PREDICTED: protein trichome birefringence-like 4 [Sesamum indicum]
Length=463

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 175/224 (78%), Gaps = 5/224 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            +++NC+++F  +PFLVQEW+ +DK G ++ ETLRLD++  S + Y +ADI+VFNTGHWWT
Sbjct  233  KDFNCSIDFIKSPFLVQEWKFSDKAGTRR-ETLRLDMMEGSYNSYHDADIIVFNTGHWWT  291

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT +G+ Y+QEG+HVY +L V +A++KAL TW RWVD +IN  +T V FRGYS+SHF 
Sbjct  292  HQKTFQGKYYFQEGNHVYRKLEVADAYKKALRTWARWVDANINSNRTRVFFRGYSSSHFK  351

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG+C  E++PI NET+L PYP  M  LE V++ MKT V +LN+T+MTD+RKD H
Sbjct  352  GGQWNSGGSCYGEMKPITNETHLAPYPWMMVALESVISKMKTPVFFLNITKMTDYRKDGH  411

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS++++   S    R  + +QDCSHWCLPGVPD WN+LLYA LL
Sbjct  412  PSIFKQ---SASTIRQGM-FQDCSHWCLPGVPDSWNQLLYAVLL  451



>ref|XP_006378226.1| hypothetical protein POPTR_0010s05310g [Populus trichocarpa]
 gb|ERP56023.1| hypothetical protein POPTR_0010s05310g [Populus trichocarpa]
Length=517

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PFLV+E     K G    ETLRLDL+  +   Y +AD+++FNTGHWWT
Sbjct  287  EDYNCTVDFVSSPFLVRESSFKSKNGTF--ETLRLDLMDRTTSMYHDADVIIFNTGHWWT  344

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTS+GEDYYQEG+H++  L V+EA+++AL TW RW+D +I+  +T VLF+GYS +HF 
Sbjct  345  HDKTSRGEDYYQEGNHIHRRLKVLEAYKRALLTWARWIDKNIDRNRTLVLFKGYSVTHFR  404

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N  YL  YP KM   + VL   KT V YLN++R+T +RKDAH
Sbjct  405  GGQWNSGGRCHKETEPIFNTAYLGKYPSKMRAFQHVLQETKTPVIYLNISRLTAYRKDAH  464

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y + EER +  R QDCSHWCLPGVPD WNELLYA LL
Sbjct  465  PSIYRMTYNTAEERIAAERSQDCSHWCLPGVPDTWNELLYASLL  508



>emb|CDP13190.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 168/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV+E     K G    ETLRLDL+  S   Y +AD+LVFNT HWWT
Sbjct  394  EDYNCSVDFVSSPFLVRESTFNGKNGSF--ETLRLDLMDKSTSMYYDADVLVFNTAHWWT  451

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTSKGEDYYQEG+HV+  L V+EA+++AL TW RWVD  I+  ++ V+FRGYS  HFS
Sbjct  452  HEKTSKGEDYYQEGNHVHGRLKVLEAYKRALRTWARWVDKSIDKTRSQVVFRGYSVMHFS  511

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNS G C  E EPI NETYL  YP KM  LE +L+ M+T V YLN++R+TDFRKD H
Sbjct  512  GGQWNSRGQCHKETEPILNETYLAKYPSKMRALEHLLHKMRTPVVYLNISRLTDFRKDGH  571

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR++Y + +E+ +    QDCSHWCLPGVPD WNELLYA LL
Sbjct  572  PSIYRREYKTLKEQIAGELNQDCSHWCLPGVPDTWNELLYASLL  615



>gb|KJB72754.1| hypothetical protein B456_011G194800 [Gossypium raimondii]
Length=463

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 171/225 (76%), Gaps = 7/225 (3%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y CT++F  +PFLVQEW+I+DK  + ++ETLRLD++  S  KY +ADI+VFNTGHWWT
Sbjct  237  QDYQCTIDFIKSPFLVQEWKISDK-SEIRRETLRLDMIQGS--KYSDADIIVFNTGHWWT  293

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT KG++Y+QEGSHVY  + V EAF KAL TW +WVD++I+   T V F GYS+SHF 
Sbjct  294  HQKTGKGKNYFQEGSHVYDRMEVKEAFTKALKTWAQWVDSNIDRKHTRVFFAGYSSSHFR  353

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
             GQW++GG C  E EPI NET L PYP  M +LE V++ MKT V YLN+T+MT +RKD H
Sbjct  354  KGQWDTGGNCHGETEPISNETSLAPYPWMMSILESVISEMKTPVFYLNITKMTAYRKDGH  413

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YR      E  R+P  +QDCSHWCLPGVPD+WNELLYA LL+
Sbjct  414  PSIYRPL----EIPRTPGMFQDCSHWCLPGVPDFWNELLYAALLI  454



>ref|XP_007153754.1| hypothetical protein PHAVU_003G062400g [Phaseolus vulgaris]
 gb|ESW25748.1| hypothetical protein PHAVU_003G062400g [Phaseolus vulgaris]
Length=526

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 166/224 (74%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+  V+PF+VQE     K G    ETLRLDL+  +  +Y++A+I+VFNTGHWWT
Sbjct  296  EDYNCSVDLVVSPFIVQESTFKSKNGSF--ETLRLDLMDWTTTRYEDANIIVFNTGHWWT  353

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KTSKGEDYYQEG+HV+  L V++A+ +ALTTW +WVD  IN  +T V FRGYS +HF 
Sbjct  354  HNKTSKGEDYYQEGNHVHARLKVLDAYTRALTTWAKWVDRKINANQTQVFFRGYSVTHFW  413

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NETYL  YP KM  LE V+  MKT V Y+N++R+TD+RKD H
Sbjct  414  GGQWNSGGQCHKETEPIFNETYLQKYPLKMRALESVIQQMKTPVVYMNISRLTDYRKDGH  473

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK Y    ++ S   ++DCSHWCLPGVPD WNELLY  LL
Sbjct  474  PSVYRKGYKKSMDQNSTALFEDCSHWCLPGVPDTWNELLYVSLL  517



>ref|XP_006419433.1| hypothetical protein CICLE_v10006676mg [Citrus clementina]
 gb|ESR32673.1| hypothetical protein CICLE_v10006676mg [Citrus clementina]
Length=436

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 173/233 (74%), Gaps = 5/233 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             +Y C+++F  +PFLVQE + +DK G +  ETLRLD++  S+ KY +ADI++FNTGHWWT
Sbjct  209  RDYMCSIDFIKSPFLVQESKFSDKSGARG-ETLRLDMIQGSSTKYGDADIIIFNTGHWWT  267

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KT KG +Y+QEGSHVY++L V EA+ KAL TW +WVD +I+  +T V FRGYSASHF 
Sbjct  268  HHKTFKGYNYFQEGSHVYNKLEVKEAYTKALKTWAQWVDANIDSNRTRVFFRGYSASHFR  327

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
             GQWN+ G+C  E++PI ++TY+  YP  M VLE V+  MKT V YLN+TRMTD+R+D H
Sbjct  328  KGQWNTRGSCHGEMKPIASDTYIATYPWMMRVLESVIAEMKTPVFYLNITRMTDYRQDGH  387

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSK  104
            PS+YR++    E  R P  +QDCSHWCLPGVPD WNELLYA LL+  Y  + K
Sbjct  388  PSIYRQR----EIPRGPGMFQDCSHWCLPGVPDSWNELLYATLLISHYDFTGK  436



>ref|XP_003613189.1| hypothetical protein MTR_5g033800 [Medicago truncatula]
 gb|AES96147.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=493

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 166/224 (74%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PF+VQE       G    ETLRLDL+  +   Y +A+I+VFNTGHWWT
Sbjct  263  EDYNCSVDFVSSPFIVQESTFKGVNGSF--ETLRLDLMDQTTSTYHDAEIIVFNTGHWWT  320

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+HVY  L V++A+ +AL TW RW+D +I+  +T V FRGYS +HF 
Sbjct  321  HEKTSRGEDYYQEGNHVYPRLKVLDAYTRALKTWARWIDNNIDANRTNVFFRGYSVTHFR  380

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI    +L  YP KM  L+ V+  MKT V Y+N++RMTD+RKDAH
Sbjct  381  GGQWNSGGQCHKETEPIYKGDHLRKYPSKMRALDYVIPKMKTPVIYMNISRMTDYRKDAH  440

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +E ER +  ++QDCSHWCLPGVPD WNELLYA LL
Sbjct  441  PSIYRMEYKTEAERTTAEQHQDCSHWCLPGVPDTWNELLYASLL  484



