BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005O16

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    319   5e-99   Solanum lycopersicum
emb|CAA64415.1|  lipoxygenase (LOX)                                     301   7e-99   Solanum lycopersicum
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               316   1e-97   Solanum tuberosum [potatoes]
emb|CAD10740.1|  lipoxygenase                                           315   3e-97   Corylus avellana [European hazelnut]
ref|XP_010041703.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    295   3e-97   Eucalyptus grandis [rose gum]
gb|ACO57136.1|  lipoxygenase 1                                          314   4e-97   Capsicum annuum
ref|XP_008245951.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    305   6e-97   Prunus mume [ume]
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               314   7e-97   
gb|AGL96414.1|  9-lipoxygenase                                          313   9e-97   Nicotiana benthamiana
emb|CAA58859.1|  lipoxygenase                                           313   1e-96   Nicotiana tabacum [American tobacco]
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    313   1e-96   Nicotiana tomentosiformis
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    312   2e-96   Nicotiana sylvestris
gb|AAO12866.1|  lipoxygenase                                            294   2e-95   Vitis vinifera
emb|CAA64769.1|  lipoxygenase                                           304   9e-95   Solanum tuberosum [potatoes]
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    308   1e-94   Fragaria vesca subsp. vesca
gb|AFU51542.1|  lipoxygenase 3                                          307   2e-94   Capsicum annuum
emb|CDP15504.1|  unnamed protein product                                307   2e-94   Coffea canephora [robusta coffee]
gb|ABW75772.2|  lipoxygenase                                            306   3e-94   Camellia sinensis [black tea]
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             306   3e-94   Nicotiana sylvestris
gb|ACG56281.1|  lipoxygenase                                            306   3e-94   Olea europaea
ref|XP_006355846.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    303   3e-94   
gb|AGK82779.1|  lipoxygenase                                            308   4e-94   Malus domestica [apple tree]
ref|XP_007030817.1|  Lipoxygenase 1                                     306   5e-94   
ref|XP_009365899.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    293   1e-93   Pyrus x bretschneideri [bai li]
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             305   1e-93   Populus trichocarpa [western balsam poplar]
gb|AAZ04411.1|  lipoxygenase                                            305   1e-93   Cynanchum gracillimum
ref|NP_001234098.1|  lipoxygenase                                       305   2e-93   Solanum lycopersicum
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    304   2e-93   Solanum tuberosum [potatoes]
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    304   2e-93   Solanum tuberosum [potatoes]
gb|AAP83134.1|  lipoxygenase                                            304   2e-93   Nicotiana attenuata
gb|AAP83135.1|  lipoxygenase                                            304   2e-93   Nicotiana attenuata
gb|ABF19102.2|  9-lipoxygenase                                          304   3e-93   Capsicum annuum
gb|AEZ50135.1|  lipoxygenase                                            295   3e-93   Diospyros kaki [Japanese persimmon]
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    305   3e-93   
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    303   3e-93   Solanum tuberosum [potatoes]
emb|CBI36802.3|  unnamed protein product                                304   5e-93   Vitis vinifera
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          303   6e-93   Solanum tuberosum [potatoes]
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    303   6e-93   Solanum tuberosum [potatoes]
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             303   6e-93   
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    303   6e-93   Solanum tuberosum [potatoes]
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             303   7e-93   Nicotiana tomentosiformis
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             303   7e-93   Prunus persica
ref|NP_001275351.1|  5-lipoxygenase                                     303   7e-93   Solanum tuberosum [potatoes]
emb|CDP20620.1|  unnamed protein product                                301   8e-93   Coffea canephora [robusta coffee]
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        303   8e-93   Solanum tuberosum [potatoes]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    303   9e-93   Populus euphratica
gb|AGU28274.1|  lipoxygenase 1                                          303   9e-93   Vitis vinifera
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    303   1e-92   Vitis vinifera
gb|ABF60001.1|  lipoxygenase 5                                          292   1e-92   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    302   1e-92   Fragaria vesca subsp. vesca
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    302   2e-92   Sesamum indicum [beniseed]
ref|XP_002319014.2|  lipoxygenase family protein                        301   2e-92   
emb|CAA64765.1|  lipoxygenase                                           301   2e-92   Solanum tuberosum [potatoes]
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                302   2e-92   Gossypium hirsutum [American cotton]
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    301   3e-92   Solanum tuberosum [potatoes]
emb|CAD10779.2|  lipoxygenase                                           301   3e-92   Prunus dulcis [sweet almond]
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    301   4e-92   Populus euphratica
emb|CAB94852.1|  lipoxygenase                                           301   4e-92   Prunus dulcis [sweet almond]
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    301   5e-92   Solanum tuberosum [potatoes]
gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                    299   5e-92   Eucalyptus grandis [rose gum]
emb|CDP20618.1|  unnamed protein product                                300   6e-92   Coffea canephora [robusta coffee]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             300   7e-92   
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 300   8e-92   
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    300   1e-91   Pyrus x bretschneideri [bai li]
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        300   1e-91   Solanum lycopersicum
ref|XP_009365971.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    291   1e-91   
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             300   1e-91   
gb|KJB80991.1|  hypothetical protein B456_013G124500                    296   1e-91   Gossypium raimondii
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    300   1e-91   Eucalyptus grandis [rose gum]
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               299   2e-91   Malus domestica [apple tree]
gb|KGN60916.1|  hypothetical protein Csa_2G023340                       290   2e-91   Cucumis sativus [cucumbers]
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    299   2e-91   Eucalyptus grandis [rose gum]
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    299   3e-91   Nelumbo nucifera [Indian lotus]
ref|XP_010094673.1|  putative linoleate 9S-lipoxygenase 5               296   3e-91   
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    298   3e-91   Nicotiana sylvestris
ref|XP_007034722.1|  PLAT/LH2 domain-containing lipoxygenase fami...    288   3e-91   
gb|AGN75068.1|  lipoxygenase 2                                          298   4e-91   Momordica charantia [balsam pear]
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    298   6e-91   Sesamum indicum [beniseed]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    298   6e-91   Sesamum indicum [beniseed]
ref|NP_001268178.1|  lipoxygenase                                       298   6e-91   Vitis vinifera
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    298   7e-91   Prunus mume [ume]
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    297   9e-91   Eucalyptus grandis [rose gum]
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    297   1e-90   
ref|XP_002315780.1|  lipoxygenase family protein                        297   2e-90   
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    297   2e-90   Sesamum indicum [beniseed]
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    297   2e-90   Sesamum indicum [beniseed]
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    295   2e-90   Citrus sinensis [apfelsine]
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  296   3e-90   Medicago truncatula
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    295   3e-90   Nicotiana sylvestris
gb|KJB80990.1|  hypothetical protein B456_013G124500                    296   4e-90   Gossypium raimondii
gb|KJB80989.1|  hypothetical protein B456_013G124500                    296   4e-90   Gossypium raimondii
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   296   4e-90   Citrus sinensis [apfelsine]
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    296   4e-90   Populus euphratica
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    296   4e-90   Populus euphratica
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             296   4e-90   Citrus clementina [clementine]
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    295   5e-90   Nicotiana sylvestris
ref|XP_009621679.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    294   6e-90   Nicotiana tomentosiformis
gb|AGI16382.1|  lipoxygenase                                            295   7e-90   Malus domestica [apple tree]
gb|AGI16377.1|  lipoxygenase                                            295   7e-90   Malus domestica [apple tree]
gb|AGI16380.1|  lipoxygenase                                            295   1e-89   Malus domestica [apple tree]
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    295   1e-89   Eucalyptus grandis [rose gum]
gb|AGK82798.1|  lipoxygenase                                            295   1e-89   Malus domestica [apple tree]
gb|AHX56187.1|  lipoxygenase                                            295   1e-89   Diospyros kaki [Japanese persimmon]
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    294   1e-89   
gb|AGI16379.1|  lipoxygenase                                            294   1e-89   Malus domestica [apple tree]
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    294   2e-89   Pyrus x bretschneideri [bai li]
ref|XP_002512386.1|  lipoxygenase, putative                             294   2e-89   Ricinus communis
gb|AGI16378.1|  lipoxygenase                                            293   2e-89   Malus domestica [apple tree]
emb|CDO99039.1|  unnamed protein product                                294   3e-89   Coffea canephora [robusta coffee]
ref|XP_007034721.1|  PLAT/LH2 domain-containing lipoxygenase fami...    289   5e-89   
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5               291   8e-89   
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    292   8e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP40158.1|  hypothetical protein JCGZ_02156                         292   1e-88   Jatropha curcas
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    291   1e-88   
emb|CAN62372.1|  hypothetical protein VITISV_036476                     276   1e-88   Vitis vinifera
gb|ABF60002.1|  lipoxygenase 2                                          291   1e-88   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    291   1e-88   Glycine max [soybeans]
gb|EPS72460.1|  lipoxygenase                                            277   2e-88   Genlisea aurea
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        291   2e-88   Morus notabilis
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    291   2e-88   
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    290   3e-88   Nicotiana sylvestris
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g             291   3e-88   Phaseolus vulgaris [French bean]
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    290   3e-88   
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    290   3e-88   Cucumis sativus [cucumbers]
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             291   4e-88   Citrus clementina [clementine]
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    292   4e-88   
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    290   4e-88   Phoenix dactylifera
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                   288   8e-88   Citrus sinensis [apfelsine]
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    289   8e-88   Solanum tuberosum [potatoes]
ref|XP_006838252.1|  hypothetical protein AMTR_s00103p00053060          273   8e-88   
gb|KGN48009.1|  Lipoxygenase                                            282   1e-87   Cucumis sativus [cucumbers]
ref|XP_003626279.1|  Chalcone synthase                                  293   1e-87   
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    288   1e-87   
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   289   2e-87   Citrus sinensis [apfelsine]
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                289   2e-87   Erythranthe guttata [common monkey flower]
ref|XP_010468375.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    271   3e-87   Camelina sativa [gold-of-pleasure]
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             288   3e-87   Phaseolus vulgaris [French bean]
emb|CDY70916.1|  BnaCnng70330D                                          279   5e-87   Brassica napus [oilseed rape]
ref|XP_010277588.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    284   7e-87   
ref|XP_003591120.1|  Lipoxygenase                                       287   7e-87   Medicago truncatula
gb|ADN92993.2|  lipoxygenase LOX1                                       287   7e-87   Ipomoea nil [qian niu]
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    287   8e-87   Solanum lycopersicum
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             287   9e-87   
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    287   9e-87   
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    287   9e-87   Nicotiana tomentosiformis
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    287   1e-86   Nicotiana tomentosiformis
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    286   1e-86   Solanum tuberosum [potatoes]
ref|XP_002311617.1|  lipoxygenase family protein                        286   1e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    286   2e-86   Populus euphratica
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    286   2e-86   Populus euphratica
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    286   2e-86   Solanum tuberosum [potatoes]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    285   2e-86   Glycine soja [wild soybean]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    285   3e-86   Glycine max [soybeans]
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5               285   3e-86   Malus domestica [apple tree]
ref|XP_004150981.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    270   3e-86   
gb|AGK82783.1|  lipoxygenase                                            285   4e-86   Malus domestica [apple tree]
gb|AGK82776.1|  lipoxygenase                                            285   5e-86   Malus domestica [apple tree]
gb|AGK82775.1|  lipoxygenase                                            285   5e-86   Malus domestica [apple tree]
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    285   6e-86   Nicotiana sylvestris
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    285   7e-86   Nicotiana sylvestris
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    284   7e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004170689.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    272   8e-86   
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    283   9e-86   Solanum lycopersicum
gb|KDP23508.1|  hypothetical protein JCGZ_23341                         284   1e-85   Jatropha curcas
gb|AGH13205.1|  lipoxygenase                                            284   1e-85   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    284   1e-85   Solanum tuberosum [potatoes]
ref|XP_002516771.1|  lipoxygenase, putative                             284   1e-85   
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    284   1e-85   Nelumbo nucifera [Indian lotus]
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    283   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    284   1e-85   
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    284   1e-85   Cucumis sativus [cucumbers]
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    283   1e-85   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg                285   2e-85   Erythranthe guttata [common monkey flower]
gb|KHF98567.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              282   3e-85   Gossypium arboreum [tree cotton]
gb|AGK82774.1|  lipoxygenase                                            283   3e-85   Malus domestica [apple tree]
ref|XP_006589595.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    273   3e-85   Glycine max [soybeans]
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    283   3e-85   Cicer arietinum [garbanzo]
gb|KHF98566.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              282   4e-85   Gossypium arboreum [tree cotton]
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             282   4e-85   Eutrema salsugineum [saltwater cress]
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg             282   4e-85   Capsella rubella
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    282   5e-85   Elaeis guineensis
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        282   5e-85   Cucumis melo [Oriental melon]
ref|XP_008465603.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    268   7e-85   
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    281   7e-85   Populus euphratica
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like        281   7e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776             281   1e-84   
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    281   1e-84   Cucumis melo [Oriental melon]
gb|AHI86055.1|  lipoxygenase                                            281   1e-84   Cucumis melo var. makuwa
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like          281   1e-84   Cucumis sativus [cucumbers]
gb|AHX56188.1|  lipoxygenase                                            281   1e-84   Diospyros kaki [Japanese persimmon]
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    281   1e-84   Gossypium arboreum [tree cotton]
ref|NP_175900.1|  lipoxygenase 1                                        281   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    281   1e-84   
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    281   1e-84   
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    281   2e-84   Sesamum indicum [beniseed]
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             280   2e-84   Brassica rapa
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    281   2e-84   Sesamum indicum [beniseed]
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        280   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        280   2e-84   Tarenaya hassleriana [spider flower]
gb|KJB38138.1|  hypothetical protein B456_006G238200                    280   4e-84   Gossypium raimondii
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        280   4e-84   Camelina sativa [gold-of-pleasure]
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   5e-84   Fragaria vesca subsp. vesca
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    279   5e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    279   6e-84   
gb|KJB38137.1|  hypothetical protein B456_006G238200                    280   6e-84   Gossypium raimondii
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    278   9e-84   
gb|AEZ50136.1|  lipoxygenase                                            279   1e-83   
gb|AIC82456.1|  lipoxygenase                                            278   1e-83   Cocos nucifera
gb|KJB28315.1|  hypothetical protein B456_005G041900                    278   1e-83   Gossypium raimondii
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    278   2e-83   Vitis vinifera
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    278   2e-83   Arabis alpina [alpine rockcress]
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                    278   2e-83   Arabis alpina [alpine rockcress]
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1             278   2e-83   Camelina sativa [gold-of-pleasure]
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                    278   2e-83   Arabis alpina [alpine rockcress]
gb|ABZ05753.1|  lipoxygenase                                            272   3e-83   Prunus armeniaca
gb|KCW61799.1|  hypothetical protein EUGRSUZ_H04497                     271   3e-83   Eucalyptus grandis [rose gum]
gb|AAO03558.1|  lipoxygenase 1                                          277   3e-83   Brassica napus [oilseed rape]
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg             277   4e-83   Prunus persica
emb|CAE17327.1|  lipoxygenase                                           277   4e-83   Fragaria x ananassa
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    277   4e-83   Pyrus x bretschneideri [bai li]
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        276   5e-83   Solanum tuberosum [potatoes]
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                 276   6e-83   
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                 276   7e-83   
gb|KJB80909.1|  hypothetical protein B456_013G121100                    260   7e-83   Gossypium raimondii
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 276   8e-83   
gb|AAM28285.1|  lipoxygenase I                                          262   1e-82   Ananas comosus
gb|AAD09202.1|  lipoxygenase                                            276   1e-82   Solanum tuberosum [potatoes]
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    275   2e-82   
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    275   2e-82   Cucumis sativus [cucumbers]
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        275   2e-82   Tarenaya hassleriana [spider flower]
emb|CDY43490.1|  BnaA01g21450D                                          278   3e-82   Brassica napus [oilseed rape]
gb|AEQ30071.1|  lipoxygenase                                            275   3e-82   Litchi chinensis [litchi]
ref|XP_002883361.1|  lipoxygenase                                       274   3e-82   
emb|CAC19365.1|  lipoxygenase                                           274   5e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             274   6e-82   Phaseolus vulgaris [French bean]
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             274   7e-82   Populus trichocarpa [western balsam poplar]
gb|ABV32552.1|  lipoxygenase                                            275   7e-82   Prunus persica
dbj|BAB01777.1|  lipoxygenase                                           274   7e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188879.2|  lipoxygenase 5                                        274   7e-82   Arabidopsis thaliana [mouse-ear cress]
emb|CAP59449.1|  lipoxygenase                                           274   7e-82   Momordica charantia [balsam pear]
gb|AAA74393.1|  lipoxygenase                                            273   8e-82   Solanum lycopersicum
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    273   9e-82   Cucumis melo [Oriental melon]
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        273   9e-82   
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    273   1e-81   
gb|ACH91370.1|  lipoxygenase LOX-3                                      274   1e-81   Prunus persica
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              273   1e-81   Glycine soja [wild soybean]
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    273   1e-81   Pisum sativum [garden pea]
ref|XP_003597559.1|  Seed lipoxygenase-3                                273   2e-81   Medicago truncatula
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    273   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    273   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    273   3e-81   Eucalyptus grandis [rose gum]
gb|ABF19103.2|  9-lipoxygenase                                          272   3e-81   Capsicum annuum
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        272   3e-81   Cucumis melo [Oriental melon]
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    272   3e-81   Camelina sativa [gold-of-pleasure]
gb|ACU81176.1|  13S-lipoxygenase                                        272   3e-81   Cucumis melo var. inodorus [casaba melon]
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                        271   4e-81   Glycine soja [wild soybean]
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    272   5e-81   Fragaria vesca subsp. vesca
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             271   5e-81   
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    272   5e-81   Prunus mume [ume]
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    271   5e-81   Solanum lycopersicum
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    271   6e-81   Glycine max [soybeans]
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                   271   6e-81   
gb|ABX60408.1|  lipoxygenase L-3                                        271   7e-81   Glycine max [soybeans]
gb|ADG03095.1|  lipoxygenase 3                                          271   7e-81   Glycine max [soybeans]
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        271   8e-81   Phoenix dactylifera
emb|CAA31664.1|  unnamed protein product                                271   8e-81   Glycine max [soybeans]
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    271   8e-81   Glycine max [soybeans]
prf||1502333A  lipoxygenase 3                                           270   9e-81
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    270   1e-80   Prunus mume [ume]
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    270   1e-80   Cicer arietinum [garbanzo]
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    270   2e-80   Elaeis guineensis
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             271   2e-80   Prunus persica
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg             270   2e-80   Capsella rubella
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    270   2e-80   Solanum lycopersicum
gb|AAV50006.1|  lipoxygenase                                            251   2e-80   Malus domestica [apple tree]
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    270   2e-80   Prunus mume [ume]
ref|XP_007030815.1|  Lipoxygenase 1                                     270   2e-80   
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    270   3e-80   Pyrus x bretschneideri [bai li]
gb|AJD18612.1|  lipoxygenase                                            259   3e-80   Pyrus ussuriensis [Harbin pear]
dbj|BAH57745.1|  lipoxygenase                                           269   3e-80   
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    270   4e-80   
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    270   4e-80   
ref|XP_007030814.1|  Lipoxygenase 1                                     268   4e-80   
gb|ABB82552.1|  13S-lipoxygenase                                        269   4e-80   
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    270   4e-80   
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    268   6e-80   
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    268   8e-80   
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    268   8e-80   
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    268   8e-80   
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    269   8e-80   
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    268   8e-80   
gb|ADL41189.1|  lipoxygenase                                            268   1e-79   
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    268   2e-79   
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    267   2e-79   
ref|XP_007030813.1|  Lipoxygenase 1                                     267   2e-79   
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    267   2e-79   
gb|AAC61785.1|  lipoxygenase 1                                          267   2e-79   
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        267   2e-79   
emb|CAA63483.1|  lipoxygenase                                           267   2e-79   
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    267   2e-79   
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5               268   2e-79   
gb|AGI37654.1|  lipoxygenase                                            267   2e-79   
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                        267   2e-79   
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        267   2e-79   
gb|AAA79186.1|  lipoxygenase                                            266   3e-79   
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    266   3e-79   
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    266   4e-79   
gb|EPS66868.1|  lipoxygenase                                            251   4e-79   
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    266   4e-79   
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    267   5e-79   
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    266   5e-79   
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg             266   5e-79   
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              266   6e-79   
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g             265   7e-79   
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                266   7e-79   
gb|AAD09861.1|  lipoxygenase                                            265   9e-79   
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g             265   1e-78   
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        265   1e-78   
gb|KHN01372.1|  Linoleate 9S-lipoxygenase 1                             249   2e-78   
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        265   2e-78   
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    265   2e-78   
gb|KFK39529.1|  hypothetical protein AALP_AA3G256200                    262   2e-78   
ref|XP_010523550.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    261   3e-78   
ref|XP_010556753.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    261   3e-78   
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5               264   3e-78   
ref|XP_006850112.1|  hypothetical protein AMTR_s00022p00225940          248   3e-78   
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               264   3e-78   
gb|KHN11254.1|  Seed linoleate 9S-lipoxygenase                          263   4e-78   
ref|XP_003531597.1|  PREDICTED: seed linoleate 9S-lipoxygenase-li...    263   4e-78   
gb|KJB26430.1|  hypothetical protein B456_004G241100                    263   5e-78   
ref|XP_007030811.1|  Lipoxygenase 1                                     263   5e-78   
gb|AAP04432.1|  lipoxygenase 1 protein                                  251   5e-78   
gb|AAB20898.1|  lipoxygenase                                            258   7e-78   
gb|AFH89626.1|  lipoxygenase                                            253   8e-78   
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                               262   1e-77   
gb|ACD43483.1|  lipoxygenase 1                                          262   1e-77   
ref|XP_007135504.1|  hypothetical protein PHAVU_010G134700g             262   1e-77   
ref|XP_004139169.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    261   1e-77   
ref|XP_007150487.1|  hypothetical protein PHAVU_005G1568001g            253   2e-77   
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                        262   2e-77   
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        262   2e-77   
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    261   2e-77   
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   3e-77   
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             261   3e-77   
gb|KHN39332.1|  Seed linoleate 9S-lipoxygenase                          261   3e-77   
ref|NP_001237338.1|  lipoxygenase-10                                    261   4e-77   
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    261   4e-77   
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    261   5e-77   
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    260   5e-77   
ref|XP_003592410.1|  Lipoxygenase                                       260   5e-77   
gb|AAC49285.1|  lipoxygenase                                            253   5e-77   
gb|ADR71860.1|  lipoxygenase-1                                          249   6e-77   
ref|XP_003627173.1|  Seed lipoxygenase-3                                260   6e-77   
gb|EPS73035.1|  hypothetical protein M569_01717                         265   8e-77   
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    259   1e-76   
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    258   2e-76   
ref|XP_007150489.1|  hypothetical protein PHAVU_005G156900g             259   2e-76   
ref|XP_010470259.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    256   2e-76   
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        259   3e-76   
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    259   3e-76   
emb|CAA97845.1|  lipoxygenase                                           258   4e-76   
gb|ACL54612.1|  unknown                                                 250   5e-76   
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    258   6e-76   
gb|KHN28545.1|  Linoleate 9S-lipoxygenase-4                             242   6e-76   
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    262   6e-76   
ref|XP_006650442.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        257   7e-76   
gb|AGE45032.1|  lipoxygenase                                            243   7e-76   
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             257   8e-76   
gb|AGI16414.1|  lipoxygenase                                            257   8e-76   
gb|AGI16415.1|  lipoxygenase                                            257   8e-76   
gb|ADG03091.1|  lipoxygenase 2                                          257   9e-76   
gb|KEH18416.1|  seed linoleate 9S-lipoxygenase                          252   9e-76   
gb|ADG03092.1|  lipoxygenase 2                                          257   9e-76   
gb|EMS35711.1|  Putative lipoxygenase 3                                 253   9e-76   
gb|AAM28283.1|  lipoxygenase III                                        239   1e-75   
gb|AGE44706.1|  lipoxygenase                                            241   1e-75   
gb|AAU86910.1|  lipoxygenase                                            239   1e-75   
gb|AGE44884.1|  lipoxygenase                                            241   1e-75   
gb|AAF15296.2|AF204210_1  lipoxygenase                                  257   1e-75   
gb|AGE44684.1|  lipoxygenase                                            241   1e-75   
gb|ABF98394.1|  Lipoxygenase 3, putative, expressed                     248   1e-75   
gb|AGE44911.1|  lipoxygenase                                            242   1e-75   
gb|AGE44756.1|  lipoxygenase                                            240   1e-75   
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g             256   1e-75   
gb|AGS94394.3|  lipoxygenase                                            256   2e-75   
gb|AGE44869.1|  lipoxygenase                                            240   2e-75   
gb|AGI16413.1|  lipoxygenase                                            256   2e-75   
gb|AGE44648.1|  lipoxygenase                                            240   2e-75   
gb|AGV54475.1|  lipoxygenase                                            256   2e-75   
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g             256   2e-75   
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5               256   2e-75   
gb|AGE44646.1|  lipoxygenase                                            240   3e-75   
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    256   3e-75   
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    256   3e-75   
ref|XP_003597558.1|  Lipoxygenase                                       256   3e-75   
gb|AGE44874.1|  lipoxygenase                                            239   3e-75   
gb|AGE44908.1|  lipoxygenase                                            241   3e-75   
gb|ACF84705.1|  unknown                                                 241   3e-75   
gb|AGE44649.1|  lipoxygenase                                            239   3e-75   
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          256   3e-75   
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        255   4e-75   
gb|ABX60407.1|  lipoxygease L-2                                         255   4e-75   
emb|CAB76909.1|  lipoxygenase                                           249   4e-75   
gb|AFK32352.1|  lipoxygenase-2                                          255   5e-75   
gb|AGE44916.1|  lipoxygenase                                            240   5e-75   
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   255   5e-75   
gb|AGE44907.1|  lipoxygenase                                            240   5e-75   
ref|XP_007135512.1|  hypothetical protein PHAVU_010G135500g             255   5e-75   
gb|AGE44758.1|  lipoxygenase                                            239   6e-75   
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    255   6e-75   
dbj|BAK01348.1|  predicted protein                                      251   6e-75   
gb|AAD32243.1|AF149803_1  lipoxygenase                                  252   6e-75   
pdb|2IUK|A  Chain A, Crystal Structure Of Soybean Lipoxygenase-D        255   6e-75   
gb|AGE44972.1|  lipoxygenase                                            240   7e-75   
gb|AGE44897.1|  lipoxygenase                                            239   7e-75   
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    255   7e-75   
emb|CDY64191.1|  BnaA01g36630D                                          255   8e-75   
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        254   8e-75   
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                     254   8e-75   
gb|AGI16416.1|  lipoxygenase                                            254   8e-75   
gb|AGE44882.1|  lipoxygenase                                            239   8e-75   
gb|ABS72447.1|  lipoxygenase-1                                          254   1e-74   
emb|CDY46325.1|  BnaC01g31590D                                          254   1e-74   
gb|AGE44906.1|  lipoxygenase                                            239   1e-74   
dbj|BAD02945.1|  9-lipoxigenase                                         254   1e-74   
gb|ACE79245.1|  lipoxygenase-1                                          254   1e-74   
ref|NP_001050990.1|  Os03g0699700                                       254   1e-74   
gb|AGE44918.1|  lipoxygenase                                            239   1e-74   
gb|EAY91521.1|  hypothetical protein OsI_13155                          254   1e-74   
gb|AGE44910.1|  lipoxygenase                                            239   1e-74   
gb|ABX57825.1|  lipoxygenase-1                                          254   1e-74   
gb|AGE44940.1|  lipoxygenase                                            239   1e-74   
gb|AGE44912.1|  lipoxygenase                                            239   2e-74   
gb|AGE45046.1|  lipoxygenase                                            239   2e-74   
gb|AES95304.2|  seed linoleate 9S-lipoxygenase                          253   2e-74   
gb|AGE44843.1|  lipoxygenase                                            238   2e-74   
gb|AGE44936.1|  lipoxygenase                                            239   2e-74   
gb|AGE44857.1|  lipoxygenase                                            238   2e-74   
ref|XP_003612345.1|  Seed lipoxygenase                                  253   3e-74   
gb|AGE45041.1|  lipoxygenase                                            238   3e-74   
gb|EAZ28259.1|  hypothetical protein OsJ_12231                          254   3e-74   
gb|AGE45022.1|  lipoxygenase                                            238   3e-74   
gb|AGE44926.1|  lipoxygenase                                            238   3e-74   
gb|AGE44915.1|  lipoxygenase                                            238   3e-74   
gb|AGE44855.1|  lipoxygenase                                            237   3e-74   
gb|ACF79424.1|  unknown                                                 241   3e-74   
gb|AGE45067.1|  lipoxygenase                                            238   3e-74   
gb|AGE44934.1|  lipoxygenase                                            238   4e-74   
gb|AGE44881.1|  lipoxygenase                                            237   4e-74   
gb|AGE44783.1|  lipoxygenase                                            237   4e-74   
gb|AGE44891.1|  lipoxygenase                                            237   4e-74   
gb|AGE44953.1|  lipoxygenase                                            238   4e-74   
gb|KJB67981.1|  hypothetical protein B456_010G220400                    237   4e-74   
gb|AGE45011.1|  lipoxygenase                                            238   5e-74   
gb|ACF79478.1|  unknown                                                 238   5e-74   
gb|AET01678.2|  seed linoleate 9S-lipoxygenase                          252   5e-74   
tpg|DAA50838.1|  TPA: lipoxygenase3                                     249   5e-74   
gb|AGE44909.1|  lipoxygenase                                            238   6e-74   
gb|EMT15495.1|  Putative lipoxygenase 3                                 252   6e-74   
gb|AET01677.2|  seed linoleate 9S-lipoxygenase                          252   6e-74   
gb|AGE45065.1|  lipoxygenase                                            237   7e-74   
gb|AGE45002.1|  lipoxygenase                                            237   8e-74   
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    251   9e-74   
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    251   1e-73   
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    251   1e-73   
gb|AGE45079.1|  lipoxygenase                                            237   1e-73   
gb|AGE44864.1|  lipoxygenase                                            236   1e-73   
gb|KJB26432.1|  hypothetical protein B456_004G241300                    251   1e-73   
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                    251   1e-73   
gb|KEH18417.1|  seed linoleate 9S-lipoxygenase                          251   2e-73   
ref|NP_001105515.1|  lipoxygenase                                       250   2e-73   
ref|XP_004512262.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     251   2e-73   
gb|ACF87672.1|  unknown                                                 240   2e-73   
gb|AAG61118.1|  lipoxygenase                                            250   3e-73   
gb|AAG42354.1|  lipoxygenase                                            250   3e-73   
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    251   3e-73   
emb|CDY38326.1|  BnaC05g30190D                                          250   3e-73   
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g             250   3e-73   
ref|NP_001235189.1|  lipoxygenase                                       250   3e-73   
gb|KHN39331.1|  Seed linoleate 9S-lipoxygenase                          250   3e-73   
ref|XP_003528382.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like ...    250   4e-73   
ref|NP_001238692.1|  lipoxygenase                                       249   4e-73   
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    250   4e-73   
gb|AAT07062.1|  lipoxygenase                                            233   5e-73   
ref|NP_001050995.2|  Os03g0700700                                       248   6e-73   
gb|ACN34715.1|  unknown                                                 240   6e-73   
gb|KHN30070.1|  Linoleate 9S-lipoxygenase-4                             248   7e-73   
gb|ADR71858.1|  lipoxygenase-1                                          249   8e-73   
ref|XP_004510414.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     249   8e-73   
ref|NP_001238203.1|  lipoxygenase L-5                                   249   8e-73   
gb|AHG59315.1|  lipoxygenase                                            249   8e-73   
gb|ADR71856.1|  lipoxygenase-1                                          249   8e-73   
gb|AEL03787.1|  lipoxygenase                                            249   9e-73   
dbj|BAJ97592.1|  predicted protein                                      247   1e-72   
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                    249   1e-72   
gb|AEI71780.1|  bacterial-induced lipoxygenase                          249   1e-72   
ref|NP_001051212.1|  Os03g0738600                                       248   1e-72   
gb|EAY91797.1|  hypothetical protein OsI_13441                          248   1e-72   
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...    249   1e-72   
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    248   2e-72   



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   319 bits (817),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  ++GH DKK+EPWWPKM  RQ LI++ T IIWI+SALHAAVNFGQY
Sbjct  662  LLKDNELQAWWKELREEGHGDKKDEPWWPKMQIRQELIDSCTIIIWIASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPTLSRRFMPEPGTPEYEELKTNPDKA+L+TIT Q QTLLGISLIEILSRHA
Sbjct  722  PYAGYLPNRPTLSRRFMPEPGTPEYEELKTNPDKAYLKTITPQLQTLLGISLIEILSRHA  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            SDEIYLGQR+  EWT D+  + AFERFGKKL+ IED+I+ MN D++W+NR+GPVKVPYTL
Sbjct  782  SDEIYLGQRDSSEWTKDQESIAAFERFGKKLSEIEDQIIQMNGDEQWKNRSGPVKVPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSE GLTG+GIPNS+SI
Sbjct  842  LFPTSEQGLTGKGIPNSVSI  861



>emb|CAA64415.1| lipoxygenase (LOX) [Solanum lycopersicum]
Length=246

 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM S Q LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  53   QAWWKELREEGHGDKKDEPWWPKMQSVQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  112

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR+FMPEPG+ EYEELK NPD  FL+TIT Q QTL+GISLIE+LSRHASD +YLG
Sbjct  113  NRPTLSRKFMPEPGSAEYEELKRNPDNVFLKTITPQLQTLVGISLIELLSRHASDTLYLG  172

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMN-DDQKWRNRTGPVKVPYTLLFPTSE  156
            QR+ PEWT D+  L AFERFGKKL  IEDRI+ MN D+QKW+NR+GPVKVPYT LFPTSE
Sbjct  173  QRDSPEWTKDQEPLSAFERFGKKLGEIEDRIIQMNGDNQKWKNRSGPVKVPYTFLFPTSE  232

Query  155  GGLTGRGIPNSISI  114
             GLTG+GIPNS+SI
Sbjct  233  EGLTGKGIPNSVSI  246



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = -2

Query  710  CRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYS  531
             +    +AWW E  ++GH DKK+EPWWPKM +RQ L ++ T IIWI+SALHAAVNFGQY 
Sbjct  664  LKDNELQAWWKELREEGHGDKKDEPWWPKMQTRQELKDSCTIIIWIASALHAAVNFGQYP  723

Query  530  YAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHAS  351
            YAGY P RPTLSRRFMPEPGTPEYEELKTNPDKA+L+TIT Q QTLLGISLIEILSRHAS
Sbjct  724  YAGYLPNRPTLSRRFMPEPGTPEYEELKTNPDKAYLKTITPQLQTLLGISLIEILSRHAS  783

Query  350  DEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLL  171
            DEIYLGQR+  EWT D+  + AFERFGKKL+ IED+I+ MN D+KW+NR+GPV VPYTLL
Sbjct  784  DEIYLGQRDSSEWTKDQEPIAAFERFGKKLSEIEDQIIQMNGDKKWKNRSGPVNVPYTLL  843

Query  170  FPTSEGGLTGRGIPNSISI  114
            FPTSE GLTG+GIPNS+SI
Sbjct  844  FPTSEQGLTGKGIPNSVSI  862



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKK+EPWWPKM +R+ L+ET T IIWI+SALHAAVNFGQY YAGY P
Sbjct  681  QSWWKELREVGHGDKKDEPWWPKMQTREELVETCTIIIWIASALHAAVNFGQYPYAGYLP  740

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT SRRFMPE GTPEY+ELK++PDK FL+TITAQ QTLLG+SLIEILS H+SDE+YLG
Sbjct  741  NRPTFSRRFMPEKGTPEYDELKSDPDKVFLKTITAQLQTLLGVSLIEILSTHSSDEVYLG  800

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT D   L+AFERFG+KLA IEDRI+ MN+D+KW+NR GPVKVPYTLL+PTSEG
Sbjct  801  QRDTPEWTLDAEALEAFERFGQKLAGIEDRIIKMNNDKKWKNRVGPVKVPYTLLYPTSEG  860

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  861  GITGKGIPNSVSI  873



>ref|XP_010041703.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Eucalyptus 
grandis]
Length=224

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            + +  ++WW E V++GH DKK EPWWPKM + + L E  T  IWI+SALHAAVNFGQY Y
Sbjct  27   KDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAVNFGQYPY  86

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQFQTLL ISL+EILS H++D
Sbjct  87   AGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQFQTLLVISLMEILSMHSTD  146

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+VPY LL+
Sbjct  147  EVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVEVPYMLLY  206

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG T +GIPNS+SI
Sbjct  207  PTSEGGATAKGIPNSVSI  224



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   314 bits (805),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 168/199 (84%), Gaps = 0/199 (0%)
 Frame = -2