>ref|XP_006585942.1| PREDICTED: protein YLS7-like [Glycine max]
Length=534

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 166/224 (74%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F V+PF+VQE     K G    ETLRLDL+  +  +Y +A+I+VFNTGHWWT
Sbjct  302  EDYNCSVDFVVSPFIVQESTFKGKNGSF--ETLRLDLMDRTTARYWDANIIVFNTGHWWT  359

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEG+HVY  L V++A+ +ALTTW +WVD  IN  +T V FRG+S +HF 
Sbjct  360  HDKTSKGEDYYQEGNHVYQRLEVLDAYTRALTTWAKWVDKKINANQTQVFFRGFSLTHFW  419

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NE YL  YP KM  LE V+  MKT V Y+N++R+TD+RKD H
Sbjct  420  GGQWNSGGQCHKETEPIFNEAYLQRYPSKMLALEHVIQQMKTPVVYMNISRLTDYRKDGH  479

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y +  ++ +   ++DCSHWCLPGVPD WNELLY  LL
Sbjct  480  PSVYRTGYKASMKQNTAALFEDCSHWCLPGVPDTWNELLYVSLL  523



>ref|XP_009591829.1| PREDICTED: protein trichome birefringence-like 2 [Nicotiana tomentosiformis]
Length=622

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 171/224 (76%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV++     K G    ETLRLD++  +   Y +ADI++FNTGHWWT
Sbjct  392  EDYNCSVDFVSSPFLVRQSAFKGKNGPF--ETLRLDMMEKTTSMYSDADIIIFNTGHWWT  449

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+HV+  L V+EA+++AL+TW RWVD +++ ++T + FRGYSA+HF 
Sbjct  450  HEKTSRGEDYYQEGNHVHARLKVLEAYKRALSTWARWVDKNLDGSRTQIFFRGYSATHFR  509

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG WNSGG C  E EPI  + YL  YP KM+VL  VL+ M T V Y+N++R+TD+RKD H
Sbjct  510  GGPWNSGGQCHKETEPIFKKAYLKKYPSKMKVLHHVLHNMTTPVIYMNISRLTDYRKDGH  569

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK+Y + EE+ + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  570  PSIYRKEYKTVEEQMAGVHAQDCSHWCLPGVPDTWNELLYASLL  613



>ref|XP_002265658.2| PREDICTED: protein trichome birefringence-like 2 [Vitis vinifera]
Length=623

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  APFLVQE     +   +  ETLRLD +  S   + +ADI+VFNTGHWWT
Sbjct  393  EDYNCSVDFVNAPFLVQESSFNGR--NRTFETLRLDEMDKSTTTFHDADIIVFNTGHWWT  450

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GE YYQEG++V+  L V++A+ KALTTW RWVD +IN   T V FRGYS +HF 
Sbjct  451  HEKTSRGEYYYQEGNYVHPRLKVLKAYTKALTTWARWVDKNINSNMTQVFFRGYSITHFK  510

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  EVEPI NE ++  YP KM  LE VL  M+T V+YLNV+R+TD+RKD H
Sbjct  511  GGQWNSGGQCHKEVEPIFNEAFIRKYPSKMRALEPVLQMMRTPVTYLNVSRLTDYRKDGH  570

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK+Y + EE  + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  571  PSIYRKEYKTVEEEIAAVHSQDCSHWCLPGVPDTWNELLYASLL  614



>ref|XP_010227191.1| PREDICTED: protein trichome birefringence-like 2 [Brachypodium 
distachyon]
Length=733

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 169/223 (76%), Gaps = 0/223 (0%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+V+F  + FLV+E     K G      LRLD +  +   Y+ A I+VFNTGHWWTH
Sbjct  502  DYNCSVDFIRSIFLVKELVRESKNGTVLDAKLRLDELDATTPAYQTASIVVFNTGHWWTH  561

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
             KTSKG +YYQEG+HVY  L V++A++KALTTW RWVD +++P +T V+FRG+S +HF G
Sbjct  562  SKTSKGLNYYQEGNHVYPSLEVMDAYKKALTTWARWVDKNVDPGRTQVVFRGFSLTHFRG  621

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNSGG C  E EPI N+TYLT YP +M +LE+VL+ MKT V YLN++R+TD+RKD HP
Sbjct  622  GQWNSGGRCHRETEPIFNQTYLTEYPERMRILEQVLSRMKTPVIYLNISRLTDYRKDGHP  681

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            S+YR +Y +EEER + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  682  SVYRVRYDTEEERMAAVMKQDCSHWCLPGVPDTWNELLYASLL  724



>gb|KHG00171.1| U3 small nucleolar RNA-associated 6 [Gossypium arboreum]
Length=179

 Score =   277 bits (708),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -1

Query  601  EDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSGGQWNSG  422
            +DYYQEGSHVY+ELNV+EAFRKALTTW RWVD  +NP KT V FRGYSASHF GGQWNSG
Sbjct  6    KDYYQEGSHVYNELNVLEAFRKALTTWARWVDASVNPMKTMVFFRGYSASHFGGGQWNSG  65

Query  421  GACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPSMYR--  248
            GACD E +PIKNETYL PYPPKM VLE VL GMKT V+YLN+TR+TDFRKD HPS+YR  
Sbjct  66   GACDSETKPIKNETYLKPYPPKMLVLESVLKGMKTHVTYLNITRLTDFRKDGHPSIYRKH  125

Query  247  -KQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
             KQ + E+ER +PL+YQDCSHWCLPGVPD WNELLYAELLVK+
Sbjct  126  PKQTVPEDERVAPLKYQDCSHWCLPGVPDSWNELLYAELLVKE  168



>ref|XP_009795954.1| PREDICTED: protein trichome birefringence-like 2 [Nicotiana sylvestris]
Length=621

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 170/224 (76%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV++     K G    ETLRLDL+  +   Y +ADI++FNTGHWWT
Sbjct  391  EDYNCSVDFVSSPFLVRQSAFKGKNGSF--ETLRLDLMEKTTSMYSDADIVIFNTGHWWT  448

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+HV+  L V+EA+++AL+TW RWVD +++ ++T + FRGYSA+HF 
Sbjct  449  HEKTSRGEDYYQEGNHVHARLKVLEAYKRALSTWARWVDKNLDGSRTQIFFRGYSATHFR  508

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG WN GG C  E EPI  + YL  YP KM+VL  VL+ M T V Y+N++R+TD+RKD H
Sbjct  509  GGPWNLGGQCHKETEPIFKKAYLKKYPSKMKVLHHVLHNMTTPVIYMNISRLTDYRKDGH  568

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK+Y + EE+ + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  569  PSIYRKEYKTVEEQMAGVHAQDCSHWCLPGVPDTWNELLYASLL  612



>gb|KDO71838.1| hypothetical protein CISIN_1g045325mg, partial [Citrus sinensis]
Length=412

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 170/225 (76%), Gaps = 5/225 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             +Y C+++F  +PFLVQE + +DK G +  ETLRLD++  S+ KY +ADI++FNTGHWWT
Sbjct  185  RDYMCSIDFIKSPFLVQESKFSDKSGARG-ETLRLDMIQGSSTKYGDADIIIFNTGHWWT  243

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KT KG +Y+QEGSHVY++L V EA+ KAL TW +WVD +I+  +T V FRGYSASHF 
Sbjct  244  HHKTFKGYNYFQEGSHVYNKLEVKEAYTKALKTWAQWVDANIDSNRTRVFFRGYSASHFR  303

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
             GQWN+ G+C  E++PI ++TY+  YP  M VLE V+  MKT V YLN+TRMTD+R+D H
Sbjct  304  KGQWNTRGSCHGEMKPIASDTYIATYPWMMRVLESVIAEMKTPVFYLNITRMTDYRQDGH  363

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YR++    E  R P  +QDCSHWCLPGVPD WNELLYA LL+
Sbjct  364  PSIYRQR----EIPRGPGMFQDCSHWCLPGVPDSWNELLYATLLI  404



>ref|XP_006602386.1| PREDICTED: protein YLS7-like [Glycine max]
Length=533

 Score =   288 bits (738),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 164/224 (73%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F V+PF+VQE     K G    ETLRLDL+  +  +Y +A+I+VFNTGHWWT
Sbjct  303  EDYNCSVDFVVSPFIVQESTFNGKNGSF--ETLRLDLMDRTTARYCDANIIVFNTGHWWT  360

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KTSKGEDYYQEG+HVY  L V++A+ +ALTTW +WVD  IN  +T V FRG+S +HF 
Sbjct  361  HDKTSKGEDYYQEGNHVYPRLEVLDAYTRALTTWAKWVDQKINADQTQVFFRGFSVTHFW  420