Query  710  CRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYS  531
             +    +AWW E  ++GH DKK+EPWWPKM +RQ LI++ T IIWI+SALHAAVNFGQY 
Sbjct  663  LKDDELQAWWKEVREEGHGDKKDEPWWPKMQTRQELIDSCTIIIWIASALHAAVNFGQYP  722

Query  530  YAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHAS  351
            YAGY P RPTLSRRFMPEPGTPEYEELKTNPD A+L+TIT Q QTLLGISLIEILSRH S
Sbjct  723  YAGYLPNRPTLSRRFMPEPGTPEYEELKTNPDLAYLKTITPQLQTLLGISLIEILSRHTS  782

Query  350  DEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLL  171
            DE+YLGQR+  EWT D+  L AFERFGKKL+ IED+I+ MN D+ W+NR+GPVKVPYTLL
Sbjct  783  DEVYLGQRDSSEWTKDQEPLAAFERFGKKLSEIEDQIVQMNGDENWKNRSGPVKVPYTLL  842

Query  170  FPTSEGGLTGRGIPNSISI  114
            FPTSE GLTG+GIPNS+SI
Sbjct  843  FPTSEEGLTGKGIPNSVSI  861



>ref|XP_008245951.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Prunus 
mume]
Length=504

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ L+ET T IIW +SALHAAVNFGQY YAGY P
Sbjct  312  QSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLP  371

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ Q +LGI+LIEILSRH++DE+YLG
Sbjct  372  NRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEILSRHSTDEVYLG  431

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L AF++FGKKLA IEDRI +MN+D+K +NR GPVKVPYTLLFPTSEG
Sbjct  432  QRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVKVPYTLLFPTSEG  491

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  492  GLTGRGIPNSVSI  504



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKKNEPWWPKM +R+ LI++ T IIWI+SALHAAVNFGQY YAGY P
Sbjct  690  QSWWKELREEGHGDKKNEPWWPKMQTREELIDSCTIIIWIASALHAAVNFGQYPYAGYLP  749

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEYEEL+++PDKAFL+TITAQ QTL+GIS+IE+LSRHASDE+YLG
Sbjct  750  NRPTVSRRFMPEKGTPEYEELQSDPDKAFLKTITAQLQTLIGISIIELLSRHASDEVYLG  809

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D + L+AFERFGKKL  IED+I++MN+D++ +NR GPVK+PYTLLFPTSEG
Sbjct  810  QRDTPEWTTDTNPLEAFERFGKKLGEIEDKIISMNNDERLKNRVGPVKMPYTLLFPTSEG  869

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  870  GLTGKGIPNSVSI  882



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM + Q LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  670  QAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR+FMPEPG+P YEELKTNPDK FLETIT Q QTLLGISLIEILSRH+SD +YLG
Sbjct  730  NRPTLSRKFMPEPGSPAYEELKTNPDKVFLETITPQLQTLLGISLIEILSRHSSDTLYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWT D+  L AF RFGKKL+ IED+I+ MN D+KW+NR+GPVKVPYTLLFPTSEG
Sbjct  790  QRESPEWTKDQEPLSAFGRFGKKLSDIEDQIMQMNGDEKWKNRSGPVKVPYTLLFPTSEG  849

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  850  GLTGKGIPNSVSI  862



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM + Q LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  670  QAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR FMPEPG+PEYEELKTNPDK FL+TIT Q QTLLGISLIEILSRH+SD +YLG
Sbjct  730  NRPTLSRNFMPEPGSPEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHSSDTLYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWT D+  L AF RFGKKL+ IED+I+ MN D+KW+NR+GPVKVPYTLLFPTSEG
Sbjct  790  QRESPEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDEKWKNRSGPVKVPYTLLFPTSEG  849

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  850  GLTGKGIPNSVSI  862



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM + Q LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  670  QAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR FMPEPG+PEYEELKTNPDK FL+TIT Q QTLLGISLIEILSRH+SD +YLG
Sbjct  730  NRPTLSRNFMPEPGSPEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHSSDTLYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWT D+  L AF RFGKKL+ IED+I+ MN D+KW+NR+GPVKVPYTLLFPTSEG
Sbjct  790  QRESPEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDEKWKNRSGPVKVPYTLLFPTSEG  849

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  850  GLTGKGIPNSVSI  862



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM + Q LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  670  QAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR FMPEPG+ EYEELKTNPDK FL+TIT Q QTLLGISLIEILSRH+SD +YLG
Sbjct  730  NRPTLSRNFMPEPGSTEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHSSDTLYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWT D+  L AFERFGKKL+ IED+I+ MN D+KW+NR+GPVKVPYTLLFPTSEG
Sbjct  790  QRESPEWTKDQEPLSAFERFGKKLSDIEDQIMEMNGDEKWKNRSGPVKVPYTLLFPTSEG  849

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  850  GLTGKGIPNSVSI  862



>gb|AAO12866.1| lipoxygenase [Vitis vinifera]
Length=289

 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WW E  ++GH DKK+EPWWPKM + + LI+T T IIW++SALHAAV+FGQY YAGY P R
Sbjct  99   WWKEVREEGHGDKKDEPWWPKMRTVKELIQTCTIIIWVASALHAAVDFGQYPYAGYLPNR  158

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+LSRH+SDE++LGQR
Sbjct  159  PTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVHLGQR  218

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEGGL  147
            + PEWT D   L AFE+FG+KLA IE+ I+  N +++++NR GPVK+PYTLL+PTSEGGL
Sbjct  219  DTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGL  278

Query  146  TGRGIPNSISI  114
            TG+GIPNS+SI
Sbjct  279  TGKGIPNSVSI  289



>emb|CAA64769.1| lipoxygenase [Solanum tuberosum]
Length=697

 Score =   304 bits (779),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  498  ILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQY  557

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  558  PYAGYVPNRPTVSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHT  617

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  618  TDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  677

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  678  LFPTSEGGLTGKGIPNSVSI  697



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V+KGH DKKNEPWWPKM +   LIE+ T IIW SSALHAAVNFGQY +AGY P
Sbjct  668  QSWWKELVEKGHGDKKNEPWWPKMQTLDELIESCTIIIWTSSALHAAVNFGQYPFAGYLP  727

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEYEELKTNPD AFL+TITAQ QT++G+SLIEILSRHASDE+YLG
Sbjct  728  NRPTVSRRFMPEIGTPEYEELKTNPDLAFLKTITAQLQTVIGVSLIEILSRHASDEVYLG  787

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P WTSD  VL+AFERFGK+LA IED I+ MN+D K +NR GPVK+PYTLL+PT E 
Sbjct  788  QRDTPGWTSDTKVLEAFERFGKRLAEIEDSIICMNNDGKLKNRVGPVKMPYTLLYPTGEA  847

Query  152  GLTGRGIPNSISI  114
            GL+G+GIPNSISI
Sbjct  848  GLSGKGIPNSISI  860



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    + WW E  + GH DKK+ PWWP+M S + LIE+ T IIWI+SALHAAVNFGQY
Sbjct  660  ILKDNELQEWWKELREVGHGDKKDAPWWPEMESPEDLIESCTIIIWIASALHAAVNFGQY  719

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELKTNPDKAFL+TITAQFQTLLG+SLIEILSRH 
Sbjct  720  PYAGYLPNRPTVSRRFMPEPGTPEYEELKTNPDKAFLKTITAQFQTLLGVSLIEILSRHT  779

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            SDEIYLGQRE PEWT DK  L AF+RFGKKL  IE+ I+  N DQ  +NR+GPV  PYTL
Sbjct  780  SDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTEIENHIIQRNGDQILKNRSGPVNAPYTL  839

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  840  LFPTSEGGLTGKGIPNSVSI  859



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   307 bits (786),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            +    +AWW E  ++GH D K++PWWPKM +R+ LIE+ TTIIW++SALHA+VNFGQY Y
Sbjct  659  KDSELQAWWKELREEGHGDLKDKPWWPKMQTREELIESCTTIIWVASALHASVNFGQYPY  718

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPT+SRRFMPEPG+PEYEELKTNPDKAFL+TITAQ QTLLG+SLIEILSRHASD
Sbjct  719  AGYLPNRPTVSRRFMPEPGSPEYEELKTNPDKAFLKTITAQLQTLLGVSLIEILSRHASD  778

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+ PEWT D + L+AF++FG KLA IE RI+  N D K+RNRTGPVK+PYTLLF
Sbjct  779  EVYLGQRDTPEWTIDGNALEAFKKFGSKLAEIEGRIIQSNTDPKYRNRTGPVKLPYTLLF  838

Query  167  PTSEGGLTGRGIPNSISI  114
            PT + GLTG+GIPNS+SI
Sbjct  839  PTGDPGLTGKGIPNSVSI  856



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM +R+ LI++ T +IW++SALHAAVNFGQY YAGY P
Sbjct  669  QSWWKELREEGHGDKKHEPWWPKMQTRRELIDSCTIVIWVASALHAAVNFGQYPYAGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPEPGTPEYEE K++PDKAFL+TITAQ QTLLG+SLIEILSRH+SDE+YLG
Sbjct  729  NRPTLSRRFMPEPGTPEYEEFKSSPDKAFLKTITAQLQTLLGVSLIEILSRHSSDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  +WT+D   L+AF RFGKKL  IE+ I+ MN+D+  RNR GPVKVPYTLLFPTSEG
Sbjct  789  QRDSADWTTDDEPLEAFGRFGKKLGEIEEMIIEMNNDENLRNRVGPVKVPYTLLFPTSEG  848

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  849  GLTGKGIPNSVSI  861



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  ++GH D K+EPWWPKM + Q LI++ T IIW SSALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTSSALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            SDEIYLGQR+ P+WT+D+  L AFERFG KL+ IE+RI+ MN DQ WRNR+GP+K PYTL
Sbjct  782  SDEIYLGQRDSPKWTNDEVPLAAFERFGNKLSDIENRIIEMNGDQIWRNRSGPIKAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  842  LFPTSEGGLTGKGIPNSVSI  861



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE  +KGH DKKNEPWWPKM +R  L+++ TTIIW++SALHAAVNFGQY YAGY P
Sbjct  672  QSWWTEVREKGHGDKKNEPWWPKMQTRGELVDSCTTIIWMASALHAAVNFGQYPYAGYLP  731

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPEPG PEY+ELKTNPDK FL+TITA+ QTLLGISLIEILS H+SDE+YLG
Sbjct  732  VRPTLSRRFMPEPGKPEYDELKTNPDKVFLKTITARLQTLLGISLIEILSSHSSDEVYLG  791

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT D   L+AF+RFG KL  +E+RI  MN+D+KWRNR GPV VPYTLL+PTSE 
Sbjct  792  QRDALEWTKDVEPLEAFDRFGTKLREVEERIKQMNNDKKWRNRVGPVNVPYTLLYPTSEE  851

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  852  GLTGKGIPNSVSI  864



>ref|XP_006355846.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
8-like [Solanum tuberosum]
Length=737

 Score =   303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  538  ILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQY  597

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  598  PYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILSRHT  657

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  658  TDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  717

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  718  LFPTSEGGLTGKGIPNSVSI  737



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =   308 bits (789),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM + + L+E  TTIIW +SALHAAVNFGQY YAGY P
Sbjct  760  QSWWKELVEEGHGDKKDEPWWPKMQTLEELVEICTTIIWTASALHAAVNFGQYPYAGYLP  819

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL++NPDK FL+TITAQ QTLLGISLIEILSRH++DE+YLG
Sbjct  820  NRPTISRKFMPEKGTPEYEELESNPDKVFLKTITAQLQTLLGISLIEILSRHSTDEVYLG  879

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT D   L+AF++FGKKLA IEDRI +MN+D K +NR GPVKVPYTLLFPTS G
Sbjct  880  QRDTPEWTVDAAQLEAFDKFGKKLAEIEDRITSMNNDAKLKNRVGPVKVPYTLLFPTSGG  939

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  940  GLTGKGIPNSVSI  952



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   306 bits (783),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKKNEPWWPKM +R+ LI+T T IIW++SALHAAVNFGQY YAGY P
Sbjct  674  QAWWKELREEGHGDKKNEPWWPKMQTREELIDTCTIIIWVASALHAAVNFGQYPYAGYLP  733

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEY EL++NPDKA+L+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  734  NRPTISRRFMPEKGTPEYAELESNPDKAYLKTITAQLQTLLGISLIEILSRHSSDEVYLG  793

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWTSD   L AFE FGK+L+ IE+RI+ MN D++ +NR GPV +PYTLL+PTSEG
Sbjct  794  QRDTPEWTSDATPLAAFEEFGKRLSGIEERIVEMNKDEQLKNRVGPVNMPYTLLYPTSEG  853

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  854  GLTGKGIPNSVSI  866



>ref|XP_009365899.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=424

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T +IW +SALHAA+NFGQ+SYAGY P
Sbjct  232  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLP  291

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  292  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  351

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D K +NR G VK+PYTLLFPTSEG
Sbjct  352  QRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDDKLKNRVGSVKIPYTLLFPTSEG  411

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  412  GITGKGIPNSVSI  424



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH D K+ PWWPKM +R+ LI++ T IIW++SALHAAVNFGQY YAGY P
Sbjct  674  QSWWKEVREEGHGDLKDAPWWPKMLTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLP  733

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE G+PEYEELK+NPDKAFL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  734  NRPTVSRRFMPEEGSPEYEELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  793

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT+DK  L+AFE+FGKKLA IED++L MN   KW+NR GPV+VPYTLL PTSEG
Sbjct  794  QRDTHEWTADKKPLEAFEKFGKKLAEIEDKMLDMNKAGKWKNRVGPVEVPYTLLVPTSEG  853

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+S+
Sbjct  854  GLTGRGIPNSVSL  866



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM SR+ LI++ T IIWI+SALHAAVNFGQY YAGY P
Sbjct  671  QAWWKELREEGHGDKKDEPWWPKMHSREELIDSCTIIIWIASALHAAVNFGQYPYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY+ELKTNPD+ FL TITAQ QTLLG+SLIEILSRHASDE+YLG
Sbjct  731  NRPTISRRFMPEPGTPEYDELKTNPDRVFLRTITAQLQTLLGVSLIEILSRHASDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT D   L AFE+FGK LA IE RI+ MN+D +W+NR GP + PYTLL+PTSE 
Sbjct  791  QRDTPEWTKDSEPLKAFEKFGKNLAEIEARIVQMNNDSEWKNRLGPAQFPYTLLYPTSEP  850

Query  152  GLTGRGIPNSISI  114
            GLT +GIPNS+SI
Sbjct  851  GLTAKGIPNSVSI  863



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM S Q LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  669  QAWWKELREEGHGDKKDEPWWPKMQSVQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR+FMPEPG+ EYEELK NPD  FL+TIT Q QTL+GISLIE+LSRHASD +YLG
Sbjct  729  NRPTLSRKFMPEPGSAEYEELKRNPDNVFLKTITPQLQTLVGISLIELLSRHASDTLYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMN-DDQKWRNRTGPVKVPYTLLFPTSE  156
            QR+ PEWT D+  L AFERFGKKL  IEDRI+ MN D+QKW+NR+GPVKVPYTLLFPTSE
Sbjct  789  QRDSPEWTKDQEPLSAFERFGKKLGEIEDRIIQMNGDNQKWKNRSGPVKVPYTLLFPTSE  848

Query  155  GGLTGRGIPNSISI  114
             GLTG+GIPNS+SI
Sbjct  849  EGLTGKGIPNSVSI  862



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  782  TDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  842  LFPTSEGGLTGKGIPNSVSI  861



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  782  TDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  842  LFPTSEGGLTGKGIPNSVSI  861



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  ++GH D K+EPWWPKM + Q LI++ T IIW +SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            SDEIYLGQR+ P+WT D+  L AF+RFG KL+ IE+RI+ MN DQ WRNR+GPVK PYTL
Sbjct  782  SDEIYLGQRDSPKWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQIWRNRSGPVKAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+G+PNS+SI
Sbjct  842  LFPTSEGGLTGKGVPNSVSI  861



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  ++GH D K+EPWWPKM + Q LI++ T IIW +SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            SDEIYLGQR+ P+WT D+  L AF+RFG KL+ IE+RI+ MN DQ WRNR+GPVK PYTL
Sbjct  782  SDEIYLGQRDSPKWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQIWRNRSGPVKAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+G+PNS+SI
Sbjct  842  LFPTSEGGLTGKGVPNSVSI  861



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +RQ LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  669  QAWWKELREEGHGDKKDEPWWPKMQTRQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR FMPEPG+ EYEELKTNPDK FL+TIT Q QTLLGISLIEILSRHASD +YLG
Sbjct  729  NRPTLSRNFMPEPGSAEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHASDTLYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPVKVPYTLLFPTSE  156
            QR+ PEWT D+  L AFERFG+KL+ IE +IL MN D +KW+NR+GPVKVPYTLLFPTSE
Sbjct  789  QRDSPEWTKDQEPLSAFERFGQKLSDIEAQILQMNGDHEKWKNRSGPVKVPYTLLFPTSE  848

Query  155  GGLTGRGIPNSISI  114
             GLTG+GIPNS+SI
Sbjct  849  EGLTGKGIPNSVSI  862



>gb|AEZ50135.1| lipoxygenase, partial [Diospyros kaki]
Length=500

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKK+EPWWPKM +R+ LI++ TTIIW++SALHAAVNFGQY YAGY P
Sbjct  308  QSWWNELREVGHGDKKDEPWWPKMQTRKELIDSCTTIIWVASALHAAVNFGQYPYAGYLP  367

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRF+PE G+PEYEELK+ P+KAFL+TITAQ QT+LGISLIE+LS H++DE+YLG
Sbjct  368  NRPTISRRFIPELGSPEYEELKSYPEKAFLKTITAQLQTVLGISLIEVLSAHSTDEVYLG  427

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT+D   L+AF+RFGKKL  IE+ I+ MN+D+K +NR GPVKVPYTLLFPTSEG
Sbjct  428  QRDTAEWTTDIEPLEAFQRFGKKLGEIEENIIDMNNDEKLKNRVGPVKVPYTLLFPTSEG  487

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  488  GVTGKGIPNSVSI  500



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   305 bits (782),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ L+ET T IIW +SALHAAVNFGQY YAGY P
Sbjct  755  QSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLP  814

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ Q +LGI+LIEILSRH++DE+YLG
Sbjct  815  NRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEILSRHSTDEVYLG  874

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L AF++FGKKLA IEDRI +MN+D+K +NR GPVKVPYTLLFPTSEG
Sbjct  875  QRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVKVPYTLLFPTSEG  934

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  935  GLTGRGIPNSVSI  947



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  658  ILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQY  717

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILSRH 
Sbjct  718  PYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHT  777

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  778  TDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  837

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  838  LFPTSEGGLTGKGIPNSVSI  857



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LIET T IIW++SALHAAVNFGQY YAGY P
Sbjct  708  QSWWKEVREEGHGDKKDEPWWPKMHTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLP  767

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  768  NRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  827

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT D   L AFE+FG+KLA IE+RI+  N +++++NR GPVK+PYTLL+PTSEG
Sbjct  828  QRDTPEWTLDTTPLKAFEKFGRKLADIEERIIDRNGNERFKNRVGPVKIPYTLLYPTSEG  887

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  888  GLTGKGIPNSVSI  900



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   303 bits (776),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTP+YEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  782  TDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  842  LFPTSEGGLTGKGIPNSVSI  861



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   303 bits (776),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTP+YEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  782  TDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  842  LFPTSEGGLTGKGIPNSVSI  861



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   303 bits (775),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH D K+ PWWPKM +R+ LI++ T IIW++SALHAAVNFGQY YAGY P
Sbjct  655  QSWWKEVREEGHGDLKDAPWWPKMLTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLP  714

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE G+P+Y+ELK+NPDKAFL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  715  NRPTVSRRFMPEEGSPDYKELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  774

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT+DK  L+AFE+FGKKLA IED++L MN   KW+NR GPV+VPYTLL PTSEG
Sbjct  775  QRDTHEWTADKKPLEAFEKFGKKLAEIEDKMLYMNKAGKWKNRVGPVEVPYTLLVPTSEG  834

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  835  GLTGRGIPNSVSI  847



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   303 bits (776),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  661  ILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQY  720

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILSRH 
Sbjct  721  PYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHT  780

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  781  TDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILINRSGPVNAPYTL  840

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  841  LFPTSEGGLTGKGIPNSVSI  860



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   303 bits (776),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  ++GH D K+EPWWPKM + Q LI++ T IIW +SALHAAVNFGQY
Sbjct  662  IVKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTSEYEVLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            SDEIYLGQR+ P+WT+D+  L AFERFG KL+ IE+RI+ MN DQ WRNR GP+K PYTL
Sbjct  782  SDEIYLGQRDSPKWTNDEEPLAAFERFGNKLSDIENRIIEMNGDQIWRNRLGPIKAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTS+GGLT +GIPNS+SI
Sbjct  842  LFPTSQGGLTAKGIPNSVSI  861



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   303 bits (776),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ L+ET T IIW +SALHAAVNFGQY YAGY P
Sbjct  670  QSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEILSRH++DE+YLG
Sbjct  730  NRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L AF++FG+KLA IEDRI  MN+D+K +NR GPVK+PYTLLFPTSEG
Sbjct  790  QRDTPEWTADTEPLKAFDKFGRKLAEIEDRITRMNNDEKLKNRVGPVKMPYTLLFPTSEG  849

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  850  GLTGRGIPNSVSI  862



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   303 bits (776),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  665  ILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQY  724

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  725  PYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILSRHT  784

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  785  TDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  844

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  845  LFPTSEGGLTGKGIPNSVSI  864



>emb|CDP20620.1| unnamed protein product [Coffea canephora]
Length=772

 Score =   301 bits (770),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWP+M +   LI++ T IIW+SSALHAA NFGQ+ YAGY P
Sbjct  580  QSWWKEVREKGHADKKDEPWWPRMKTITELIDSCTIIIWLSSALHAATNFGQWPYAGYQP  639

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT SRRFMPEPGTPEYEELK+NPDKAFL+TIT QFQTLLG+S IEILSRH +DE+YLG
Sbjct  640  NRPTTSRRFMPEPGTPEYEELKSNPDKAFLKTITPQFQTLLGLSTIEILSRHTTDEVYLG  699

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE+P+WT D   L+AF+RFG+ L+ IED+IL MN D KWRNR GPV +PYTLLFPTS+ 
Sbjct  700  QRENPQWTKDTEPLEAFKRFGQTLSEIEDQILQMNGDPKWRNRVGPVNIPYTLLFPTSDS  759

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNSI+I
Sbjct  760  GITGRGIPNSIAI  772



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   303 bits (775),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M   Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREVGHGDKKNEPWWPEMERPQELIDSCTTIIWIASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILSRH 
Sbjct  722  PYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  782  TDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  842  LFPTSEGGLTGKGIPNSVSI  861



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   303 bits (775),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH D K+ PWWPKM +R+ LI++ T IIW++SALHAAVNFGQY YAGY P
Sbjct  679  QSWWKEVREEGHGDLKDAPWWPKMKTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLP  738

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE G+P+YEELK+NP+KAFL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  739  NRPTISRRFMPEEGSPDYEELKSNPEKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  798

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+DK  L+AFE+FGKKLA IEDR+  MN D   +NR G VKVPYTLL PTSEG
Sbjct  799  QRDTPEWTADKEPLEAFEKFGKKLAVIEDRMFDMNKDVNLKNRVGSVKVPYTLLVPTSEG  858

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  859  GLTGRGIPNSVSI  871



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   303 bits (775),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKKNEPWWPKM + + LIET T IIW++SALHAAVNFGQY YAGY P
Sbjct  667  QSWWKEVREEGHGDKKNEPWWPKMRTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+LSRH+SDE+YLG
Sbjct  727  NRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT D   L AFE+FG+KLA IE+ I+  N +++++NR GPVK+PYTLL+PTSEG
Sbjct  787  QRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVKIPYTLLYPTSEG  846

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  847  GLTGKGIPNSVSI  859



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LIET T IIW++SALHAAVNFGQY YAGY P
Sbjct  683  QSWWKEVREEGHGDKKDEPWWPKMHTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLP  742

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  743  NRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  802

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT D   L AFE+FG+KLA IE+RI+  N +++++NR GPVK+PYTLL+PTSEG
Sbjct  803  QRDTPEWTLDTTPLKAFEKFGRKLADIEERIIDRNGNERFKNRVGPVKIPYTLLYPTSEG  862

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  863  GITGKGIPNSVSI  875



>gb|ABF60001.1| lipoxygenase 5 [Actinidia deliciosa]
Length=450

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LI+T T +IW++SALHAA+NFGQY YAGY P
Sbjct  258  QSWWKELREEGHGDKKDEPWWPKMQTVKELIDTCTIVIWVASALHAALNFGQYPYAGYLP  317

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPE GT EYEELK++P+KA L+TIT Q QTLLGISLIEILSRH+SDE+YLG
Sbjct  318  NRPTLSRRFMPEEGTSEYEELKSDPEKALLKTITPQLQTLLGISLIEILSRHSSDEVYLG  377

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L AF RFG KL  +E++I+ MN+D++ +NR GPV VPYTLLFPTSEG
Sbjct  378  QRDTPEWTTDAEPLKAFARFGNKLDEVEEKIIDMNNDKELKNRVGPVNVPYTLLFPTSEG  437

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  438  GLTGKGIPNSVSI  450



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ LIE  T IIW SSALHAAVNFGQY YAGY P
Sbjct  671  QSWWKELVEEGHGDKKDEPWWPKMQTREELIEACTIIIWTSSALHAAVNFGQYPYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
            CRPT+SRRFMPE GTPEY+EL++NPDKAFL+TITAQFQT+LGI+LIEILSRH++DE+YLG
Sbjct  731  CRPTVSRRFMPEKGTPEYDELESNPDKAFLKTITAQFQTVLGIALIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P WT+D   L AF RFGKKLA IE++I  MN+D+  +NR G V+VPYTLL+PT E 
Sbjct  791  QRDTPNWTADAEALQAFNRFGKKLAEIEEKITNMNNDENLKNRVGKVEVPYTLLYPTGES  850

Query  152  GLTGRGIPNSISI  114
            G+ G+GIPNS+SI
Sbjct  851  GIAGKGIPNSVSI  863



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 166/196 (85%), Gaps = 0/196 (0%)
 Frame = -2

Query  701  KSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAG  522
            +  ++WW E  +KGH DKKNE WWPKM + + LI++ T IIW++SALHAAVNFGQY YAG
Sbjct  672  RELQSWWKELREKGHADKKNESWWPKMQTLKELIDSCTIIIWVASALHAAVNFGQYHYAG  731

Query  521  YNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEI  342
            Y P RPT+SRRFMPEPGT EY+EL+TNPDK FL TITA+ QTL+GI+LIEILSRH+SDEI
Sbjct  732  YMPNRPTISRRFMPEPGTKEYDELRTNPDKVFLRTITARLQTLVGIALIEILSRHSSDEI  791

Query  341  YLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPT  162
            YLGQR+ PEWT+D  VL+AF++FGKKL  IE+ I+ MN+D KW+NR G VKVPYTLL+PT
Sbjct  792  YLGQRDTPEWTADAQVLEAFDKFGKKLGEIEEGIVKMNNDGKWKNRVGAVKVPYTLLYPT  851

Query  161  SEGGLTGRGIPNSISI  114
            SE GLTG+GIPNS+SI
Sbjct  852  SEDGLTGKGIPNSVSI  867



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH D K+ PWWPKM +R+ LI++ T IIW++SALHAAVNFGQY YAGY P
Sbjct  644  QSWWKEAREEGHGDLKDAPWWPKMKTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLP  703

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRF+PE G+P+YEELK+NP+KAFL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  704  NRPTISRRFLPEEGSPDYEELKSNPEKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  763

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+DK  L+AFE+FGKKLA IEDR+  MN D   +NR G VKVPYTLL PTSEG
Sbjct  764  QRDTPEWTADKEPLEAFEKFGKKLAVIEDRMFDMNKDVNLKNRVGSVKVPYTLLVPTSEG  823

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  824  GLTGRGIPNSVSI  836



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  645  ILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQY  704

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P R T+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  705  PYAGYLPNRATVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILSRHT  764

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  765  TDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  824

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  825  LFPTSEGGLTGKGIPNSVSI  844



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ LI++ T IIW++SALHAAVNFGQY YAGY P
Sbjct  673  QAWWKELREEGHGDKKDEPWWPKMQTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLP  732

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEY EL++NPDK FL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  733  NRPTISRRFMPEKGTPEYTELESNPDKVFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  792

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV +PYTLL+PTSEG
Sbjct  793  QRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVNMPYTLLYPTSEG  852

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  853  GLTGKGIPNSVSI  865



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   301 bits (772),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWWP+M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  662  ILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQY  721

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P R T+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILSRH 
Sbjct  722  PYAGYLPNRATVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILSRHT  781

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  PYTL
Sbjct  782  TDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTL  841

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  842  LFPTSEGGLTGKGIPNSVSI  861



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ L+ET T IIW +SALHAAVNFGQ+ YAGY P
Sbjct  670  QSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQFPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEILSRH++DE+YLG
Sbjct  730  NRPTLSRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L AF++FG+KLA IEDRI +MN+D+K +NR GPVK+PYTLLFPTS G
Sbjct  790  QRDTPEWTADTEPLKAFDKFGRKLAKIEDRITSMNNDEKLKNRVGPVKMPYTLLFPTSGG  849

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  850  GLTGRGIPNSVSI  862



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   301 bits (771),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH D K+  WWPKM +R+ LI++ T IIW++SALHAAVNFGQY YAGY P
Sbjct  674  QSWWKEVREEGHGDLKDATWWPKMQTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLP  733

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE G+PEYEELK+NPDK FL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  734  NRPTVSRRFMPEEGSPEYEELKSNPDKVFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  793

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT+DK  L+AFERFGKKLA IED++  MN   KW+NR GPV+VPYTLL PTSEG
Sbjct  794  QRDTHEWTADKKPLEAFERFGKKLAEIEDKMFDMNKAGKWKNRVGPVEVPYTLLVPTSEG  853

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  854  GLTGRGIPNSVSI  866



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   301 bits (770),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ L+ET T IIW +SALHAAVNFGQY YAGY P
Sbjct  670  QSWWKELVEEGHGDKKDEPWWPKMQTRKDLVETCTIIIWTASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEILSRH++DE+YLG
Sbjct  730  NRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L AF +FG KLA IEDRI  MN+D+K +NR GPVK+PYTLLFPTSEG
Sbjct  790  QRDTPEWTADTEPLKAFAKFGSKLAEIEDRITRMNNDEKLKNRVGPVKMPYTLLFPTSEG  849

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  850  GLTGRGIPNSVSI  862



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   301 bits (770),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM + Q LI++ T  IWI+SALHAAVNFGQY YAGY P
Sbjct  669  QAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR+FMPEPG+ EYEELKTNPD  FL+TIT Q QTL+GISLIE+LSRH+SD +YLG
Sbjct  729  NRPTLSRKFMPEPGSAEYEELKTNPDNVFLKTITPQLQTLVGISLIELLSRHSSDTLYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPVKVPYTLLFPTSE  156
            Q + PEWT D+  L AFERFGKKL+ IEDRI+ MN D +KW+NR+GPVKVPYTLLFPTSE
Sbjct  789  QNDSPEWTKDQEPLSAFERFGKKLSDIEDRIMQMNGDPEKWKNRSGPVKVPYTLLFPTSE  848

Query  155  GGLTGRGIPNSISI  114
             GLTG+GIPNS+SI
Sbjct  849  EGLTGKGIPNSVSI  862



>gb|KCW61801.1| hypothetical protein EUGRSUZ_H044981, partial [Eucalyptus grandis]
Length=795

 Score =   299 bits (766),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            + +  ++WW E V++GH DKK EPWWPKM + + L ET T  IWI+SALHAAVNFGQY Y
Sbjct  598  KDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAVNFGQYPY  657

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQ QTLLGISLIEILS H++D
Sbjct  658  AGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEILSSHSTD  717

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++W NR GPV+VPY LL+
Sbjct  718  EVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWMNRVGPVEVPYMLLY  777

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG+T +GIPNS+SI
Sbjct  778  PTSEGGVTAKGIPNSVSI  795



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWP+M +   LI++ T IIW+SSALHA+ NFGQ+ YAGY P
Sbjct  665  QSWWKEVREKGHADKKDEPWWPRMKTLTELIDSCTIIIWVSSALHASTNFGQWPYAGYAP  724

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEYEELK+NPDKAFL+TIT QFQTLLG+S IEILSRH +DE+YLG
Sbjct  725  NRPTISRRFMPEPGTPEYEELKSNPDKAFLKTITPQFQTLLGLSTIEILSRHTTDEVYLG  784

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE+P+WT D   L+AF+RFG+ L+ IED+IL MN D KWRNR GP  +PYTLLFPTS+ 
Sbjct  785  QRENPQWTKDTEPLEAFKRFGQTLSEIEDQILQMNGDPKWRNRVGPANIPYTLLFPTSDS  844

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNSI+I
Sbjct  845  GITGRGIPNSIAI  857



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   300 bits (769),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ L+ET T IIW +SALHAAVNFGQY YAGY P
Sbjct  670  QSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEILSRH++DE+YLG
Sbjct  730  NRPTLSRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L  F++FG+KLA IEDRI +MN+D+K +NR GPVK+PYTLLFPTS G
Sbjct  790  QRDTPEWTADTEPLKVFDKFGRKLAEIEDRIESMNNDEKLKNRVGPVKMPYTLLFPTSGG  849

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  850  GLTGRGIPNSVSI  862



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   300 bits (768),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LIET T IIW++SALHAAVNFGQY YAGY P
Sbjct  667  QSWWKEVREEGHGDKKDEPWWPKMRTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRF+PE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+LSRH+SDE+YLG
Sbjct  727  NRPTISRRFIPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT D   L AFE+FG+KLA IE+ I+  N D++++NR GP+K+PYTLL+PTSEG
Sbjct  787  QRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIERNGDERFKNRVGPLKIPYTLLYPTSEG  846

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  847  GLTGKGIPNSVSI  859



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPK+ + + L+E  TTIIW +SALHAAVNFGQY YAGY P
Sbjct  670  QSWWKELVEEGHGDKKDEPWWPKLQTLEELVEICTTIIWTASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP  GT EYEELK+NPDK FL+TITAQ QTLLGISLIEILSRH++DE+YLG
Sbjct  730  NRPTISRKFMPVKGTAEYEELKSNPDKVFLKTITAQLQTLLGISLIEILSRHSTDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L+AF++FGKKL  IE+RI +MN+D+K +NR GPVKVPYTLLFPTS G
Sbjct  790  QRDTPEWTADAAPLEAFDKFGKKLEEIEERITSMNNDEKLKNRVGPVKVPYTLLFPTSGG  849

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  850  GLTGKGIPNSVSI  862



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 160/200 (80%), Gaps = 0/200 (0%)
 Frame = -2

Query  713  FCRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQY  534
              +    +AWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  661  ILKDNELQAWWKEVREVGHGDKKNEPWWAEMETPQELIDSCTTIIWIASALHAAVNFGQY  720

Query  533  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  354
             YAGY P RPT+SR+FMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILSRH 
Sbjct  721  PYAGYLPNRPTVSRKFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHT  780

Query  353  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  174
            +DEIYLGQRE PEWT DK  L AFERFG KL  IE +I+  N +    NRTGPV  PYTL
Sbjct  781  TDEIYLGQRESPEWTKDKEPLAAFERFGNKLTDIEKQIMQRNGNNILTNRTGPVNAPYTL  840

Query  173  LFPTSEGGLTGRGIPNSISI  114
            LFPTSEGGLTG+GIPNS+SI
Sbjct  841  LFPTSEGGLTGKGIPNSVSI  860



>ref|XP_009365971.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=506

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T +IW +SALHAA+NFGQ+SYAGY P
Sbjct  314  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLP  373

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FM E GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  374  NRPTISRKFMLEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  433

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D K +NR G VK+PYTLLFPTSEG
Sbjct  434  QRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDDKLKNRVGSVKIPYTLLFPTSEG  493

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  494  GITGKGIPNSVSI  506



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 168/193 (87%), Gaps = 1/193 (1%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPKM +R+ L+ET T IIW +SALHAAVNFGQY YAGY P
Sbjct  665  QSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLP  724

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEILSRH++DE+YLG
Sbjct  725  NRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLG  784

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L AF++FGKKLA IEDRI +MN+D+K +NR GPVKVPYTLLFPTSE 
Sbjct  785  QRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVKVPYTLLFPTSE-  843

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  844  GLTGRGIPNSVSI  856



>gb|KJB80991.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=693

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++ H DKK+EPWWPKM +R+ LI + T IIW++SALHAAVNFGQY YAGY P
Sbjct  501  QAWWKELREEAHGDKKDEPWWPKMQTREELINSCTIIIWVASALHAAVNFGQYPYAGYLP  560