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NE YL  YP KM  LE V+  MK +V Y+N++R+TD+RKD H
Sbjct  421  GGQWNSGGQCHKETEPIFNEAYLQRYPSKMLALEHVIQQMKARVVYMNISRLTDYRKDGH  480

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y +     +   ++DCSHWCLPGVPD WNELLY  LL
Sbjct  481  PSVYRTGYKASMNHNTAALFEDCSHWCLPGVPDTWNELLYVSLL  524



>ref|XP_010553609.1| PREDICTED: protein trichome birefringence-like 2 [Tarenaya hassleriana]
Length=556

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 171/233 (73%), Gaps = 3/233 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PFLV+E     + G    ETLRLDL+  +   Y++ADILVFNTGHWWT
Sbjct  325  EDYNCTVDFVGSPFLVRESSFKGENGTF--ETLRLDLMDKTTSMYQDADILVFNTGHWWT  382

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG++V+  L V++A+++AL TW RWVD +I+  +T V+FRGYS +HF 
Sbjct  383  HDKTKLGENYYQEGNYVHPRLKVLKAYKRALMTWARWVDQNIDRNRTHVIFRGYSVTHFR  442

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EPI N+ YL  YP KM  LE +L + MKT V Y+N++R+TDFRKD 
Sbjct  443  GGPWNSGGQCHRETEPIFNKRYLAKYPSKMRALEYILRDEMKTPVIYMNISRLTDFRKDG  502

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSS  107
            HPS+YRK Y +E ERR  + +QDCSHWCLPGVPD WNELLY  LL K    SS
Sbjct  503  HPSIYRKVYETEGERREAVSHQDCSHWCLPGVPDTWNELLYVSLLKKARIVSS  555



>ref|XP_006356414.1| PREDICTED: uncharacterized protein LOC102583109 [Solanum tuberosum]
Length=570

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV++     K G    ETLRLDL+  +   Y +ADI++FNTGHWWT
Sbjct  340  EDYNCSVDFVSSPFLVRQSTFKGKNGSF--ETLRLDLMDKTTSMYSDADIVIFNTGHWWT  397

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+HV+  L V+EA+++A++TW RWVD +   ++T V+FRGYS +HF 
Sbjct  398  HEKTSRGEDYYQEGNHVHGRLKVLEAYKRAISTWARWVDQNFGGSRTQVIFRGYSVTHFR  457

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG WNSGG C  E EPI  + YL  YP KM+VL  VL+ M T V Y+N++R+TD+RKD H
Sbjct  458  GGPWNSGGQCHKETEPIFKKAYLAKYPSKMKVLHHVLHNMTTPVIYMNISRLTDYRKDGH  517

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK+Y + E++ + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  518  PSIYRKEYKTVEKQMAGVHSQDCSHWCLPGVPDTWNELLYASLL  561



>ref|XP_006488998.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=457

 Score =   285 bits (730),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 170/225 (76%), Gaps = 5/225 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             +Y C+++F  +PFLVQE + +DK G +  ETLRLD++  S+ KY +ADI++FNTGHWWT
Sbjct  230  RDYMCSIDFIKSPFLVQESKFSDKSGARG-ETLRLDMIQGSSTKYGDADIIIFNTGHWWT  288

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KT KG +Y+QEGSHVY++L V EA+ KAL TW +WVD +I+  +T V FRGYSASHF 
Sbjct  289  HHKTFKGYNYFQEGSHVYNKLEVKEAYTKALKTWAQWVDANIDSNRTRVFFRGYSASHFR  348

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
             GQWN+ G+C  E++PI ++TY+  YP  M VLE V+  MKT V YLN+TRMTD+R+D H
Sbjct  349  KGQWNTRGSCHGEMKPIASDTYIATYPWMMRVLESVIAEMKTPVFYLNITRMTDYRQDGH  408

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YR++    E  R P  +QDCSHWCLPGVPD WNELLYA LL+
Sbjct  409  PSIYRQR----EIPRGPGMFQDCSHWCLPGVPDSWNELLYATLLI  449



>ref|XP_010026659.1| PREDICTED: protein trichome birefringence-like 2 [Eucalyptus 
grandis]
Length=525

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E YNC+V+F  APFLV+E   ++  G     TLR+DL+  +   Y++ADI+VFNTGHWWT
Sbjct  296  EGYNCSVDFVGAPFLVRESSFSNGNGSFG--TLRIDLMDRTTRTYRDADIIVFNTGHWWT  353

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKT++GE YYQEG +V+  L V++A+++AL TW +W+D +I+  +T VLFRGYS +HF 
Sbjct  354  HEKTTRGEHYYQEGKYVHPRLKVLDAYKRALRTWAKWIDKNIHQTRTQVLFRGYSVTHFR  413

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI NE+YL  YP KM VLE VL  M+T V+YLN++R+TD+RKD H
Sbjct  414  GGQWNSGGQCHKETEPIFNESYLENYPSKMRVLENVLQEMRTPVTYLNISRLTDYRKDGH  473

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y + +E+ +  + QDCSHWCLPGVPD WNELLYA LL
Sbjct  474  PSVYRTAYRTAQEQMAAEQSQDCSHWCLPGVPDTWNELLYASLL  517



>emb|CCI55362.1| PH01B035L11.7 [Phyllostachys edulis]
Length=696

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 167/224 (75%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             +YNC+V+F  + FLV+E  I++ K       LRLD +  +   Y+ ADI+VFNTGHWWT
Sbjct  465  RDYNCSVDFIRSIFLVKEL-ISESKSGAVDRKLRLDELDGATPAYRTADIVVFNTGHWWT  523

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KTS+G +YYQEG+HVY  L V +AF+KALTTW RWVD +I+  +T V+FRGYS +HF 
Sbjct  524  HSKTSRGLNYYQEGNHVYPSLEVTDAFKKALTTWARWVDKNIDSRRTQVVFRGYSLAHFR  583

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N+TYLT YP KM +LE+VL  MKT V YLN++ +TD+RKD H
Sbjct  584  GGQWNSGGKCHRETEPIFNQTYLTAYPEKMRILEQVLRQMKTPVIYLNISTLTDYRKDGH  643

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y +EEER + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  644  PSVYRVWYNTEEERMAAVTKQDCSHWCLPGVPDTWNELLYASLL  687



>ref|XP_004502134.1| PREDICTED: uncharacterized protein LOC101510392 [Cicer arietinum]
Length=449

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 167/230 (73%), Gaps = 5/230 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQK---KKETLRLDLVAHSADKYKNADILVFNTGH  632
            ++Y C+++F  +PFLVQEW++  K G     ++ETLRLD++  S   Y NADI++FNTGH
Sbjct  214  KDYGCSIDFVKSPFLVQEWKVLRKDGASVSLQRETLRLDMIQASKSLYHNADIIIFNTGH  273

Query  631  WWTHEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSAS  452
            WW H+KT  G +Y+QEG+HVY +L V EA RKAL TW +WVD+ ++  KT V F G+SAS
Sbjct  274  WWNHDKTKNGRNYFQEGNHVYEKLQVSEALRKALKTWAKWVDSKVDSRKTRVFFTGFSAS  333

Query  451  HFSGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            H+ GGQWNSGG CD E +PI NE+YL  YP  M ++E V+  MKT V YLN+T+MTD+RK
Sbjct  334  HYKGGQWNSGGKCDGERQPITNESYLGAYPWTMGIVEEVIAEMKTPVFYLNITKMTDYRK  393

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQ  122
            D HPS+YR+   ++   R     QDCSHWCLPG+PD WN+LLYA LL+ Q
Sbjct  394  DGHPSIYREAGFNDN--RGHKMVQDCSHWCLPGIPDSWNQLLYATLLMAQ  441



>ref|XP_003517720.1| PREDICTED: protein YLS7-like [Glycine max]
Length=525

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 165/225 (73%), Gaps = 3/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PF+VQE       G    ETLRLDL+  ++  Y +ADI+VFNTGHWWT
Sbjct  294  EDYNCSVDFVSSPFIVQESTFKGINGSF--ETLRLDLMDQTSTTYHDADIIVFNTGHWWT  351

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQ G+HVY  L V++A+ +ALTTW RWVD +I+  +T V FRGYS +HF 
Sbjct  352  HEKTSRGEDYYQVGNHVYPRLKVLDAYTRALTTWARWVDKNIDANRTQVFFRGYSVTHFR  411

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLER-VLNGMKTQVSYLNVTRMTDFRKDA  266
            GGQWNSGG C  E EPI N  +L  YP KM   E  V+  MKT V Y+N++R+TD+RKD 
Sbjct  412  GGQWNSGGKCHKETEPISNGKHLRKYPSKMRAFEHVVIPKMKTPVIYMNISRLTDYRKDG  471