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY EL++NPDK FL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  561  NRPTISRRFMPEKGTSEYTELESNPDKVFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  620

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV +PYTLL+PTSEG
Sbjct  621  QRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVNMPYTLLYPTSEG  680

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  681  GLTGKGIPNSVSI  693



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            + +  ++WW E V++GH DKK EPWWPKM + + L ET T  IWI+SALHAAVNFGQY Y
Sbjct  674  KDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAVNFGQYPY  733

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQ QTLLGISLIEILS H++D
Sbjct  734  AGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEILSSHSTD  793

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++W NR GPV+VPY LL+
Sbjct  794  EVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWMNRVGPVEVPYMLLY  853

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG+T +GIPNS+SI
Sbjct  854  PTSEGGVTAKGIPNSVSI  871



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPK+ + +VL+E  TTIIW +SALHAAVNFGQY YAGY P
Sbjct  670  QSWWKELVEEGHGDKKDEPWWPKLQTLEVLVEICTTIIWTASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP  GT EYEELK+NPDK FL+TITAQ QTLLGISLIEILSRH++DE+YLG
Sbjct  730  NRPTISRKFMPVKGTAEYEELKSNPDKVFLKTITAQLQTLLGISLIEILSRHSTDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L+AF++FGKKL  IE+RI +MN+ +K +NR GPVKVPYTLLFPTS G
Sbjct  790  QRDTPEWTADTAPLEAFDKFGKKLEEIEERITSMNNGEKLKNRVGPVKVPYTLLFPTSGG  849

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  850  GLTGKGIPNSVSI  862



>gb|KGN60916.1| hypothetical protein Csa_2G023340 [Cucumis sativus]
Length=485

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LI+T   IIWI+SALHAAVNFGQY YAGY P
Sbjct  293  QSWWKELREEGHGDKKDEPWWPKMQNIEELIDTCAIIIWIASALHAAVNFGQYPYAGYLP  352

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+TNP+KAFL TITAQ QTLLGI+ IEILSRH+SDE+YLG
Sbjct  353  NRPTISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEILSRHSSDEVYLG  412

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WT+DK  LDAFE+FGKKLA IED I   N+D   RNR GPV +PYTLL+P+SE 
Sbjct  413  QRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVFMPYTLLYPSSEE  472

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  473  GLTGKGIPNSVSI  485



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK EPWWPKM + + L E  T  IWI+SALHAAVNFGQY YAGY P
Sbjct  679  QSWWRELVEEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAVNFGQYPYAGYLP  738

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRR+MPE GTPE+EEL+ NPDKAFL+TITAQ QTLLGISLIEILS H++DE+YLG
Sbjct  739  NRPTLSRRYMPEEGTPEFEELRQNPDKAFLKTITAQLQTLLGISLIEILSTHSTDEVYLG  798

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+VPY LL+PTSEG
Sbjct  799  QRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVEVPYMLLYPTSEG  858

Query  152  GLTGRGIPNSISI  114
            G+T +GIPNS+SI
Sbjct  859  GVTAKGIPNSVSI  871



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WWTE    GH DKK+EPWWPKM +   L +T T IIW++SA HAAVNFGQY YAGY P
Sbjct  677  QCWWTELRNVGHGDKKDEPWWPKMQTLSDLTQTCTIIIWVASAFHAAVNFGQYPYAGYLP  736

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTP+Y EL++NPDK +L+TITAQ QTLLG+SLIEILSRH+SDE+YLG
Sbjct  737  NRPTISRRFMPEPGTPDYAELESNPDKVYLKTITAQLQTLLGVSLIEILSRHSSDEVYLG  796

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE PEWTSD   L+AFERFGKKL  IE+RI+ MN+D++W+NR GPVKVPY LL+P    
Sbjct  797  QRESPEWTSDAAALEAFERFGKKLVEIENRIIEMNNDKRWKNRVGPVKVPYMLLYPDTSN  856

Query  164  -TSEGGLTGRGIPNSISI  114
             T  GGLTGRG+PNSISI
Sbjct  857  YTGVGGLTGRGVPNSISI  874



>ref|XP_010094673.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56581.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=764

 Score =   296 bits (759),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+EPWWP M +R+ L ET TT+IWI+SALHAAVNFGQY YAGY P
Sbjct  572  QAWWKELREVGHGDKKDEPWWPTMQTRKDLTETCTTVIWIASALHAAVNFGQYPYAGYLP  631

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEYEEL TNPD AFL+TITAQ QT+LG+SLIEILSRHASDE+YLG
Sbjct  632  NRPTVSRRFMPEEGTPEYEELMTNPDMAFLKTITAQEQTILGVSLIEILSRHASDEVYLG  691

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D     AFERFG+KLA IEDRI++ N+D+  +NR GPVK PYTLL P+SE 
Sbjct  692  QRDTPEWTADAEPTKAFERFGEKLAQIEDRIMSRNNDKTLKNRVGPVKFPYTLLCPSSEE  751

Query  152  GLTGRGIPNSISI  114
            GLT RGIPNSISI
Sbjct  752  GLTARGIPNSISI  764



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  +KGH DKK+EPWWPKM +   LI++ T +IWI+SALHAAVNFGQY YAGY P
Sbjct  661  QAWWKELREKGHGDKKDEPWWPKMQTVLELIDSCTIVIWIASALHAAVNFGQYPYAGYLP  720

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPEPGTPEYEEL TNP+KAFL+TIT Q QTLLGISLIE+LSRH +DE+YLG
Sbjct  721  NRPTLSRRFMPEPGTPEYEELNTNPEKAFLKTITPQMQTLLGISLIEMLSRHTADEVYLG  780

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
             R+ PEWT+D+  L AFERFGK+L  IE+RI  MN D+KW+NR+GPVKVPYT  +P+SE 
Sbjct  781  LRDTPEWTNDQEPLQAFERFGKRLREIEERITQMNCDEKWKNRSGPVKVPYTSFYPSSEM  840

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  841  GLTGKGIPNSVSI  853



>ref|XP_007034722.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 ref|XP_007034723.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY05648.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY05649.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
Length=453

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+EPWWP++ +R  LIE  T IIW++SA HAAVNFGQY YAGY P
Sbjct  256  QSWWAEIRTEGHGDLKDEPWWPEIKTRAELIEACTIIIWVASAFHAAVNFGQYPYAGYLP  315

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL+ +PD AFL+TITAQFQTLLG+SLIE+LSRH++DEIYLG
Sbjct  316  NRPTVSRRFMPEPGTPEYAELEKDPDLAFLKTITAQFQTLLGVSLIEVLSRHSADEIYLG  375

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AFERFGKKL  IE RI+  N+D + +NRTGPVK+PYTLL+P +  
Sbjct  376  QRDSPEWTSDAEPLAAFERFGKKLIEIESRIMDRNNDSRLKNRTGPVKMPYTLLYPNTSD  435

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  436  YSREGGLTGKGIPNSISI  453



>gb|AGN75068.1| lipoxygenase 2 [Momordica charantia]
Length=845

 Score =   298 bits (762),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWPKM + + LIET T +IWI+SALHAAVNFGQY YAGY P
Sbjct  653  QSWWKELREKGHGDKKDEPWWPKMQNVEELIETCTIVIWIASALHAAVNFGQYPYAGYLP  712

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL++NP+KAFL TITAQ QTLLG+SLIEILSRH+SDE+YLG
Sbjct  713  NRPTISRKFMPEKGTPEYEELESNPEKAFLRTITAQLQTLLGVSLIEILSRHSSDEVYLG  772

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+DK  L+AFE+FGKKLA IED I+  N D + +NR GPV VPYTLL+PT E 
Sbjct  773  QRDSPEWTTDKEPLEAFEKFGKKLAEIEDGIIKRNGDLRLKNRVGPVVVPYTLLYPTGEE  832

Query  152  GLTGRGIPNSISI  114
            GL+G+GIPNS+SI
Sbjct  833  GLSGKGIPNSVSI  845



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score =   298 bits (762),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DK NEPWWPKM +R+ LI++ T +IW++SALHAAVNFGQY Y GY P
Sbjct  674  QSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLP  733

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILSRH+SDEI+LG
Sbjct  734  NRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLG  793

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+PYTLL+P+S+ 
Sbjct  794  QRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDI  853

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  854  GLTGRGIPNSVSI  866



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =   298 bits (762),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DK NEPWWPKM +R+ LI++ T +IW++SALHAAVNFGQY Y GY P
Sbjct  675  QSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLP  734

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILSRH+SDEI+LG
Sbjct  735  NRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLG  794

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+PYTLL+P+S+ 
Sbjct  795  QRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDI  854

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  855  GLTGRGIPNSVSI  867



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   298 bits (762),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WW E  ++GH DKK+EPWWPKM + + L++T T IIW++SALHAAVNFGQY YAGY P R
Sbjct  669  WWKEVREEGHGDKKDEPWWPKMRTVKELMQTCTIIIWVASALHAAVNFGQYPYAGYLPNR  728

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+LSRH+SDE+YLGQR
Sbjct  729  PTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVYLGQR  788

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEGGL  147
            + PEWT D   L AFE+FG+KLA IE+ I+  N +++++NR GPVK+PYTLL+PTSEGGL
Sbjct  789  DTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGL  848

Query  146  TGRGIPNSISI  114
            TG+GIPNS+SI
Sbjct  849  TGKGIPNSVSI  859



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   298 bits (764),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWP M +R+ L+ET T IIW +SALHAAVNFGQY YAGY P
Sbjct  723  QSWWKELVEEGHGDKKDEPWWPNMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLP  782

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSR+FMPE GTPEY+EL+++PD  FL+TITAQ Q +LGI+LIEILSRH++DE+YLG
Sbjct  783  NRPTLSRKFMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEILSRHSTDEVYLG  842

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +R+ PEWT+D+  L AF++FG+KLA IEDRI +MN+D+K +NR GPVK+PYTLLFPTS G
Sbjct  843  KRDTPEWTADREPLKAFDKFGRKLAEIEDRITSMNNDEKLKNRVGPVKMPYTLLFPTSGG  902

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  903  GLTGRGIPNSVSI  915



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =   297 bits (761),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            + +  ++WW E V++GH DKK EPWWPKM + + L E  T  IWI+SALHAAVNFGQY Y
Sbjct  674  KDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAVNFGQYPY  733

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQFQTLL ISL+EILS H++D
Sbjct  734  AGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQFQTLLVISLMEILSMHSTD  793

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+VPY LL+
Sbjct  794  EVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVEVPYMLLY  853

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG T +GIPNS+SI
Sbjct  854  PTSEGGATAKGIPNSVSI  871



>ref|XP_009625817.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=844

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+EPWWPKM + + LI++ TTIIWI+SALHAA+NFGQY Y GY P
Sbjct  652  QAWWKEVREDGHGDKKSEPWWPKMQALKELIDSCTTIIWIASALHAAINFGQYPYGGYLP  711

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRRFMPEPG+PEYEELKTNP+K +L TIT Q QTL+GIS IEILS H+SDEIYLG
Sbjct  712  NRPSMSRRFMPEPGSPEYEELKTNPEKGYLRTITPQLQTLIGISAIEILSTHSSDEIYLG  771

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT DK  + A ERFGKKLA IE++I+ MN+D+K +NR GPVK+PYTLL+PTSE 
Sbjct  772  QRDTPEWTKDKEPIQALERFGKKLAEIEEKIIKMNNDKKLKNRMGPVKMPYTLLYPTSEP  831

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  832  GLTGKGIPNSVSI  844



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH DKK+EPWWP+M +   + +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  683  QSWWTEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVIIWIASALHAAVNFGQYPYAGYLP  742

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY+EL  NPD AFL+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  743  NRPTISRRFMPEPGTPEYDELAKNPDVAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  802

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD  +L AFERFG+KL  IE++I+ MN+D +W+NR GPV+VPYTLLFP +  
Sbjct  803  QRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDNRWKNRVGPVQVPYTLLFPNTTD  862

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  863  YSREGGLTGKGIPNSVSI  880



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DK NEPWWPKM +R+ LI++ T +IW++SALHAAVNFGQY Y GY P
Sbjct  715  QSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLP  774

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILSRH+SDEI+LG
Sbjct  775  NRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLG  834

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+PYTLL+P+S+ 
Sbjct  835  QRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDI  894

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  895  GLTGRGIPNSVSI  907



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DK NEPWWPKM +R+ LI++ T +IW++SALHAAVNFGQY Y GY P
Sbjct  714  QSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLP  773

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILSRH+SDEI+LG
Sbjct  774  NRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLG  833

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+PYTLL+P+S+ 
Sbjct  834  QRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDI  893

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  894  GLTGRGIPNSVSI  906



>ref|XP_006472029.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Citrus sinensis]
Length=808

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM +R+ LI++ T IIW++SALHAA+NFGQY YAGY P
Sbjct  616  QSWWKELREEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAINFGQYPYAGYLP  675

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEY+EL++NPDK FL+TITAQ QT+LGISLIEILSRH++DE+YLG
Sbjct  676  NRPTISRRFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEILSRHSTDEVYLG  735

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWTSD+  L AF+ FGKKLA +E++I++ N ++  +NR GPVK+PYTLL PTSEG
Sbjct  736  QRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVKMPYTLLVPTSEG  795

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  796  GLTGKGIPNSVSI  808



>gb|AES82497.2| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=867

 Score =   296 bits (757),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E +Q+GH DKKNEPWWPKM + + L ET T IIWI+SALHAAVNFGQY +AGY+P
Sbjct  675  QSWWKELIQEGHGDKKNEPWWPKMQTVEELTETCTIIIWIASALHAAVNFGQYPFAGYSP  734

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY+EL TNPDKAFL+TITAQ QTL+GISLIEILS H+SDE+YLG
Sbjct  735  NRPTISRRFMPEKGTIEYDELVTNPDKAFLKTITAQLQTLVGISLIEILSTHSSDEVYLG  794

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+   WT D   L+AF+RFGKKL  IE+RI+AMNDD   +NR GPVK+PYTLL+P SE 
Sbjct  795  QRDSMHWTCDAEPLEAFDRFGKKLKEIEERIVAMNDDVNLKNRVGPVKMPYTLLYPRSEA  854

Query  152  GLTGRGIPNSISI  114
            GLTG GIPNS+SI
Sbjct  855  GLTGAGIPNSVSI  867



>ref|XP_009779646.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=822

 Score =   295 bits (755),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+EPWWPKM +RQ LI+++T IIW++SALHAAVNFGQY Y G+ P
Sbjct  630  QAWWKELREVGHGDKKDEPWWPKMQTRQELIDSVTIIIWMASALHAAVNFGQYPYGGFAP  689

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP +SRR +PEPGTPEYEELK NP K +L+TIT QFQTL+GIS +E+LS H SDEIYLG
Sbjct  690  NRPGMSRRLIPEPGTPEYEELKVNPVKGYLKTITPQFQTLIGISALEVLSTHTSDEIYLG  749

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT DK  L AFERFGKKLA IE+ I  MN+D+KW+NRTGPVK+PYTLL+PTSE 
Sbjct  750  QRDSAEWTKDKEALQAFERFGKKLAEIEENITKMNNDKKWKNRTGPVKMPYTLLYPTSEP  809

Query  152  GLTGRGIPNSISI  114
            GLT +GIPNSISI
Sbjct  810  GLTAKGIPNSISI  822



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++ H DKK+EPWWPKM +R+ LI + T IIW++SALHAAVNFGQY YAGY P
Sbjct  668  QAWWKELREEAHGDKKDEPWWPKMQTREELINSCTIIIWVASALHAAVNFGQYPYAGYLP  727

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY EL++NPDK FL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  728  NRPTISRRFMPEKGTSEYTELESNPDKVFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  787

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV +PYTLL+PTSEG
Sbjct  788  QRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVNMPYTLLYPTSEG  847

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  848  GLTGKGIPNSVSI  860



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++ H DKK+EPWWPKM +R+ LI + T IIW++SALHAAVNFGQY YAGY P
Sbjct  673  QAWWKELREEAHGDKKDEPWWPKMQTREELINSCTIIIWVASALHAAVNFGQYPYAGYLP  732

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY EL++NPDK FL+TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  733  NRPTISRRFMPEKGTSEYTELESNPDKVFLKTITAQLQTLLGISLIEILSRHSSDEVYLG  792

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV +PYTLL+PTSEG
Sbjct  793  QRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVNMPYTLLYPTSEG  852

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  853  GLTGKGIPNSVSI  865



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM +R+ LI++ T IIW++SALHAA+NFGQY YAGY P
Sbjct  682  QSWWKELREEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAINFGQYPYAGYLP  741

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEY+EL++NPDK FL+TITAQ QT+LGISLIEILSRH++DE+YLG
Sbjct  742  NRPTISRRFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEILSRHSTDEVYLG  801

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWTSD+  L AF+ FGKKLA +E++I++ N ++  +NR GPVK+PYTLL PTSEG
Sbjct  802  QRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVKMPYTLLVPTSEG  861

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  862  GLTGKGIPNSVSI  874



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 164/198 (83%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E    GH DKK+EPWWP+M +   + +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  684  QSWWAEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVIIWIASALHAAVNFGQYPYAGYLP  743

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY+EL  NPD AFL+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  744  NRPTISRRFMPEPGTPEYDELAKNPDAAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  803

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD  +L AFERFG+KL  IE++I+ MN+D++W+NR GPV+VPYTLLFP +  
Sbjct  804  QRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDKRWKNRVGPVQVPYTLLFPNTTD  863

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  864  YSREGGLTGKGIPNSVSI  881



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 164/198 (83%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E    GH DKK+EPWWP+M +   + +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  683  QSWWAEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVIIWIASALHAAVNFGQYPYAGYLP  742

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY+EL  NPD AFL+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  743  NRPTISRRFMPEPGTPEYDELAKNPDAAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  802

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD  +L AFERFG+KL  IE++I+ MN+D++W+NR GPV+VPYTLLFP +  
Sbjct  803  QRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDKRWKNRVGPVQVPYTLLFPNTTD  862

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  863  YSREGGLTGKGIPNSVSI  880



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM +R+ LI++ T IIW++SALHAA+NFGQY YAGY P
Sbjct  682  QSWWKELREEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAINFGQYPYAGYLP  741

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTPEY+EL++NPDK FL+TITAQ QT+LGISLIEILSRH++DE+YLG
Sbjct  742  NRPTISRRFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEILSRHSTDEVYLG  801

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWTSD+  L AF+ FGKKLA +E++I++ N ++  +NR GPVK+PYTLL PTSEG
Sbjct  802  QRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVKMPYTLLVPTSEG  861

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  862  GLTGKGIPNSVSI  874



>ref|XP_009779645.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=849

 Score =   295 bits (755),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+EPWWPKM +RQ LI+++T IIW++SALHAAVNFGQY Y G+ P
Sbjct  657  QAWWKELREVGHGDKKDEPWWPKMQTRQELIDSVTIIIWMASALHAAVNFGQYPYGGFAP  716

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP +SRR +PEPGTPEYEELK NP K +L+TIT QFQTL+GIS +E+LS H SDEIYLG
Sbjct  717  NRPGMSRRLIPEPGTPEYEELKVNPVKGYLKTITPQFQTLIGISALEVLSTHTSDEIYLG  776

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT DK  L AFERFGKKLA IE+ I  MN+D+KW+NRTGPVK+PYTLL+PTSE 
Sbjct  777  QRDSAEWTKDKEALQAFERFGKKLAEIEENITKMNNDKKWKNRTGPVKMPYTLLYPTSEP  836

Query  152  GLTGRGIPNSISI  114
            GLT +GIPNSISI
Sbjct  837  GLTAKGIPNSISI  849



>ref|XP_009621679.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=822

 Score =   294 bits (753),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+EPWWPKM +RQ LI+++T IIW++SALHAAVNFGQY Y GY P
Sbjct  630  QAWWKELREVGHGDKKDEPWWPKMQTRQELIDSVTIIIWMASALHAAVNFGQYPYGGYAP  689

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP +SRR +PEPGTPEYEELK NP K +L+TIT QF TL+GIS +E+LS H SDEIYLG
Sbjct  690  NRPGMSRRLIPEPGTPEYEELKLNPVKGYLKTITPQFHTLIGISALEVLSTHTSDEIYLG  749

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT DK  L AFERFGKKLA IE+ I  MN+D+KWRNRTGPVK+PYTLL+PTSE 
Sbjct  750  QRDSAEWTKDKEALLAFERFGKKLAQIEENITKMNNDKKWRNRTGPVKMPYTLLYPTSEP  809

Query  152  GLTGRGIPNSISI  114
            GLT +GIPNSISI
Sbjct  810  GLTAKGIPNSISI  822



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   295 bits (755),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T +IW +SALHAA+NFGQ+SYAGY P
Sbjct  671  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  731  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK+PYTLLFPTSEG
Sbjct  791  QRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEG  850

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  851  GITGKGIPNSVSI  863



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   295 bits (755),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T +IW +SALHAA+NFGQ+SYAGY P
Sbjct  671  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  731  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK+PYTLLFPTSEG
Sbjct  791  QRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEG  850

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  851  GITGKGIPNSVSI  863



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T ++W +SALHAA+NFGQ+SYAGY P
Sbjct  671  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAALNFGQFSYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  731  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK+PYTLLFPTSEG
Sbjct  791  QRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEG  850

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  851  GITGKGIPNSVSI  863



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            + +  ++WW E V++GH DKK+EPWWPKM + + L ET T  IWI+SALHAAVNFGQY Y
Sbjct  667  KDEELQSWWKELVEEGHGDKKDEPWWPKMQTVKDLTETCTITIWIASALHAAVNFGQYPY  726

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPTLSRR+MPE GTPE+EEL+ NPDKAFL+TITAQ QTLLGIS+IEILS H++D
Sbjct  727  AGYLPNRPTLSRRYMPEEGTPEFEELRQNPDKAFLKTITAQLQTLLGISIIEILSMHSTD  786

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+  EWT+D   L+AFERFGKKL  +E+ I+ MN D++WRNR GPV++PY LL+
Sbjct  787  EVYLGQRDTREWTADAEPLEAFERFGKKLGEVEETIIRMNGDKRWRNRVGPVEIPYMLLY  846

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG+T +GIPNS+SI
Sbjct  847  PTSEGGVTAKGIPNSVSI  864



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T ++W +SALHAA+NFGQ+SYAGY P
Sbjct  672  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAALNFGQFSYAGYLP  731

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  732  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  791

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK+PYTLLFPTSEG
Sbjct  792  QRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEG  851

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  852  GITGKGIPNSVSI  864



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKK+EPWWPKM +R+ LI + TTIIW++SALHAAVNFGQY YAGY P
Sbjct  680  QSWWNELREVGHGDKKDEPWWPKMQTRKELIYSCTTIIWVASALHAAVNFGQYPYAGYLP  739

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRF+PE G+PEYEELK+ P+KAFL+TITAQ QTLLGISLIE+LS H++DE+YLG
Sbjct  740  NRPTISRRFIPELGSPEYEELKSYPEKAFLKTITAQLQTLLGISLIEVLSAHSTDEVYLG  799

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT+D   L+AF+RFGKKL  IE+ I+ MN+D+K +NR GPVKVPYTLLFPTSEG
Sbjct  800  QRDTAEWTTDIEPLEAFQRFGKKLGEIEENIIDMNNDEKLKNRVGPVKVPYTLLFPTSEG  859

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  860  GVTGKGIPNSVSI  872



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  +KGH DKK+EPWWPKM + Q LI + T +IWI+SALHAAVNFGQY YAGY P
Sbjct  640  QAWWKELREKGHGDKKDEPWWPKMQTVQELINSCTIVIWIASALHAAVNFGQYPYAGYLP  699

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPEPGT EYEEL TNP+ AFL+TIT Q QTLLGISLIE+LSRH +DE+YLG
Sbjct  700  NRPTLSRRFMPEPGTQEYEELNTNPENAFLKTITPQMQTLLGISLIEMLSRHTADEVYLG  759

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D+  L AFERFGK+L  IE RI  MN D+KW+NR+GPVKVPYT  + +SE 
Sbjct  760  QRDTPEWTNDQEPLQAFERFGKRLREIEKRITQMNCDEKWKNRSGPVKVPYTSFYASSEM  819

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  820  GLTGKGIPNSVSI  832



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T ++W +SALHAA+NFGQ+SYAGY P
Sbjct  671  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAALNFGQFSYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  731  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK+PYTLLFPTSEG
Sbjct  791  QRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEG  850

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  851  GITGKGIPNSVSI  863



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T +IW +SALHAA+NFGQ+SYAGY P
Sbjct  671  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  731  NRPTISRKFMPEKGTPEYEELEASPDAVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D K +NR G VK+PYTLLFPTSEG
Sbjct  791  QRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDDKLKNRVGSVKIPYTLLFPTSEG  850

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  851  GITGKGIPNSVSI  863



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKK+EPWWPKM +R+ LIE+ T IIW +SALHAA+NFGQY Y GY P
Sbjct  679  QSWWKELREVGHGDKKHEPWWPKMQTREELIESCTIIIWTASALHAAINFGQYPYGGYLP  738

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRRFMPE GTPEYEELKTNPDKAF +T+TAQ QT+LGISLIEILSRH+SDE+YLG
Sbjct  739  NRPSISRRFMPEKGTPEYEELKTNPDKAFFKTVTAQLQTVLGISLIEILSRHSSDEVYLG  798

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   L+AF++FGKKL  IEDRI+ MN D + +NR GPV VPYTLL P+S+ 
Sbjct  799  QRDTPEWTTDSKPLEAFKKFGKKLEKIEDRIIEMNKDVELKNRIGPVLVPYTLLVPSSDV  858

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  859  GLTGRGIPNSVSI  871



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T +IW +SALHAA+NFGQ+SYAGY P
Sbjct  671  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  731  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AF++FGKKLA IEDRI +MN+D+K +NR G VK+PYTLLFPTSEG
Sbjct  791  QRDTPDWTSDTAALEAFDKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEG  850

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  851  GITGKGIPNSVSI  863



>emb|CDO99039.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH D K+EPWWP+M +R  L++  T IIWI+SALHAAVNFGQY YAGY P
Sbjct  685  QSWWTELRNVGHGDLKDEPWWPQMQTRDELVQACTIIIWIASALHAAVNFGQYPYAGYLP  744

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL +NPD AFL+TITAQFQTLLG+SLIEILSRH+SDEIYLG
Sbjct  745  NRPTVSRRFMPEPGTPEYAELASNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLG  804

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QR++PEWTSD    DAF RFG KL  IE+ ILA N+D+K++NRTGPVK+PYTLL P S  
Sbjct  805  QRDNPEWTSDTIPRDAFTRFGAKLVEIENHILARNNDKKYKNRTGPVKMPYTLLIPNSSD  864

Query  155  ----GGLTGRGIPNSISI  114
                GGLTG+GIPNSISI
Sbjct  865  YSKVGGLTGKGIPNSISI  882



>ref|XP_007034721.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY05647.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
Length=677

 Score =   289 bits (739),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+EPWWP++ +R  LIE  T IIW++SA HAAVNFGQY YAGY P
Sbjct  480  QSWWAEIRTEGHGDLKDEPWWPEIKTRAELIEACTIIIWVASAFHAAVNFGQYPYAGYLP  539

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL+ +PD AFL+TITAQFQTLLG+SLIE+LSRH++DEIYLG
Sbjct  540  NRPTVSRRFMPEPGTPEYAELEKDPDLAFLKTITAQFQTLLGVSLIEVLSRHSADEIYLG  599

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AFERFGKKL  IE RI+  N+D + +NRTGPVK+PYTLL+P +  
Sbjct  600  QRDSPEWTSDAEPLAAFERFGKKLIEIESRIMDRNNDSRLKNRTGPVKMPYTLLYPNTSD  659

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  660  YSREGGLTGKGIPNSISI  677



>ref|XP_010094672.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56580.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=792

 Score =   291 bits (744),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKK+EPWW K+ + + LIET TTIIWI+SALHAA+NFGQY Y GY P
Sbjct  600  QSWWKELREVGHGDKKDEPWWSKLQTLEELIETCTTIIWIASALHAAINFGQYPYGGYPP  659

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRRF+PE GTPEYEELKT+P+KAFL+TIT Q  ++LGI+L+EILSRH+SDE+YLG
Sbjct  660  NRPSMSRRFIPEEGTPEYEELKTDPEKAFLKTITGQLLSVLGIALVEILSRHSSDEVYLG  719

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D  VL+AFERFGKKL  IE++I+ MN D+K +NR GP K+PYTLL+P+SEG
Sbjct  720  QRDTPEWTTDGEVLEAFERFGKKLREIEEKIVRMNKDEKLKNRVGPAKMPYTLLYPSSEG  779

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  780  GLTGKGIPNSVSI  792



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   292 bits (748),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+E WWPKM +   L +T TTIIW++SALHAAVNFGQY YAGY P
Sbjct  675  QAWWKEVREVGHGDKKDEDWWPKMQTLAELAKTCTTIIWVASALHAAVNFGQYPYAGYLP  734

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL+ NPD AFL+TIT+QFQT+LG+SLIE+LSRH+SDE+YLG
Sbjct  735  NRPTISRRFMPEPGTPEYHELEKNPDLAFLKTITSQFQTILGVSLIEVLSRHSSDEVYLG  794

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ PEWT+D+  L+AFERF  KL  IE+RI++MN D   RNRTGPVK+PYTLL+P    
Sbjct  795  QRDSPEWTTDRSALEAFERFSHKLIEIENRIISMNQDASLRNRTGPVKMPYTLLYPNVSD  854

Query  164  -TSEGGLTGRGIPNSISI  114
             T  GGLTGRGIPNS+SI
Sbjct  855  LTGVGGLTGRGIPNSVSI  872



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH DKK+EPWWP+M +R  L +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  670  QSWWTEIRNVGHGDKKDEPWWPEMQTRADLKQTCTIIIWIASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+ +P+  FL+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  730  NRPTVSRRFMPEPGTSEYAELEKDPELGFLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD+  L AFERF K+L+ IE++I+ MN+D+KW+NR GPVKVPYTLLFP +  
Sbjct  790  QRDTPEWTSDREPLAAFERFAKRLSVIENKIMEMNNDEKWKNRNGPVKVPYTLLFPNTSD  849

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  850  KSREGGLTGKGIPNSISI  867



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPK+ + + L+E  T IIW +SALHAAVNFGQY YAGY P
Sbjct  643  QSWWKELVEEGHGDKKDEPWWPKLQTXEXLVEICTXIIWTASALHAAVNFGQYPYAGYLP  702

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP  GT EYEELK+NPDK FL+T TAQ QTLLGISLIEILSRH++DE+YLG
Sbjct  703  NRPTISRKFMPVKGTAEYEELKSNPDKVFLKTXTAQLQTLLGISLIEILSRHSTDEVYLG  762

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +R+ PEWT+D   L+AF +FGKKL  IE+RI++MN+D+K +NR G VKVPYTLLFPTS G
Sbjct  763  KRDTPEWTADAAPLEAFNKFGKKLEEIEERIISMNNDEKLKNRVGLVKVPYTLLFPTSGG  822

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  823  GLTGKGIPNSVSI  835



>emb|CAN62372.1| hypothetical protein VITISV_036476 [Vitis vinifera]
Length=289

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   KGH DKK+EPWW +M +   L +T T IIW++SALHAAVNFGQY YAGY P
Sbjct  92   QSWWMELRNKGHGDKKDEPWWSEMQTLVDLTKTCTIIIWVASALHAAVNFGQYPYAGYLP  151

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY+EL+ NPD AFL+TITAQ QTLLG+SLIEILSRH++DEIYLG
Sbjct  152  NRPTISRRFMPEPGTPEYQELERNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEIYLG  211

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AFERFG +L  IE RI  MN D++W NR GPV++ YTLL+P +  
Sbjct  212  QRDTPEWTSDAEPLAAFERFGSRLRGIETRINQMNQDRRWNNRFGPVEMQYTLLYPNTSD  271

Query  158  ---EGGLTGRGIPNSISI  114
               +GGL G+GIPNS+SI
Sbjct  272  YSRQGGLAGKGIPNSVSI  289



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWPKM + + L+ET TTIIW++SALHAAVNFGQY Y GY P
Sbjct  673  QSWWNELREKGHGDKKDEPWWPKMQTHKELVETCTTIIWVASALHAAVNFGQYPYGGYLP  732

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP +SRRF+PE  TP+Y EL++NP+KAFL+T+T Q  ++LGISLIEILSRH +DE++LG
Sbjct  733  NRPAMSRRFIPERDTPDYAELESNPEKAFLKTVTPQMLSILGISLIEILSRHTADEVFLG  792

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+DK  L AFERFG+KL  IEDRI  MN+D+K RNRTGP K+PYTLLFPTSE 
Sbjct  793  QRDTPEWTTDKEALKAFERFGEKLTEIEDRITRMNNDEKLRNRTGPAKMPYTLLFPTSEV  852

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  853  GLTGKGIPNSVSI  865



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKK+EPWWPKM + + LI+T T IIWI+SALHAA+NFGQY Y G+ P
Sbjct  673  QSWWKEIREVGHGDKKDEPWWPKMQTCEELIQTCTIIIWIASALHAAINFGQYPYGGFPP  732

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP +SRRFMPE GTPEY+EL  NPDKA+L+T+T+QF  +LGISL+EILS+H+SDE+YLG
Sbjct  733  SRPAISRRFMPEKGTPEYDELVANPDKAYLKTVTSQFLAVLGISLVEILSKHSSDEVYLG  792

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L AFE+FGKKLA IE+RIL MN D+K+RNR GPVK+PYTLL+P+S+G
Sbjct  793  QRDTPDWTSDAEPLQAFEKFGKKLADIEERILRMNSDEKFRNRYGPVKMPYTLLYPSSKG  852

Query  152  GLTGRGIPNSISI  114
            GLTG G+PNSISI
Sbjct  853  GLTGMGVPNSISI  865



>gb|EPS72460.1| lipoxygenase, partial [Genlisea aurea]
Length=338

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DK++E WWP+M +   L+++ + IIW++SALHAAVNFGQY Y GY P
Sbjct  146  QSWWKEVREKGHGDKRDETWWPRMETCDELVDSCSIIIWVASALHAAVNFGQYPYGGYLP  205

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRR +PE GTP+YEELK+ P+K FL+TIT+Q Q++LGISLIEILSRH+SDE++LG
Sbjct  206  NRPSTSRRLIPEAGTPDYEELKSEPEKTFLKTITSQLQSVLGISLIEILSRHSSDEVFLG  265

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE PEWT+D   + AF RFGKKL  IE +I  MNDD +W+NR GPVKVPYTLL+P+S+ 
Sbjct  266  QRESPEWTADSEAITAFGRFGKKLEDIEKKISEMNDDSRWKNRYGPVKVPYTLLYPSSDV  325

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNSISI
Sbjct  326  GLTGKGIPNSISI  338



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 163/196 (83%), Gaps = 5/196 (3%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WWTE  + GH DKK+EPWWP+M++   L+ + TTIIW++SALHAAVNFGQY YAG+ P R
Sbjct  689  WWTEIRKVGHGDKKDEPWWPQMSTIADLVNSATTIIWVASALHAAVNFGQYPYAGFLPNR  748

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SRRFMPEPGTPE+ EL+++PD AFL+TITAQFQ LLG+SLIEILSRH++DE+YLGQR
Sbjct  749  PTVSRRFMPEPGTPEFAELESDPDAAFLKTITAQFQALLGVSLIEILSRHSTDEVYLGQR  808

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP-----T  162
            + PEWT D   ++AFERFGK+L  IE+RIL  N D++ RNR GPVKVPYTLLFP     T
Sbjct  809  DTPEWTDDGEAIEAFERFGKRLVEIEERILERNRDERLRNRVGPVKVPYTLLFPGTSDFT  868

Query  161  SEGGLTGRGIPNSISI  114
             EGGLTG+GIPNSISI
Sbjct  869  REGGLTGKGIPNSISI  884



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LI+T   IIWI+SALHAAVNFGQY YAGY P
Sbjct  660  QSWWKELREEGHGDKKDEPWWPKMQNIEDLIDTCAIIIWIASALHAAVNFGQYPYAGYLP  719

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+TNP+K FL TITAQ QTLLGI+ IEILSRH+SDE+YLG
Sbjct  720  NRPTISRKFMPEEGTPEYKELETNPEKVFLRTITAQLQTLLGIASIEILSRHSSDEVYLG  779

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WT+DK VLDAFE+FGKKLA IED I   N+D   RNR GPV +PYTLL+P+SE 
Sbjct  780  QRDSPKWTADKEVLDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVFMPYTLLYPSSEE  839