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR +Y + EER +  ++QDCSHWCLPGVPD WNELLY  LL
Sbjct  472  HPSIYRMEYKTAEERTAAEQHQDCSHWCLPGVPDTWNELLYVSLL  516



>gb|EYU28435.1| hypothetical protein MIMGU_mgv1a003426mg [Erythranthe guttata]
Length=586

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 167/224 (75%), Gaps = 5/224 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+++F  +PFLV+E     K G    ETLRLDL+  +   Y +AD+++FNTGHWWT
Sbjct  359  EDYNCSIDFVSSPFLVKESSFNGKNGSF--ETLRLDLMDGTTSMYHDADVIIFNTGHWWT  416

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GE YYQEG+HV+  L V+EA+++A+ TW +WVD +I+  KT V+FRGYS +HF 
Sbjct  417  HEKTSRGEGYYQEGNHVHPRLKVLEAYKRAIITWAKWVDKNIDSNKTEVIFRGYSVTHFR  476

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG WNSGG C+ E EPI N+TYL  YP KM +LE VL  MKT V+YLN++R+TD+RKD H
Sbjct  477  GGPWNSGGQCNKETEPIFNDTYLAKYPSKMRILEYVLKDMKTPVTYLNISRLTDYRKDGH  536

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y + ++    +  QDCSHWCLPGVPD WNELLY  LL
Sbjct  537  PSVYRPDYQTAQQE---VHAQDCSHWCLPGVPDTWNELLYVSLL  577



>ref|XP_004238644.1| PREDICTED: protein trichome birefringence-like 2 [Solanum lycopersicum]
Length=543

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 169/224 (75%), Gaps = 5/224 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV++     K G    ETLRLDL+  +   Y +ADI++FNTGHWWT
Sbjct  316  EDYNCSVDFVSSPFLVRQSTFKGKNGSF--ETLRLDLMDKTTSMYSDADIVIFNTGHWWT  373

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+HV+  L V+EA+++A++TW RWVD + + +++ V+FRGYS +HF 
Sbjct  374  HEKTSRGEDYYQEGNHVHGRLKVLEAYKRAISTWARWVDQNFDGSRSQVIFRGYSVTHFR  433

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG WNSGG C  E EPI N++YL  YP KM+VL  VL+ M T V Y+N++R+TD+RKD H
Sbjct  434  GGPWNSGGQCHKEREPIFNKSYLAKYPSKMKVLHHVLHNMTTPVIYMNISRLTDYRKDGH  493

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YRK+Y   EE    +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  494  PSIYRKEYKRVEE---AIHSQDCSHWCLPGVPDTWNELLYASLL  534



>ref|XP_010473258.1| PREDICTED: protein trichome birefringence-like 2 [Camelina sativa]
Length=541

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G K  ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  310  EDYNCTVDFVGSPFFVRESSFKGVNGTKL-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  368

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++AL TW +WVD +I+   T V+FRGYS +HF 
Sbjct  369  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALITWAKWVDKNIDRNHTHVIFRGYSVTHFR  428

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EPI N  YL  YP KM  LE +L + MKT V Y+NV+R+TDFRKD 
Sbjct  429  GGPWNSGGQCHKETEPIYNTMYLAKYPSKMRALEYILRDTMKTPVVYMNVSRLTDFRKDG  488

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E+E+R  +R+QDCSHWCLPGVPD WN+LLY  LL
Sbjct  489  HPSIYRMVYRTEKEKREAVRHQDCSHWCLPGVPDTWNQLLYVSLL  533



>ref|XP_007157368.1| hypothetical protein PHAVU_002G064300g [Phaseolus vulgaris]
 gb|ESW29362.1| hypothetical protein PHAVU_002G064300g [Phaseolus vulgaris]
Length=518

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 166/225 (74%), Gaps = 3/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PF+V+E       G    ETLRLDL+  +   Y +ADI+VFNTGHWWT
Sbjct  287  EDYNCSVDFVSSPFIVRESTFKGTNGSF--ETLRLDLMDQTTSTYHDADIIVFNTGHWWT  344

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG+H+Y  L V++A+ +ALTTW +W+D +I+  +T V FRGYS +HF 
Sbjct  345  HEKTSRGEDYYQEGNHIYPRLKVLDAYTRALTTWAKWIDNNIDANRTQVFFRGYSVTHFR  404

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLER-VLNGMKTQVSYLNVTRMTDFRKDA  266
            GGQWNSGG C  E EPI +  +L  YP KM  LE  V+  MKT V Y+N++R+TD+RKD 
Sbjct  405  GGQWNSGGQCHKETEPITDGKHLRKYPSKMRALEHVVIPKMKTPVIYMNISRLTDYRKDG  464

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR +Y + EE+ S   +QDCSHWCLPGVPD WNELLYA LL
Sbjct  465  HPSIYRMEYKTPEEQASAELHQDCSHWCLPGVPDTWNELLYASLL  509



>ref|XP_002886589.1| hypothetical protein ARALYDRAFT_475253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62848.1| hypothetical protein ARALYDRAFT_475253 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E    D  G    ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  288  EDYNCTVDFVGSPFFVRESSFKDVNGTTL-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  346

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++AL TW +WVD +I+ ++T V+FRGYS +HF 
Sbjct  347  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALITWAKWVDKNIDRSQTHVVFRGYSVTHFR  406

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EPI N  YL  YP KM+ LE +L + MKT V Y+N++R+TDFRKD 
Sbjct  407  GGPWNSGGQCHKETEPIFNTRYLAKYPSKMKALEYILRDTMKTPVIYMNISRLTDFRKDG  466

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E+E+R  + +QDCSHWCLPG+PD WN+LLY  LL
Sbjct  467  HPSIYRMVYRTEKEKREAVSHQDCSHWCLPGIPDTWNQLLYVSLL  511



>ref|XP_002448144.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
 gb|EES12472.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
Length=720

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 171/224 (76%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             EYNC+V+F  + FLV++  I + +   +   L+LD +  +   Y+ ADI+VFNTGHWWT
Sbjct  489  REYNCSVDFIRSIFLVRQM-IREGRNGTEDAKLKLDELDATTPAYRTADIIVFNTGHWWT  547

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KTS+G +YYQEG+HVY  L+V++A+++AL TW RWVD +I+P +T V+FRGYS SHF 
Sbjct  548  HYKTSRGLNYYQEGNHVYPSLDVLDAYKRALVTWARWVDKNIDPRRTQVVFRGYSLSHFR  607

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N+TYLT YP KM +LE+VL  MKT V YLN++ +TD+RKD H
Sbjct  608  GGQWNSGGRCHTETEPILNQTYLTEYPEKMVILEQVLRQMKTPVIYLNISALTDYRKDGH  667

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +EEER + ++ QDCSHWCLPGVPD WN+LLYA LL
Sbjct  668  PSVYRVRYDTEEERMAMVKRQDCSHWCLPGVPDTWNQLLYASLL  711



>ref|XP_006302106.1| hypothetical protein CARUB_v10020097mg [Capsella rubella]
 gb|EOA35004.1| hypothetical protein CARUB_v10020097mg [Capsella rubella]
Length=548

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G K  ETLRLD++  +   Y +ADIL+FNTGHWWT
Sbjct  317  EDYNCTVDFVGSPFFVRESSFKGVNGTKL-ETLRLDMMDKTTSMYSDADILIFNTGHWWT  375

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++ALTTW +WVD +I+ + T V+FRGYS +HF 
Sbjct  376  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALTTWAKWVDKNIDRSHTHVIFRGYSVTHFR  435

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EPI N  YL  YP KM+  E +L + MKT V Y+N++R+TDFRKD 
Sbjct  436  GGPWNSGGQCHKETEPIFNTRYLAKYPSKMKAFEYILRDTMKTPVIYMNISRLTDFRKDG  495

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HP++YR  Y +E+E+R  +R+QDCSHWCLPGVPD WN+LLY  LL
Sbjct  496  HPAIYRMVYRTEKEKREAVRHQDCSHWCLPGVPDTWNQLLYVSLL  540



>ref|XP_008663376.1| PREDICTED: protein trichome birefringence-like 16 [Zea mays]
Length=715

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 170/224 (76%), Gaps = 1/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             +YNC+V+F  + FLV+E  I + +   +   L+LD +  +   Y+ ADI+VFNTGHWWT
Sbjct  484  RDYNCSVDFIRSIFLVRE-TIREGRNGTEDAKLKLDELDATTPAYQTADIVVFNTGHWWT  542

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KTS+G +YYQEG+HVY  L+V++A+R+AL TW RWVD +I+P +T V+FRGYS SHF 
Sbjct  543  HYKTSRGLNYYQEGNHVYPSLDVLDAYRRALVTWARWVDKNIDPRRTQVVFRGYSLSHFR  602

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N+TYLT YP KM VLE+VL  MKT V YLN++ +TD+RKD H
Sbjct  603  GGQWNSGGRCHGETEPIFNQTYLTEYPEKMVVLEQVLRQMKTPVIYLNISTLTDYRKDGH  662

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +  +EEER + ++ QDCSHWCLPGVPD WNELLYA LL
Sbjct  663  PSVYRIRCDTEEERMAMVKKQDCSHWCLPGVPDTWNELLYASLL  706



>ref|XP_010418022.1| PREDICTED: protein trichome birefringence-like 2 [Camelina sativa]
Length=545

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G K  ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  314  EDYNCTVDFVGSPFFVRESSFKGVNGTKL-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  372

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++ALTTW +WVD +I+   T V+FRGYS +HF 
Sbjct  373  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALTTWAKWVDKNIDRNHTHVIFRGYSVTHFR  432

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EPI N  YL  YP KM  LE +L + MKT V Y+N++R+TDFRKD 
Sbjct  433  GGPWNSGGQCHKETEPIFNTKYLAKYPSKMRALEYILRDTMKTPVVYMNISRLTDFRKDG  492

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E E+R  + +QDCSHWCLPGVPD WN+LLY  LL
Sbjct  493  HPSIYRMVYKTEREKRKAVSHQDCSHWCLPGVPDTWNQLLYVSLL  537



>ref|XP_003519825.1| PREDICTED: protein YLS7-like [Glycine max]
Length=535

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 165/225 (73%), Gaps = 3/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PF+VQE       G    ETLRLDL+  ++  Y++ADI+VFNTGHWWT
Sbjct  304  EDYNCSVDFVSSPFIVQESNFKGINGSF--ETLRLDLMDQTSTTYRDADIIVFNTGHWWT  361

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQ G+HVY  L V++A+ +ALTTW  WVD +I+  +T V FRGYS +HF 
Sbjct  362  HEKTSRGEDYYQVGNHVYPRLKVLDAYTRALTTWATWVDNNIDANRTQVFFRGYSVTHFR  421

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLER-VLNGMKTQVSYLNVTRMTDFRKDA  266
            GGQWNSGG C  E EPI N  +L  YP KM   E  V+  MKT V Y+N++R+TD+RKD 
Sbjct  422  GGQWNSGGKCHKETEPISNGKHLRKYPSKMRAFEHVVIPKMKTPVIYMNISRLTDYRKDG  481

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR +Y + EE+ +  ++QDCSHWCLPGVPD WNELLY  LL
Sbjct  482  HPSIYRMEYKTAEEQTAAEQHQDCSHWCLPGVPDTWNELLYVSLL  526



>ref|XP_002271893.1| PREDICTED: protein trichome birefringence-like 4 [Vitis vinifera]
 emb|CBI22916.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 165/233 (71%), Gaps = 9/233 (4%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +Y C+++F  +PFLVQE        +  + TLRLD++  S+ KY++ADI+VFNTGHWWTH
Sbjct  236  DYKCSIDFVRSPFLVQE-----TISRTLRATLRLDVIQDSSSKYRDADIIVFNTGHWWTH  290

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            +KT +G++Y+QEG HVY++L V EA+ KAL TW +WVD +I+  +T V FRG+SASHF G
Sbjct  291  QKTYRGQNYFQEGKHVYNKLEVTEAYTKALRTWAQWVDANIDSNRTRVFFRGFSASHFRG  350

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
            GQWNS G CD E  PI NET L+PYP  M  LE V+  M T V YLN+T+MTD+RKD HP
Sbjct  351  GQWNSCGNCDGETRPITNETQLSPYPWMMRTLESVIAEMITPVLYLNITKMTDYRKDGHP  410

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKK  101
            S++R+     E  RS    QDCSHWCLPGVPD WNELLYA LL   Y   S +
Sbjct  411  SIFRQ----PEASRSNEMVQDCSHWCLPGVPDSWNELLYATLLTSSYGSRSNR  459



>gb|AES91931.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=466

 Score =   280 bits (717),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            ++Y C+++F  +PFLVQEW+++      +++TLRLD++  S  +Y +ADI++FNTGHWW 
Sbjct  233  KDYGCSIDFVKSPFLVQEWKVSRDDEVPQRDTLRLDMIQASKSQYYDADIIIFNTGHWWN  292

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  G +Y+QEG+HVY  L V EA +KAL TW +WVD+ ++  +T V F G+SASH+ 
Sbjct  293  HDKTKNGRNYFQEGNHVYDRLEVSEALQKALKTWAKWVDSTVDSTRTRVFFTGFSASHYK  352

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG CD E +PI NE+YL  YP  M ++E V+  MKT V YLN+T+MTD+RKD H
Sbjct  353  GGQWNSGGKCDGERQPITNESYLAAYPWTMGIVEDVIAEMKTPVFYLNITKMTDYRKDGH  412

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            PS+YR+   S+ + R  +  QDCSHWCLPG+PD WNELLY+ LLV
Sbjct  413  PSIYREPGFSDSKGRKMV--QDCSHWCLPGIPDSWNELLYSTLLV  455



>ref|XP_011086599.1| PREDICTED: protein trichome birefringence-like 2 [Sesamum indicum]
Length=598

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 168/224 (75%), Gaps = 6/224 (3%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNC+V+F  +PFLV++   + K G    +TLRLDL+  +   Y +AD+++FNTGHWWT
Sbjct  372  EDYNCSVDFVSSPFLVKQSSFSGKNGSF--DTLRLDLMDETTSMYHDADVMIFNTGHWWT  429

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            HEKTS+GEDYYQEG +V+  L  +EA+++ALTTWGRWVD +++  +T V+FRGYS +HF 
Sbjct  430  HEKTSRGEDYYQEGDYVHPRLKALEAYKRALTTWGRWVDKNVDGNRTQVIFRGYSVTHFR  489

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GG WNSGG C  E EPI NET+L  YP KM+ LE V+ GM+  V+YLN++R++D+RKD H
Sbjct  490  GGPWNSGGECHKETEPIFNETHLAKYPTKMKALEYVVKGMQIPVTYLNISRLSDYRKDGH  549

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR  Y + +E    +  QDCSHWCLPGVPD WNELLY  LL
Sbjct  550  PSIYRPNYEALQE----IHAQDCSHWCLPGVPDTWNELLYVSLL  589



>ref|XP_002519189.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43053.1| conserved hypothetical protein [Ricinus communis]
Length=474

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 168/227 (74%), Gaps = 5/227 (2%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+++F  +PFLVQE + ++  G ++ ETLRLD++  +  KY +ADI++FNTGHWWTH
Sbjct  247  DYNCSIDFVKSPFLVQEVKASEDTGNRR-ETLRLDMIQGTFSKYHHADIIIFNTGHWWTH  305

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            +KT++G+DY+QEGSHVY+ L V EA+ KAL TW  WVD +IN + T V FRGYSASHF  
Sbjct  306  QKTNRGKDYFQEGSHVYNRLKVTEAYTKALWTWAHWVDANINSSHTRVFFRGYSASHFRK  365

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHP  260
              WN+ G CD E +P+ N+T L PYP  M +LE V++ MKT V YLN+TRMTD+RKD HP
Sbjct  366  VPWNAVGRCDGENQPVTNDTDLAPYPWMMSILESVISEMKTPVFYLNITRMTDYRKDGHP  425

Query  259  SMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQY  119
            S+YR+  +    RR     QDCSHWCLPGVPD WNELLYA LL+  +
Sbjct  426  SVYRQSKI----RRDHEMIQDCSHWCLPGVPDSWNELLYATLLLSHH  468



>ref|NP_176278.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8VYR3.1|TBL2_ARATH RecName: Full=Protein trichome birefringence-like 2 [Arabidopsis 
thaliana]
 gb|AAL49770.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91701.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33733.1| uncharacterized protein AT1G60790 [Arabidopsis thaliana]
Length=541

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G    ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  310  EDYNCTVDFVGSPFFVRESSFKGVNGTTL-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  368

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++AL TW +WVD +I+ ++T ++FRGYS +HF 
Sbjct  369  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALITWAKWVDKNIDRSQTHIVFRGYSVTHFR  428

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EPI N +YL  YP KM+ LE +L + MKT V Y+N++R+TDFRKD 
Sbjct  429  GGPWNSGGQCHKETEPIFNTSYLAKYPSKMKALEYILRDTMKTPVIYMNISRLTDFRKDG  488

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E+E+R  + +QDCSHWCLPGVPD WN+LLY  LL
Sbjct  489  HPSIYRMVYRTEKEKREAVSHQDCSHWCLPGVPDTWNQLLYVSLL  533