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  840  GLTGKGIPNSVSI  852



>ref|XP_009774054.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=844

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH D+K+EPWWPKM + + LI++   IIWI+SALHAA+NFGQY Y GY P
Sbjct  652  QAWWKEVREDGHGDRKSEPWWPKMQTLKELIDSCNIIIWIASALHAAINFGQYPYGGYLP  711

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRRFMPEPG+PEYE+LKTNP+K +L TIT Q QTL+GIS IEILS H+SDEIYLG
Sbjct  712  NRPSMSRRFMPEPGSPEYEDLKTNPEKGYLRTITPQLQTLIGISAIEILSIHSSDEIYLG  771

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT DK  L A ERFGKKLA IE++I+ MN+D K +NR GPVK+PYTLL+PTSE 
Sbjct  772  QRDTPEWTKDKEPLQALERFGKKLAEIEEKIMKMNNDTKLKNRIGPVKMPYTLLYPTSEP  831

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  832  GLTGKGIPNSVSI  844



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =   291 bits (744),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKKNEPWWPKM +R+ LIE  T IIW++SALHA+ NFGQY YAG+ P
Sbjct  671  QSWWKELREEGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHASTNFGQYPYAGFLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRR MPE GTPEY+EL  NP+KAFL+TITAQ QTL+G+SLIEILS+H+SDE+YLG
Sbjct  731  NRPTVSRRLMPEEGTPEYDELVNNPEKAFLKTITAQLQTLIGLSLIEILSKHSSDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P WTSD   L+AFERFGKKLA IE+RI+ MN+D K +NR GPV +PYTLL+P+S+ 
Sbjct  791  QRDTPNWTSDVEPLEAFERFGKKLAQIEERIVTMNNDGKHKNRVGPVNMPYTLLYPSSKA  850

Query  152  GLTGRGIPNSISI  114
            GLTG GIPNS++I
Sbjct  851  GLTGMGIPNSVAI  863



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH D K+EPWWPKM + + L+ET T + W +SALHAA+NFGQ+SYAGY P
Sbjct  671  QSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILXWTASALHAALNFGQFSYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEILSRH++DE+YLG
Sbjct  731  NRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AF +FGKKLA IEDRI +MN+D+K +NR G VK+PYTLLFPTSEG
Sbjct  791  QRDTPDWTSDTAALEAFXKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEG  850

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  851  GITGKGIPNSVSI  863



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LI+T   IIWI+SALHAAVNFGQY YAGY P
Sbjct  660  QSWWKELREEGHGDKKDEPWWPKMQNIEELIDTCAIIIWIASALHAAVNFGQYPYAGYLP  719

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+TNP+KAFL TITAQ QTLLGI+ IEILSRH+SDE+YLG
Sbjct  720  NRPTISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEILSRHSSDEVYLG  779

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WT+DK  LDAFE+FGKKLA IED I   N+D   RNR GPV +PYTLL+P+SE 
Sbjct  780  QRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVFMPYTLLYPSSEE  839

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  840  GLTGKGIPNSVSI  852



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   291 bits (744),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E    GH DK++EPWWP+M +R  L++T T IIW++SALHAAVNFGQY YAGY P
Sbjct  685  QSWWEELRNVGHGDKRDEPWWPEMQTRAELVQTCTIIIWVASALHAAVNFGQYPYAGYLP  744

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL+ NPD AFL+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  745  NRPTVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  804

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWT D   L AFERFG +L  IE+RIL MN+D++W+NR G VKVPYTLL+P +  
Sbjct  805  QRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVPYTLLYPNTSD  864

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  865  YSREGGLTGKGIPNSVSI  882



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E V++GH DKK+EPWWPK+ + + L+E  T IIW +SALHAAVNFGQY YAGY P
Sbjct  771  QSWWKELVEEGHGDKKDEPWWPKLQTXEXLVEICTXIIWTASALHAAVNFGQYPYAGYLP  830

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP  GT EYEELK+NPDK FL+T TAQ QTLLGISLIEILSRH++DE+YLG
Sbjct  831  NRPTISRKFMPVKGTAEYEELKSNPDKVFLKTXTAQLQTLLGISLIEILSRHSTDEVYLG  890

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +R+ PEWT+D   L+AF +FGKKL  IE+RI++MN+D+K +NR G VKVPYTLLFPTS G
Sbjct  891  KRDTPEWTADAAPLEAFNKFGKKLEEIEERIISMNNDEKLKNRVGLVKVPYTLLFPTSGG  950

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  951  GLTGKGIPNSVSI  963



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   290 bits (743),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 164/198 (83%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+E WWPKM + + L +T +TIIW++SALHAAVNFGQY YAGY P
Sbjct  670  QAWWKEVREVGHGDKKDETWWPKMQTFRELTKTCSTIIWVASALHAAVNFGQYPYAGYLP  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTP YE+L+ NPD  FLETIT+QFQT+LG+SLIEILSRH+SDE+YLG
Sbjct  730  NRPTISRRFMPEPGTPAYEKLENNPDGVFLETITSQFQTILGVSLIEILSRHSSDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QR+ PEWT+D+  LDAF+RFG+ L  IE+RIL MN D++ +NR GPVK+PYTLL+P++  
Sbjct  790  QRDTPEWTTDRKALDAFKRFGEHLVEIENRILRMNQDKRLKNRNGPVKMPYTLLYPSTSD  849

Query  155  ----GGLTGRGIPNSISI  114
                GGLTGRGIPNS+SI
Sbjct  850  FSGVGGLTGRGIPNSVSI  867



>gb|KDO74648.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=803

 Score =   288 bits (738),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E    GH DK++EPWWP+M ++  L++T T IIW++SALHAAVNFGQY YAGY P
Sbjct  606  QSWWEELRNVGHGDKRDEPWWPEMQTQAELVQTCTIIIWVASALHAAVNFGQYPYAGYLP  665

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL+ NPD AFL+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  666  NRPTVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  725

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWT D   L AFERFG +L  IE+RIL MN+D++W+NR G VKVPYTLL+P +  
Sbjct  726  QRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVPYTLLYPNTSD  785

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  786  YSREGGLTGKGIPNSVSI  803



>ref|XP_006344836.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=845

 Score =   289 bits (740),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM + + L ++ T IIWI+SALHAA+NFGQY Y GY P
Sbjct  653  QAWWKELQEEGHGDKKDEPWWPKMQTLKELTDSCTIIIWIASALHAAINFGQYPYGGYLP  712

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SR+ MPEPG+PEYEELKTNP+K +L TIT Q QTL+GIS IEILS H+SDEIYLG
Sbjct  713  NRPSMSRKLMPEPGSPEYEELKTNPEKGYLSTITPQLQTLIGISAIEILSTHSSDEIYLG  772

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WT+DK  L A ERFGKKL  IE++I+ MN+D+KW+NR GP+K+PYTLL+P SE 
Sbjct  773  QRDTPKWTNDKEPLQALERFGKKLTEIEEKIIKMNNDKKWKNRMGPIKMPYTLLYPISEP  832

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  833  GLTGKGIPNSVSI  845



>ref|XP_006838252.1| hypothetical protein AMTR_s00103p00053060 [Amborella trichopoda]
 gb|ERN00821.1| hypothetical protein AMTR_s00103p00053060 [Amborella trichopoda]
Length=254

 Score =   273 bits (697),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E    GH DK++EPWWP+M++   L +T+ T+IW++SALHAAVNFGQY+YAGY P
Sbjct  57   QSWWAEVRNVGHGDKRSEPWWPQMSTIHELTDTIITLIWVASALHAAVNFGQYTYAGYMP  116

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT +YE+L+++PD  FL TIT Q  TLLG+SLIEILSRH+SDE+YLG
Sbjct  117  NRPTISRRFMPEPGTTDYEKLESDPDGYFLSTITNQPLTLLGVSLIEILSRHSSDELYLG  176

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QRE  EWT+D   L+AFERFGK+L  IE +I+  N D ++RNR GPVKVPYTLL+P +  
Sbjct  177  QRESSEWTADAQALEAFERFGKRLEEIEQQIMTRNSDHQFRNRVGPVKVPYTLLYPGTSD  236

Query  155  ----GGLTGRGIPNSISI  114
                GGLTGRGIPNS+SI
Sbjct  237  IGTAGGLTGRGIPNSVSI  254



>gb|KGN48009.1| Lipoxygenase [Cucumis sativus]
Length=555

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH D K+EPWWPKM +R+ L+++ T IIWI+SALHAAVNFGQY YAGY P
Sbjct  358  QSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAVNFGQYPYAGYLP  417

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE LSRH+ DEIYLG
Sbjct  418  NRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIESLSRHSVDEIYLG  477

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK+PYT LFP +  
Sbjct  478  QRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVKMPYTFLFPNTSN  537

Query  158  ---EGGLTGRGIPNSISI  114
               E GL  RGIPNSISI
Sbjct  538  YYEEEGLNARGIPNSISI  555



>ref|XP_003626279.1| Chalcone synthase [Medicago truncatula]
Length=1317

 Score =   293 bits (750),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E +Q+GH DKKNEPWWPKM + + L ET T IIWI+SALHAAVNFGQY +AGY+P
Sbjct  693  QSWWKELIQEGHGDKKNEPWWPKMQTVEELTETCTIIIWIASALHAAVNFGQYPFAGYSP  752

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY+EL TNPDKAFL+TITAQ QTL+GISLIEILS H+SDE+YLG
Sbjct  753  NRPTISRRFMPEKGTIEYDELVTNPDKAFLKTITAQLQTLVGISLIEILSTHSSDEVYLG  812

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+   WT D   L+AF+RFGKKL  IE+RI+AMNDD   +NR GPVK+PYTLL+P SE 
Sbjct  813  QRDSMHWTCDAEPLEAFDRFGKKLKEIEERIVAMNDDVNLKNRVGPVKMPYTLLYPRSEA  872

Query  152  GLTGRGIPNSI  120
            GLTG GIPNS+
Sbjct  873  GLTGAGIPNSV  883


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 66/108 (61%), Gaps = 20/108 (19%)
 Frame = -2

Query  581  IWISSALHAAVNFGQYSYAGYNPCRP-TLSRRFMPEPGTPEYEELKTNPDKAFLETITAQ  405
            IWI+SALHAAV FGQY YA Y+      + RR                    FL+T+ AQ
Sbjct  888  IWIASALHAAVKFGQYPYASYSIMNLWQILRRL-------------------FLKTVAAQ  928

Query  404  FQTLLGISLIEILSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKL  261
             Q L+G+SLIEILS H+SDE+YLG+R+   W  D   L+AF++FGKKL
Sbjct  929  LQILVGVSLIEILSAHSSDEVYLGERDTKHWIYDAEPLEAFDKFGKKL  976



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK++PWWPKM + + LI+T   IIWI+SALHAAVNFGQY YAGY P
Sbjct  660  QSWWKELREEGHGDKKDKPWWPKMQNIEELIDTCAIIIWIASALHAAVNFGQYPYAGYLP  719

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GTPEY+EL+TNP+KAFL TITAQ QTLLGI+ IEILSRH+SDE+YLG
Sbjct  720  NRPTISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEILSRHSSDEVYLG  779

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WT+DK  LDAFE+FGKKLA IED I   N+D   RNR GPV +PYTLL+P+SE 
Sbjct  780  QRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVFMPYTLLYPSSEE  839

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  840  GLTGKGIPNSVSI  852



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E    GH DK++EPWWP+M ++  L++T T IIW++SALHAAVNFGQY YAGY P
Sbjct  685  QSWWEELRNVGHGDKRDEPWWPEMQTQAELVQTCTIIIWVASALHAAVNFGQYPYAGYLP  744

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL+ NPD AFL+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  745  NRPTVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  804

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWT D   L AFERFG +L  IE+RIL MN+D++W+NR G VKVPYTLL+P +  
Sbjct  805  QRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVPYTLLYPNTSD  864

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  865  YSREGGLTGKGIPNSVSI  882



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWPKM +R+ LI++ T I+W++SALHAAVNFGQY Y GY P
Sbjct  672  QSWWKEVREKGHGDKKDEPWWPKMQTRKELIDSCTIIVWVASALHAAVNFGQYPYGGYLP  731

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+P+ GTPEY+ELKT+P+KAFL+TIT+Q Q++LGISLIEILSRH++DE+YLG
Sbjct  732  NRPSTSRRFIPDKGTPEYDELKTDPEKAFLKTITSQLQSVLGISLIEILSRHSADEVYLG  791

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   + AFE FG++L  IE RI+ MN D +W+NR+GPVK+PYTLL P+S+ 
Sbjct  792  QRDSPEWTTDTEAIKAFEMFGERLVKIEKRIIEMNKDGRWKNRSGPVKMPYTLLCPSSDI  851

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSIS+
Sbjct  852  GLTGRGIPNSISM  864



>ref|XP_010468375.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Camelina 
sativa]
Length=246

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   KGH DK++E WWP M +R  LIE+ T IIWI+SALHAAVNFGQY YAG+ P
Sbjct  49   QSWWTELRTKGHGDKQHESWWPSMQTRDDLIESCTIIIWIASALHAAVNFGQYPYAGFLP  108

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL  + D AFL+TIT Q QTLLGIS+IE LS+H++DE+YLG
Sbjct  109  NRPTVSRRFMPEPGTVEYTELAEDTDVAFLKTITPQLQTLLGISIIETLSQHSTDEVYLG  168

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE P WT+D   L+AF+RFGK+L  IE+ I+  N+D++++NRTGPV +PYTLL+P    
Sbjct  169  QRESPNWTADDEALEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTD  228

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGGLTG+GIPNS+SI
Sbjct  229  YTREGGLTGKGIPNSVSI  246



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKKNEPWWPKM + + LI+T T +IWI+SALHAA+NFGQY + G+ P
Sbjct  669  QSWWKEIREVGHGDKKNEPWWPKMETSEDLIQTCTILIWIASALHAAINFGQYPFGGFPP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP +SRRFMPE GTPEY+EL  +P KA+L+TI++QFQ +LGISL+EILS+H+SDE+YLG
Sbjct  729  SRPAISRRFMPEEGTPEYDELVADPAKAYLKTISSQFQAVLGISLVEILSKHSSDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L AFE+FGK LA+IE+RIL MN D+K RNR GPVK+PYTLL+PTS+G
Sbjct  789  QRDTPDWTSDAEPLQAFEKFGKTLASIEERILRMNSDEKLRNRFGPVKMPYTLLYPTSKG  848

Query  152  GLTGRGIPNSISI  114
            GLTG G+PNSISI
Sbjct  849  GLTGMGVPNSISI  861



>emb|CDY70916.1| BnaCnng70330D, partial [Brassica napus]
Length=504

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ LI++ T IIW++SALHAAVNFGQY  AGY P
Sbjct  312  QAWWKEVREEGHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAVNFGQYPIAGYLP  371

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP+  TPE+EEL+ NPDK FL++ITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  372  NRPTISRQFMPKENTPEFEELEKNPDKVFLKSITAQLQTLLGISLIEILSTHSSDEVYLG  431

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK+PYT LFPTSEG
Sbjct  432  QRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVKMPYTSLFPTSEG  491

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNS+SI
Sbjct  492  GVTGRGIPNSVSI  504



>ref|XP_010277588.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nelumbo 
nucifera]
Length=703

 Score =   284 bits (726),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW+E    GH DKK+EPWWPKM +   L +T T IIW++SALHAAVNFGQY YAGY P
Sbjct  506  QSWWSELRNVGHGDKKDEPWWPKMQTLSELTQTCTIIIWVASALHAAVNFGQYPYAGYLP  565

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD  +L TITAQ QTLLG+SLIEILSRH+SDE+YLG
Sbjct  566  NRPTISRRFMPEPGTPEYAELESNPDTFYLRTITAQLQTLLGVSLIEILSRHSSDEVYLG  625

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QR+ PEWT+D   L+AFERF +KL  IE+RI  MN D++ +NR GPVKVPYTLLFP +  
Sbjct  626  QRDTPEWTTDAAPLEAFERFREKLVEIENRIREMNLDKRLKNRVGPVKVPYTLLFPDTSN  685

Query  155  ----GGLTGRGIPNSISI  114
                GGLTGRGIPNSISI
Sbjct  686  VYGVGGLTGRGIPNSISI  703



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   287 bits (734),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LIET T IIWI+SALHAAVNFGQY Y GY P
Sbjct  666  QSWWKEIREEGHGDKKDEPWWPKMHTLEELIETCTIIIWIASALHAAVNFGQYPYGGYPP  725

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRR MPE GT EY EL  NPDKAFL+TIT+QFQ +LG+SL+EILSRHASDE+YLG
Sbjct  726  SRPSMSRRLMPEKGTQEYNELLENPDKAFLKTITSQFQAVLGLSLVEILSRHASDEVYLG  785

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P+WTSD   L+AFE+FG KL  IE RI  MN+D+K +NR GPVK+ YTLL PTSEG
Sbjct  786  QRDTPDWTSDIKALEAFEKFGNKLVEIEKRIGIMNNDEKLKNRFGPVKMSYTLLKPTSEG  845

Query  152  GLTGRGIPNSISI  114
            GLTG GIPNSISI
Sbjct  846  GLTGMGIPNSISI  858



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   287 bits (734),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH D K++PWWP M + Q LI++ T IIWI+SALHAAVNFGQY YAGY P
Sbjct  665  QAWWKELREQGHGDLKDKPWWPTMQTVQELIDSCTIIIWIASALHAAVNFGQYPYAGYLP  724

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPEPGT +Y+EL+ +PDK FL+TITAQ QTLLG+SLIEILSRHASDE+YLG
Sbjct  725  NRPTLSRRFMPEPGTDDYKELEADPDKVFLKTITAQLQTLLGVSLIEILSRHASDEVYLG  784

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +RE PEWT+D+  LDAF +FG+ L+ IE  I  MN   K +NRTGPV+VPYTLLFPTSE 
Sbjct  785  KREFPEWTNDQEALDAFAQFGRNLSKIEVNIKRMNTVGKLKNRTGPVEVPYTLLFPTSEV  844

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  845  GLTGKGIPNSVSI  857



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+EPWWP+M +R  LIET TTIIW++SALHAAVNFGQY YAGY P
Sbjct  677  QSWWMEVRNEGHGDLKDEPWWPQMQTRSELIETCTTIIWVASALHAAVNFGQYPYAGYLP  736

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILSRH+S+EIYLG
Sbjct  737  NRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHSSEEIYLG  796

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE+PEWTSD     +F+RF  +L  IE+RI+  N D +W+NR GPVKVPY LL+P    
Sbjct  797  QRENPEWTSDVEPRQSFQRFHDRLVDIENRIVERNSDSRWKNRNGPVKVPYMLLYPNASG  856