>gb|KHN00372.1| hypothetical protein glysoja_000040 [Glycine soja]
Length=503

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 164/224 (73%), Gaps = 3/224 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YNC+V+F  +PF+VQE       G    ETLRLDL+  ++  Y++ADI+VFNTGHWWTH
Sbjct  273  DYNCSVDFVSSPFIVQESNFKGINGSF--ETLRLDLMDQTSTTYRDADIIVFNTGHWWTH  330

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+GEDYYQ G+HVY  L V++A+ +ALTTW  WVD +I+  +T V FRGYS +HF G
Sbjct  331  EKTSRGEDYYQVGNHVYPRLKVLDAYTRALTTWATWVDNNIDANRTQVFFRGYSVTHFRG  390

Query  439  GQWNSGGACDHEVEPIKNETYLTPYPPKMEVLER-VLNGMKTQVSYLNVTRMTDFRKDAH  263
            GQWNSGG C  E EPI N  +L  YP KM   E  V+  MKT V Y+N++R+TD+RKD H
Sbjct  391  GQWNSGGKCHKETEPISNGKHLRKYPSKMRAFEHVVIPKMKTPVIYMNISRLTDYRKDGH  450

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y + EE+ +  ++QDCSHWCLPGVPD WNELLY  LL
Sbjct  451  PSIYRMEYKTAEEQTAAEQHQDCSHWCLPGVPDTWNELLYVSLL  494



>ref|XP_010510908.1| PREDICTED: protein trichome birefringence-like 2 [Camelina sativa]
Length=541

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 163/225 (72%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G    ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  310  EDYNCTVDFVGSPFFVRESSFKGVNGTTL-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  368

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG  VY  L V+EA+++AL TW +WVD +I+   T V+FRGYS +HF 
Sbjct  369  HDKTKLGENYYQEGDVVYTRLKVLEAYKRALITWAKWVDKNIDRNHTHVIFRGYSVTHFR  428

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EPI N  YL  YP KM  LE +L + MKT V Y+N++R+TDFRKD 
Sbjct  429  GGPWNSGGQCHKETEPIFNTRYLAKYPSKMRALEYILRDTMKTPVVYMNISRLTDFRKDG  488

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E+E+R  +R+QDCSHWCLPGVPD WN+LLY  LL
Sbjct  489  HPSIYRMVYKTEKEKREAVRHQDCSHWCLPGVPDTWNQLLYVSLL  533



>ref|XP_010671195.1| PREDICTED: protein trichome birefringence-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=474

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 163/226 (72%), Gaps = 5/226 (2%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKG-QKKKETLRLDLVAHSADKYKNADILVFNTGHWW  626
            ++YNCTVEF  +PFLVQEW+    KG + ++E LRLDL+  +   Y +AD L+FNTGHWW
Sbjct  244  QDYNCTVEFIRSPFLVQEWKFPSVKGVESRREMLRLDLIQATTSNYHDADFLIFNTGHWW  303

Query  625  THEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHF  446
            TH KT KG++++QEG  V  +L V EA+ KAL TW  WVD ++N  KT V F GYS SHF
Sbjct  304  THHKTRKGKNFFQEGETVLSKLKVTEAYTKALKTWAEWVDKNVNKNKTQVFFAGYSTSHF  363

Query  445  SGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
             GGQWNSGG CD E EPI ++ YL  YP  M+ LE V++ M T V YLN+++MTD+RKD 
Sbjct  364  RGGQWNSGGNCDGETEPIIDDKYLGSYPWMMKALESVISKMSTPVVYLNISKMTDYRKDG  423

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            HPS+YR+      ERR P  +QDCSHWCLPGVPD WN+LLYA LL+
Sbjct  424  HPSIYRQ---PGTERR-PGMFQDCSHWCLPGVPDSWNQLLYASLLM  465



>emb|CDY40499.1| BnaC09g14570D [Brassica napus]
Length=493

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G    ETLRLD++  +   Y++ADILVFNTGHWWT
Sbjct  262  EDYNCTVDFVGSPFFVRESSFRGVNGTTL-ETLRLDMMDKTTSMYRDADILVFNTGHWWT  320

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++ALTTW +WVD +I+  +T V+FRGYS +HF 
Sbjct  321  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALTTWAKWVDKNIDRNQTHVVFRGYSETHFR  380

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C +E EPI N  YL  YP KM  L+ +L + MKT V Y+N++R+TDFRKD 
Sbjct  381  GGPWNSGGQCHNETEPIYNTHYLKKYPSKMRALDYILRDKMKTPVIYMNISRLTDFRKDG  440

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E+E+R  + +QDCSHWCLPGVPD WN+LLY  LL
Sbjct  441  HPSIYRTVYKTEKEKREAVSHQDCSHWCLPGVPDTWNQLLYVSLL  485



>ref|XP_006392115.1| hypothetical protein EUTSA_v10023395mg [Eutrema salsugineum]
 gb|ESQ29401.1| hypothetical protein EUTSA_v10023395mg [Eutrema salsugineum]
Length=548

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G +  ETLRLDL+  +   YK+ADIL+FNTGHWWT
Sbjct  317  EDYNCTVDFVGSPFFVRESSFKGVNGTRL-ETLRLDLMDKTTSMYKDADILIFNTGHWWT  375

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++AL TW +WVD +IN  +T V+FRGYS +HF 
Sbjct  376  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALATWAKWVDKNINRNQTHVVFRGYSVTHFR  435

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EP  N +YL  YP KM  LE +L + MKT V Y+N++R+TDFRKD 
Sbjct  436  GGPWNSGGQCHKETEPFFNTSYLKKYPSKMRALEYILRDTMKTPVIYMNISRLTDFRKDG  495

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HP++YR  Y +++E+R  + +QDCSHWCLPGVPD WN+LLY  LL
Sbjct  496  HPAIYRMVYRTDKEKREAVSHQDCSHWCLPGVPDTWNQLLYVSLL  540



>emb|CDY69617.1| BnaA09g53160D [Brassica napus]
Length=551

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G    ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  320  EDYNCTVDFVGSPFFVRESSFKGVNGTTL-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  378

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++ALTTW +WVD +I+  +T V+FRGYS +HF 
Sbjct  379  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALTTWAKWVDKNIDRNQTHVVFRGYSETHFR  438

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C +E EPI N  YL  YP KM  L+ +L + MKT V Y+N++R+TDFRKD 
Sbjct  439  GGPWNSGGQCHNETEPIYNTHYLKKYPSKMRALDYILRDKMKTPVIYMNISRLTDFRKDG  498

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E+ERR  + +QDCSHWCLPGVPD WN+LLY  LL
Sbjct  499  HPSIYRTVYKTEKERREAVSHQDCSHWCLPGVPDTWNQLLYVSLL  543



>ref|XP_009113182.1| PREDICTED: protein trichome birefringence-like 2 [Brassica rapa]
Length=542

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G    ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  311  EDYNCTVDFVGSPFFVRESSFRGVNGTTM-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  369

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++ALTTW +WVD +I+  +T V+FRGYS +HF 
Sbjct  370  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALTTWAKWVDKNIDRNQTHVVFRGYSETHFR  429

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C +E EPI N  YL  YP KM+ L+ +L + MKT V Y+N++R+TDFRKD 
Sbjct  430  GGPWNSGGQCHNETEPIYNTHYLKKYPSKMKALDYILRDKMKTPVIYMNISRLTDFRKDG  489

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +E+E+R  + +QDCSHWCLPGVPD WN+LLY  LL
Sbjct  490  HPSIYRTVYKTEKEKREAVSHQDCSHWCLPGVPDTWNQLLYVSLL  534



>gb|KFK40758.1| hypothetical protein AALP_AA2G037100 [Arabis alpina]
Length=535

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
            E+YNCTV+F  +PF V+E       G    ETLRLD++  +   Y++ADIL+FNTGHWWT
Sbjct  304  EDYNCTVDFVGSPFFVRESSFKGVNGTTL-ETLRLDMMDKTTSMYRDADILIFNTGHWWT  362

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT  GE+YYQEG+ VY  L V+EA+++AL TW +WVD +I+ + T V+FRGYS +HF 
Sbjct  363  HDKTKLGENYYQEGNVVYPRLKVLEAYKRALVTWAKWVDKNIDRSHTHVIFRGYSVTHFR  422

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVL-NGMKTQVSYLNVTRMTDFRKDA  266
            GG WNSGG C  E EP  N  YL  YP KM+ LE +L + MKT V Y+N++R+TDFRKD 
Sbjct  423  GGPWNSGGQCHKETEPFFNTRYLAKYPSKMKALEYILRDTMKTPVIYMNISRLTDFRKDG  482

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            HPS+YR  Y +++E+R  + +QDCSHWCLPGVPD WN+LLY  LL
Sbjct  483  HPSIYRMVYRTDKEKREAVSHQDCSHWCLPGVPDTWNQLLYVSLL  527



>ref|NP_001053267.1| Os04g0508000 [Oryza sativa Japonica Group]
 emb|CAE04726.1| OSJNBa0043L24.14 [Oryza sativa Japonica Group]
 emb|CAE75965.1| OSJNBb0002J11.24 [Oryza sativa Japonica Group]
 dbj|BAF15181.1| Os04g0508000 [Oryza sativa Japonica Group]
 gb|EAY94794.1| hypothetical protein OsI_16573 [Oryza sativa Indica Group]
 gb|EAZ31295.1| hypothetical protein OsJ_15402 [Oryza sativa Japonica Group]
Length=711

 Score =   282 bits (721),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 166/224 (74%), Gaps = 0/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             +YNC+V+F  + FLV+E     K G      LRLD +  +   Y+ ADI+VFNTGHWWT
Sbjct  479  RDYNCSVDFIRSIFLVKEMINETKGGAVVDAKLRLDELDETTPAYRTADIVVFNTGHWWT  538

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KTS+G +YYQEG++V+  L V++A+++ALTTW RWVD +I+  +T V+FRGYS +HF 
Sbjct  539  HWKTSRGLNYYQEGNYVHPSLEVMDAYKRALTTWARWVDKNIDSTRTQVVFRGYSLTHFR  598

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N T+L  YP KM +LE+VL  M+T V YLN++ MTD+RKDAH
Sbjct  599  GGQWNSGGRCHRETEPIFNRTHLAEYPEKMRILEQVLGRMRTPVIYLNISAMTDYRKDAH  658

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +EEER + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  659  PSVYRVRYETEEERMAAVAKQDCSHWCLPGVPDSWNELLYASLL  702



>emb|CAH67561.1| OSIGBa0101P20.4 [Oryza sativa Indica Group]
Length=711

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 166/224 (74%), Gaps = 0/224 (0%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWT  623
             +YNC+V+F  + FLV+E     K G      LRLD +  +   Y+ ADI+VFNTGHWWT
Sbjct  479  RDYNCSVDFIRSIFLVKEMINETKGGAVVDAKLRLDELDETTPAYRTADIVVFNTGHWWT  538

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H KTS+G +YYQEG++V+  L V++A+++ALTTW RWVD +I+  +T V+FRGYS +HF 
Sbjct  539  HWKTSRGLNYYQEGNYVHPSLEVMDAYKRALTTWARWVDKNIDSTRTQVVFRGYSLTHFR  598

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
            GGQWNSGG C  E EPI N T+L  YP KM +LE+VL  M+T V YLN++ MTD+RKDAH
Sbjct  599  GGQWNSGGRCHRETEPIFNRTHLAEYPEKMRILEQVLGRMRTPVIYLNISAMTDYRKDAH  658

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            PS+YR +Y +EEER + +  QDCSHWCLPGVPD WNELLYA LL
Sbjct  659  PSVYRVRYETEEERMAAVAKQDCSHWCLPGVPDSWNELLYASLL  702



>gb|EYU17992.1| hypothetical protein MIMGU_mgv1a025478mg [Erythranthe guttata]
Length=485

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 174/232 (75%), Gaps = 6/232 (3%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTH  620
            +YN +VE+  + FLVQEWE+  + G  K ETLRLD V  S D YK+AD+LVFNTG+WWTH
Sbjct  252  DYNVSVEYIRSAFLVQEWEMPIENGSTK-ETLRLDRVEKSYDLYKDADVLVFNTGNWWTH  310

Query  619  EKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSG  440
            EKTS+G+ YYQEG HV+ +L+VVEAF KA++TW RWV+++++P KT V FRGYS SHFS 
Sbjct  311  EKTSEGKGYYQEGDHVHEKLDVVEAFDKAMSTWARWVESNVDPKKTRVFFRGYSFSHFSK  370

Query  439  GQWNSGGACDHEVEPIKNETYLTPY----PPKMEVLERVLNGMKTQVSYLNVTRMTDFRK  272
            G+WNSGG CD   EPIK+   L       PP  ++L++ +  +K+ V YLNVTRMT++R 
Sbjct  371  GEWNSGGRCDSR-EPIKDAKDLLSIEELSPPIPQMLDKSMEKLKSPVVYLNVTRMTNYRS  429

Query  271  DAHPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQ  116
            DAHPS+YRK   + +E+R    +QDCSHWCLPGVPD WN+LL+A+L++ Q Q
Sbjct  430  DAHPSVYRKPNATVQEKRLFETHQDCSHWCLPGVPDTWNQLLFAQLVLSQRQ  481



>ref|XP_006282292.1| hypothetical protein CARUB_v10028578mg [Capsella rubella]
 gb|EOA15190.1| hypothetical protein CARUB_v10028578mg [Capsella rubella]
Length=460

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 167/237 (70%), Gaps = 2/237 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADK-YKNADILVFNTGHWW  626
            ++++C+V+F  +PFLVQE E+ D  G K++ETLRLD+V  S  K YKNADI++FNTGHWW
Sbjct  222  KDFDCSVDFIKSPFLVQESEVLDVYG-KRRETLRLDMVQRSMTKIYKNADIVIFNTGHWW  280

Query  625  THEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHF  446
            TH+KT++G+ Y+QEG  VY  L V EA+ KAL TW  WVD++IN  KT V F GYS+SHF
Sbjct  281  THQKTNEGKGYFQEGKRVYERLEVKEAYTKALHTWADWVDSNINSTKTRVFFVGYSSSHF  340

Query  445  SGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
              G WN+GG CD E  PI+NETY   YP  M+V+E V++ MKT V Y+N+T+MT +R D 
Sbjct  341  RKGAWNNGGQCDGETRPIQNETYTGVYPWMMKVVESVISDMKTPVLYMNITKMTWYRTDG  400

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKKAG  95
            HPS+YR+         +   +QDCSHWCLPGVPD WN+LLYA LLV       K  G
Sbjct  401  HPSVYRQPVDVRGSSSAARMFQDCSHWCLPGVPDSWNQLLYATLLVSHSSLPDKSLG  457



>gb|EYU44003.1| hypothetical protein MIMGU_mgv1a017776mg, partial [Erythranthe 
guttata]
Length=207

 Score =   265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 158/204 (77%), Gaps = 4/204 (2%)
 Frame = -1

Query  718  KKETLRLDLVAHSADKYKNADILVFNTGHWWTHEKTSKGEDYYQEGSHVYHELNVVEAFR  539
            ++ETLRLD++  S +KY +AD++VFNTGHWWTH+KT +G+ Y+QEG HVY++L V +A++
Sbjct  4    RRETLRLDMMEGSYNKYYDADVIVFNTGHWWTHQKTFQGKYYFQEGDHVYNKLAVADAYK  63

Query  538  KALTTWGRWVDTHINPAKTFVLFRGYSASHFSGGQWNSGGACDHEVEPIKNETYLTPYPP  359
            KAL TW +WVD +I+ +KT V FRGYSASHF GGQWNSGG+CD E +PI NET L+PYP 
Sbjct  64   KALKTWAQWVDENIDSSKTSVFFRGYSASHFKGGQWNSGGSCDGETKPITNETQLSPYPW  123

Query  358  KMEVLERVLNGMKTQVSYLNVTRMTDFRKDAHPSMYRKQYLSEEERRSPLRYQDCSHWCL  179
             M  LE VL  MKT V YLN+T+MTD+RKD HPS++R+   S    ++ + +QDCSHWCL
Sbjct  124  MMRALESVLMKMKTPVFYLNITKMTDYRKDGHPSIFRR---SSSNIKNGV-FQDCSHWCL  179

Query  178  PGVPDYWNELLYAELLVKQYQKSS  107
            PGVPD WNELLY  L+  Q QK S
Sbjct  180  PGVPDSWNELLYVILVQSQNQKLS  203



>ref|XP_010471907.1| PREDICTED: protein trichome birefringence-like 4 [Camelina sativa]
Length=318

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 164/226 (73%), Gaps = 2/226 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADK-YKNADILVFNTGHWW  626
            ++++C+++F  +PFLVQE E  D  G K++ETLRLD++  S  K YKNADI++FNTGHWW
Sbjct  87   QDFDCSIDFIKSPFLVQESEALDVYG-KRRETLRLDMIQRSMTKIYKNADIVIFNTGHWW  145

Query  625  THEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHF  446
            TH+KT +G+ Y+QEG  VY  L V EA+ KAL TW  WVD++IN ++T V F GYS+SHF
Sbjct  146  THQKTYEGKGYFQEGKRVYERLEVKEAYTKALHTWADWVDSNINSSRTRVFFVGYSSSHF  205

Query  445  SGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
              G WN+GG CD E  PI+NETY   YP  M+V+E V++ MKT V Y+N+T+MT +R D 
Sbjct  206  RKGAWNNGGECDGETRPIQNETYTGAYPWMMKVVESVISDMKTPVFYMNITKMTWYRTDG  265

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            HPS+YR+         +   +QDCSHWCLPGVPD WN+LLYA LLV
Sbjct  266  HPSVYRQPVEVRGSSPAARMFQDCSHWCLPGVPDSWNQLLYATLLV  311



>emb|CDY33914.1| BnaA02g30730D [Brassica napus]
Length=452

 Score =   273 bits (697),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 166/226 (73%), Gaps = 2/226 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADK-YKNADILVFNTGHWW  626
            +++ C+++F  +PFLVQE E+ D  G K+KETLRLD++  S  K Y+NADI+VFNTGHWW
Sbjct  214  KDFECSIDFIKSPFLVQESEVLDAYG-KRKETLRLDVIQESITKIYRNADIVVFNTGHWW  272

Query  625  THEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHF  446
            TH+KT++G+DY+QEG  VY +L V EA+ KAL TW  WVD+ IN  +T V F GYS+SHF
Sbjct  273  THQKTNEGKDYFQEGDRVYEKLEVKEAYTKALRTWADWVDSSINSTRTRVFFVGYSSSHF  332

Query  445  SGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
              G WN+GG CD E  PI+NETY   YP  M+V+E V++ MKT V Y+N+T+MT +R D 
Sbjct  333  RKGAWNAGGQCDGETRPIENETYTGGYPWMMKVVESVISDMKTPVFYMNITKMTWYRTDG  392

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            HPS+YR+   +     +   +QDCSHWCLPGVPD WN+LLYA LLV
Sbjct  393  HPSVYRQPVDARGSSPASGMFQDCSHWCLPGVPDSWNQLLYATLLV  438



>ref|XP_009129778.1| PREDICTED: protein trichome birefringence-like 4 [Brassica rapa]
Length=452

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 166/226 (73%), Gaps = 2/226 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADK-YKNADILVFNTGHWW  626
            +++ C+++F  +PFLVQE E+ D  G K+KETLRLD++  S  K Y+NADI+VFNTGHWW
Sbjct  214  KDFECSIDFIKSPFLVQESEVLDAYG-KRKETLRLDVIQESITKIYRNADIVVFNTGHWW  272

Query  625  THEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHF  446
            TH+KT++G+DY+QEG  VY +L V EA+ KAL TW  WVD+ IN  +T V F GYS+SHF
Sbjct  273  THQKTNEGKDYFQEGDRVYEKLEVKEAYTKALRTWADWVDSSINSTRTRVFFVGYSSSHF  332

Query  445  SGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
              G WN+GG CD E  PI+NETY   YP  M+V+E V++ MKT V Y+N+T+MT +R D 
Sbjct  333  RKGAWNAGGQCDGETRPIENETYTGGYPWMMKVVESVISDMKTPVFYMNITKMTWYRTDG  392

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLV  128
            HPS+YR+   +     +   +QDCSHWCLPGVPD WN+LLYA LLV
Sbjct  393  HPSVYRQPVDARGSSPASGMFQDCSHWCLPGVPDSWNQLLYATLLV  438



>gb|KHN14559.1| hypothetical protein glysoja_027168 [Glycine soja]
Length=521

 Score =   274 bits (701),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -1

Query  787  TVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADKYKNADILVFNTGHWWTHEKTS  608
             ++F  +PF+VQE       G    ETLRLDL+  ++  Y +ADI+VFNTGHWWTHEKTS
Sbjct  295  AIDFVSSPFIVQESTFKGINGSF--ETLRLDLMDQTSTTYHDADIIVFNTGHWWTHEKTS  352

Query  607  KGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFSGGQWN  428
            +GEDYYQ G+HVY  L V++A+ +ALTTW RWVD +I+  +T V FRGYS +HF GGQWN
Sbjct  353  RGEDYYQVGNHVYPRLKVLDAYTRALTTWARWVDKNIDANRTQVFFRGYSVTHFRGGQWN  412

Query  427  SGGACDHEVEPIKNETYLTPYPPKMEVLER-VLNGMKTQVSYLNVTRMTDFRKDAHPSMY  251
            SGG C  E EPI N  +L  YP KM   E  V+  MKT V Y+N++R+TD+RKD HPS+Y
Sbjct  413  SGGKCHKETEPISNGKHLRKYPSKMRAFEHVVIPKMKTPVIYMNISRLTDYRKDGHPSIY  472

Query  250  RKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELL  131
            R +Y + EER +  ++QDCSHWCLPGVPD WNELLY  LL
Sbjct  473  RMEYKTAEERTAAEQHQDCSHWCLPGVPDTWNELLYVSLL  512



>ref|NP_199745.1| protein TRICHOME BIREFRINGENCE-LIKE [Arabidopsis thaliana]
 sp|Q9FJ06.1|TBL4_ARATH RecName: Full=Protein trichome birefringence-like 4 [Arabidopsis 
thaliana]
 dbj|BAB10352.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95799.1| protein trichome birefringence-like 4 [Arabidopsis thaliana]
Length=457

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -1

Query  799  EYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADK-YKNADILVFNTGHWWT  623
            ++ C+++F  +PFLVQE E+ D  G K++ETLRLD++  S  K YKNADI++FNTGHWWT
Sbjct  220  DFECSIDFIKSPFLVQESEVVDVYG-KRRETLRLDMIQRSMTKIYKNADIVIFNTGHWWT  278

Query  622  HEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHFS  443
            H+KT +G+ YYQEG+ VY  L V EA+ KA+ TW  WVD++IN  KT V F GYS+SHF 
Sbjct  279  HQKTYEGKGYYQEGNRVYERLEVKEAYTKAIHTWADWVDSNINSTKTRVFFVGYSSSHFR  338

Query  442  GGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDAH  263
             G WNSGG CD E  PI+NETY   YP  M+V+E V++ MKT V Y+N+T+MT +R D H
Sbjct  339  KGAWNSGGQCDGETRPIQNETYTGVYPWMMKVVESVISEMKTPVFYMNITKMTWYRTDGH  398

Query  262  PSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKKAG  95
            PS+YR+         +   YQDCSHWCLPGVPD WN+LLYA LLV       K  G
Sbjct  399  PSVYRQPADPRGTSPAAGMYQDCSHWCLPGVPDSWNQLLYATLLVSHGSLPDKSLG  454



>emb|CDY00034.1| BnaC09g02670D [Brassica napus]
Length=450

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 170/237 (72%), Gaps = 2/237 (1%)
 Frame = -1

Query  802  EEYNCTVEFFVAPFLVQEWEIADKKGQKKKETLRLDLVAHSADK-YKNADILVFNTGHWW  626
            +++ C+V+F  +PFLVQE E+ D  G K+KETLRLD++  S  K YK+ADI+VFNTGHWW
Sbjct  212  KDFGCSVDFIKSPFLVQESEVLDGYG-KRKETLRLDVIQGSIKKIYKDADIIVFNTGHWW  270

Query  625  THEKTSKGEDYYQEGSHVYHELNVVEAFRKALTTWGRWVDTHINPAKTFVLFRGYSASHF  446
            TH+KT +G+DYYQEG+ VY +L V EA+ +AL TW  WVD++IN  KT V F GYS+SHF
Sbjct  271  THQKTYEGKDYYQEGNRVYEKLGVKEAYTRALHTWSDWVDSNINMTKTRVFFVGYSSSHF  330

Query  445  SGGQWNSGGACDHEVEPIKNETYLTPYPPKMEVLERVLNGMKTQVSYLNVTRMTDFRKDA  266
              G WN+GG CD E  PI+N+TY   YP  M+V+E V++ MKT V Y+N+T+MT +R D 
Sbjct  331  RKGAWNAGGQCDGETRPIQNKTYTGGYPWMMKVVESVISDMKTPVFYMNITKMTWYRTDG  390

Query  265  HPSMYRKQYLSEEERRSPLRYQDCSHWCLPGVPDYWNELLYAELLVKQYQKSSKKAG  95
            HPS+YR+   +     +   +QDCSHWCLPGVPD WN+LLYA LLV +     K  G
Sbjct  391  HPSVYRQPVETRGSSPATGVFQDCSHWCLPGVPDSWNQLLYATLLVSRGSLPYKSLG  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1593558888600