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  857  DNSESGLTGKGIPNSVSI  874



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   287 bits (734),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH D+K+ PWWPKM +R+ LI++ T IIW+ SALHAAVNFGQY Y GY  
Sbjct  670  QSWWKEVREVGHGDQKDAPWWPKMQTREELIQSCTIIIWVGSALHAAVNFGQYPYGGYLL  729

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRFMP+ G+PEYEELK+NPDK FL TITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  730  NRPSTSRRFMPQKGSPEYEELKSNPDKFFLGTITAQLQTLLGISLIEILSRHSSDEVYLG  789

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT++K  ++AF++FG+KLA IEDRIL MN + +++NR GPVKVPYTLL PTSE 
Sbjct  790  QRDILEWTAEKEPIEAFKKFGRKLAVIEDRILDMNREARYKNRVGPVKVPYTLLVPTSEA  849

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  850  GLTGRGIPNSVSI  862



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =   287 bits (735),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+EPWWP+M +R  LIET TTIIW++SALHAAVNFGQY YAGY P
Sbjct  694  QSWWMEVRNEGHGDLKDEPWWPQMQTRSELIETCTTIIWVASALHAAVNFGQYPYAGYLP  753

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILSRH+S+EIYLG
Sbjct  754  NRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHSSEEIYLG  813

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE+PEWTSD     +F+RF  +L  IE+RI+  N D +W+NR GPVKVPY LL+P    
Sbjct  814  QRENPEWTSDVEPRQSFQRFHDRLVDIENRIVERNSDSRWKNRNGPVKVPYMLLYPNASG  873

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  874  DNSESGLTGKGIPNSVSI  891



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   287 bits (734),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH D K+EPWWP+M +R  L +  T IIW++SALHAAVNFGQY YAGY P
Sbjct  679  QSWWTEVRNEGHGDLKDEPWWPQMQTRAELAKACTIIIWVASALHAAVNFGQYPYAGYLP  738

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILSRH+SDEIYLG
Sbjct  739  NRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLG  798

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ PEWTSD     AF+RF  +L  +E+RI+ MN+D +W+NR GPVKVPY LL+P    
Sbjct  799  QRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVKMNNDSRWKNRNGPVKVPYMLLYPNASG  858

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  859  DNSESGLTGKGIPNSVSI  876



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH D K+EPWWP+M +R  L +  T IIW++SALHAAVNFGQY YAGY P
Sbjct  689  QSWWTEVRNEGHGDLKDEPWWPQMQTRAELAKACTIIIWVASALHAAVNFGQYPYAGYLP  748

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILSRH+SDEIYLG
Sbjct  749  NRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLG  808

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ PEWTSD     AF+RF  +L  +E+RI+ MN+D +W+NR GPVKVPY LL+P    
Sbjct  809  QRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVKMNNDSRWKNRNGPVKVPYMLLYPNASG  868

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  869  DNSESGLTGKGIPNSVSI  886



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+EPWWP+M +R  L+E  T IIW++SALHAAVNFGQY YAGY P
Sbjct  680  QSWWMEVRNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNFGQYPYAGYLP  739

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILSRHASDEIYLG
Sbjct  740  NRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHASDEIYLG  799

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE+PEWTSD     +F+RF  +L  +E+RI+  N+D +W+NR GPVKVPY LL+P    
Sbjct  800  QRENPEWTSDVEPRQSFQRFHDRLVDVENRIVERNNDSRWKNRNGPVKVPYMLLYPNASG  859

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  860  DNSESGLTGKGIPNSVSI  877



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH DKK+EPWWP+M +   + +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  683  QSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIIIWIASALHAAVNFGQYPYAGYLP  742

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+LSRRFMPEPGTPEY EL+ NPD A+L+TITAQ QTLLG+SLIEILSRH++DE+YLG
Sbjct  743  NRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQTLLGVSLIEILSRHSTDEVYLG  802

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+  EWT D   L AFERF +KL  IE++I+ MN+D++W+NR GPV+VPYTLLFP +  
Sbjct  803  QRDTAEWTLDSEPLAAFERFRRKLVEIENKIMDMNNDKRWKNRVGPVEVPYTLLFPNTTD  862

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTGRGIPNSISI
Sbjct  863  YSREGGLTGRGIPNSISI  880



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH DKK+EPWWP+M +   + +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  683  QSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIIIWIASALHAAVNFGQYPYAGYLP  742

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+LSRRFMPEPGTPEY EL+ NPD A+L+TITAQ QTLLGISLIEILSRH++DE+YLG
Sbjct  743  NRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQTLLGISLIEILSRHSTDEVYLG  802

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+  EWT D   L AFERF +KL  IE++I+ MN+D++W+NR GPV+VPYTLLFP +  
Sbjct  803  QRDTTEWTLDSEPLAAFERFRRKLIEIENKIMDMNNDKRWKNRVGPVEVPYTLLFPNTTD  862

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTGRGIPNSISI
Sbjct  863  YSREGGLTGRGIPNSISI  880



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH DKK+EPWWP+M +   + +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  684  QSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIIIWIASALHAAVNFGQYPYAGYLP  743

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+LSRRFMPEPGTPEY EL+ NPD A+L+TITAQ QTLLGISLIEILSRH++DE+YLG
Sbjct  744  NRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQTLLGISLIEILSRHSTDEVYLG  803

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+  EWT D   L AFERF +KL  IE++I+ MN+D++W+NR GPV+VPYTLLFP +  
Sbjct  804  QRDTTEWTLDSEPLAAFERFRRKLIEIENKIMDMNNDKRWKNRVGPVEVPYTLLFPNTTD  863

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTGRGIPNSISI
Sbjct  864  YSREGGLTGRGIPNSISI  881



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+EPWWP+M +R  L+E  T IIW++SALHAAVNFGQY YAGY P
Sbjct  690  QSWWMEVRNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNFGQYPYAGYLP  749

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILSRHASDEIYLG
Sbjct  750  NRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHASDEIYLG  809

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE+PEWTSD     +F+RF  +L  +E+RI+  N+D +W+NR GPVKVPY LL+P    
Sbjct  810  QRENPEWTSDVEPRQSFQRFHDRLVDVENRIVERNNDSRWKNRNGPVKVPYMLLYPNASG  869

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  870  DNSESGLTGKGIPNSVSI  887



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKKNEPWWPKM +R+ LIE  T IIW++SALHA+ NFGQY YAG+ P
Sbjct  663  QSWWKELREEGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHASTNFGQYPYAGFLP  722

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY+EL  NPDK FL+TITAQ QTL+GISLIEILSRH+SDE++LG
Sbjct  723  NRPTISRRFMPEEGTSEYDELVNNPDKVFLKTITAQLQTLIGISLIEILSRHSSDELHLG  782

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P WT D   L+AF+ FGKKL  IE+RI+A+N+D K +NR GPV +PYTLLFP+S+ 
Sbjct  783  QRDTPNWTCDVEPLEAFDEFGKKLVEIEERIMALNNDGKHKNRVGPVNMPYTLLFPSSKA  842

Query  152  GLTGRGIPNSISI  114
            GLTG GIPNS++I
Sbjct  843  GLTGMGIPNSVAI  855



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKKNEPWWPKM +R+ LIE  T IIW++SALHA+ NFGQY YAG+ P
Sbjct  666  QSWWKELREEGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHASTNFGQYPYAGFLP  725

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY+EL  NPDK FL+TITAQ QTL+GISLIEILSRH+SDE++LG
Sbjct  726  NRPTISRRFMPEEGTSEYDELVNNPDKVFLKTITAQLQTLIGISLIEILSRHSSDELHLG  785

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ P WT D   L+AF+ FGKKL  IE+RI+A+N+D K +NR GPV +PYTLLFP+S+ 
Sbjct  786  QRDTPNWTCDVEPLEAFDEFGKKLVEIEERIMALNNDGKHKNRVGPVNMPYTLLFPSSKA  845

Query  152  GLTGRGIPNSISI  114
            GLTG GIPNS++I
Sbjct  846  GLTGMGIPNSVAI  858



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 156/196 (80%), Gaps = 5/196 (3%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WWTE    GH DKKNEPWWPKM +R  LIE+ T IIW++SALHAAVNFGQYSYAGY P R
Sbjct  684  WWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLPNR  743

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEILSRH++DE+YLGQ 
Sbjct  744  PTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLGQN  803

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS----  159
            + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV VPYTLL P +    
Sbjct  804  DTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSDKS  863

Query  158  -EGGLTGRGIPNSISI  114
             EGGLTG+GIPNS+SI
Sbjct  864  REGGLTGKGIPNSVSI  879



>ref|XP_004150981.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=303

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKKNE WWPK+ +   L+ET TTIIWISSALHAAVNFGQY Y G+ P
Sbjct  111  QSWWKEVREKGHVDKKNETWWPKLQNFNELVETCTTIIWISSALHAAVNFGQYPYGGFMP  170

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRR MPE G+ EY+EL++ P+KA+L+T+ +  QTLLG+SLIEILSRHASDE+YLG
Sbjct  171  NRPTISRRHMPEVGSAEYKELESKPEKAYLKTVNSMLQTLLGVSLIEILSRHASDEVYLG  230

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR   EWTSDK  L+ FE FGK++  +E RI+  N D   +NR GPV VPYTLL P+S  
Sbjct  231  QRASIEWTSDKAALEVFENFGKQVFEVESRIIERNKDVNLKNRNGPVNVPYTLLLPSSTE  290

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  291  GLTGRGIPNSISI  303



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score =   285 bits (729),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 156/196 (80%), Gaps = 5/196 (3%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WWTE    GH DKKNEPWWPKM +R  LIE+ T IIW++SALHAAVNFGQYSYAGY P R
Sbjct  684  WWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLPNR  743

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEILSRH++DE+YLGQ 
Sbjct  744  PTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLGQN  803

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS----  159
            + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV VPYTLL P +    
Sbjct  804  DTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSDKS  863

Query  158  -EGGLTGRGIPNSISI  114
             EGGLTG+GIPNS+SI
Sbjct  864  REGGLTGKGIPNSVSI  879



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WWTE    GH DKKNEPWWPKM +R  LIE+ T IIW++SALHAAVNFGQYSYAGY P
Sbjct  703  QNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLP  762

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEILSRH++DE+YLG
Sbjct  763  NRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLG  822

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV VPYTLL P +  
Sbjct  823  QNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSD  882

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  883  KSREGGLTGKGIPNSVSI  900



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WWTE    GH DKKNEPWWPKM +R  LIE+ T IIW++SALHAAVNFGQYSYAGY P
Sbjct  703  QNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLP  762

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEILSRH++DE+YLG
Sbjct  763  NRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLG  822

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV VPYTLL P +  
Sbjct  823  QNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSD  882

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  883  KSREGGLTGKGIPNSVSI  900



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH D K+EPWWP+M +R  L E  T IIW++SALHAAVNFGQY YAGY P
Sbjct  676  QSWWTEVRNEGHGDLKDEPWWPQMQTRAELAEACTIIIWVASALHAAVNFGQYPYAGYLP  735

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILSRH+SDEIYLG
Sbjct  736  NRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLG  795

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ PEWTSD     AF+RF  +L  +E+RI+  N+D +W NR GPVKVPY LL+P    
Sbjct  796  QRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVERNNDSRWMNRNGPVKVPYMLLYPNASG  855

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  856  DNSESGLTGKGIPNSVSI  873



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =   285 bits (728),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH D K+EPWWP+M +R  L E  T IIW++SALHAAVNFGQY YAGY P
Sbjct  686  QSWWTEVRNEGHGDLKDEPWWPQMQTRAELAEACTIIIWVASALHAAVNFGQYPYAGYLP  745

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILSRH+SDEIYLG
Sbjct  746  NRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLG  805

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ PEWTSD     AF+RF  +L  +E+RI+  N+D +W NR GPVKVPY LL+P    
Sbjct  806  QRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVERNNDSRWMNRNGPVKVPYMLLYPNASG  865

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  866  DNSESGLTGKGIPNSVSI  883



>ref|XP_009387658.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+E WWP M +   LIET TTI+WI SALHAA+NFGQY YAGY P
Sbjct  655  QAWWKEVREVGHGDKKDEHWWPAMQTTSELIETCTTIVWIGSALHAAINFGQYPYAGYLP  714

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEYEELK NPDK FL+TIT+Q  T+LG++ IEILS HASDE+YLG
Sbjct  715  NRPTMSRRFMPEPGTPEYEELKKNPDKVFLKTITSQLLTMLGLNTIEILSNHASDEVYLG  774

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWTSD+  + AFERFG++L AIE  I+  N D   +NR GPVK+PYTLLFP+S  
Sbjct  775  QRDTPEWTSDERAVKAFERFGQRLKAIEAEIMKRNGDPSLKNRNGPVKMPYTLLFPSSGV  834

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNSISI
Sbjct  835  GVTGRGIPNSISI  847



>ref|XP_004170689.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like, partial 
[Cucumis sativus]
Length=372

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKKNE WWPK+ + + L+ET TTIIWISSALHAAVNFGQY Y G+ P
Sbjct  180  QSWWKEVREKGHVDKKNETWWPKLQNFKELVETCTTIIWISSALHAAVNFGQYPYGGFMP  239

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRR MPE G+ EY+EL++ P+KA+L+T+ +  QTLLG+SLIEILSRHASDE+YLG
Sbjct  240  NRPTISRRLMPEVGSAEYKELESKPEKAYLKTVNSMLQTLLGVSLIEILSRHASDEVYLG  299

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR   EWTSDK  ++ FE FGKK+  +E RI+  N D   +NR+GPV VPYTLL P+S  
Sbjct  300  QRASIEWTSDKAAVEVFENFGKKVFEVESRIIERNKDVNLKNRSGPVNVPYTLLLPSSTE  359

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  360  GLTGRGIPNSISI  372



>ref|XP_004231274.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=841

 Score =   283 bits (725),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM + + L ++ T IIWI+SALHAA+NFGQY Y GY P
Sbjct  649  QAWWKELQEEGHGDKKDEPWWPKMQTLKELTDSCTIIIWIASALHAAINFGQYPYGGYLP  708

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRR MPEPG+PEYEELK NP+K +L TIT Q QTL+GIS IEILS H+SDEIYLG
Sbjct  709  NRPSMSRRLMPEPGSPEYEELKRNPEKVYLRTITPQLQTLIGISAIEILSTHSSDEIYLG  768

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+DK  L A ERFGKKLA I ++I+ MN+D+KW+NR GP K+PYTLL+  SE 
Sbjct  769  QRDTPEWTNDKAPLQALERFGKKLAEIAEKIIKMNNDKKWKNRMGPTKMPYTLLYHISEP  828

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  829  GLTGKGIPNSVSI  841



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH DKK EPWWPKM +R+ LIE+ T IIWI+SALHAA+NFGQY Y GY P
Sbjct  678  QSWWKEIREVGHGDKKEEPWWPKMHTREELIESCTIIIWIASALHAAINFGQYPYGGYLP  737

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRRF+PE  TPEYEELK+NP+KAFL+TITAQ QT+LGISLIEILSRHASDE+YLG
Sbjct  738  NRPSISRRFLPEKDTPEYEELKSNPEKAFLKTITAQLQTVLGISLIEILSRHASDEVYLG  797

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D+  L+AF++FGKKL  IE+ I+ MN D + +NR GPV + YTLL P+SE 
Sbjct  798  QRDTPEWTTDEKPLEAFKQFGKKLEKIEEGIIEMNKDVQLKNRVGPVLMTYTLLVPSSEV  857

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  858  GLTGRGIPNSVSI  870



>gb|AGH13205.1| lipoxygenase [Salvia miltiorrhiza]
Length=856

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWWTE  +KGH DKK+EPWWP M S + LIE+ TTIIW++SALHAA+NFGQY Y GY P
Sbjct  664  QAWWTEIREKGHGDKKDEPWWPTMQSCEELIESCTTIIWVASALHAALNFGQYPYGGYLP  723

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP  SRRF+P+ GTP YEE+K NP+KA+L+TIT Q Q +LGISL+EILSRH+SDEIYLG
Sbjct  724  NRPATSRRFIPDIGTPAYEEMKLNPEKAYLKTITPQMQGVLGISLVEILSRHSSDEIYLG  783

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D     AFERFG +L   E + + +N+D++WRNR+GPVK+PYTLL+P+SE 
Sbjct  784  QRDSPEWTADTEARKAFERFGDRLRETEQKFIDLNNDKRWRNRSGPVKMPYTLLYPSSEI  843

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  844  GLTGRGIPNSISI  856



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 159/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            +    +AWW E  ++GH DKK+EPWWPKM +RQ LIE+ T  IWI+SALHAAVNFGQY Y
Sbjct  666  KDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPY  725

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY   RP+LSR FMPEPG+PEYEELK NPDK FL+T     QTLL IS++E+LS HASD
Sbjct  726  AGYLVNRPSLSRMFMPEPGSPEYEELKKNPDKVFLKTTVPPLQTLLEISVLEVLSTHASD  785

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPVKVPYTLL  171
             +YLGQR+ PEWT D+  + AFER GKKL+ IED+I+ MN D QKW+NR+GP KVPYTLL
Sbjct  786  TLYLGQRDSPEWTKDQEPILAFERVGKKLSDIEDQIMQMNSDHQKWKNRSGPAKVPYTLL  845

Query  170  FPTSEGGLTGRGIPNSISI  114
            FPTSE GLTG+GIPNSI+I
Sbjct  846  FPTSEEGLTGKGIPNSINI  864



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH DKK+EPWWP+M +R  L +T T IIWI+SALHAAVNFGQY YAGY P
Sbjct  671  QSWWAEIRNEGHGDKKDEPWWPEMQTRADLTQTCTIIIWIASALHAAVNFGQYPYAGYLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL+ +P+ AFL+TITAQ QTLLG+SLIEILSRH +DE+YLG
Sbjct  731  NRPTVSRRFMPEPGTPEYTELEKDPNLAFLKTITAQLQTLLGVSLIEILSRHPTDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+  EWTSD+  L AFERF ++L  IE++I+ MN D K++NR GPVKVPYTLLFP +  
Sbjct  791  QRDTAEWTSDREPLAAFERFSERLKEIENKIMDMNSDNKYKNRIGPVKVPYTLLFPNTSD  850

Query  158  ---EGGLTGRGIPNSISI  114
               +GGLTG+GIPNSISI
Sbjct  851  ESRQGGLTGKGIPNSISI  868



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW+E    GH DKK+EPWWPKM +   L +T T IIW++SALHAAVNFGQY YAGY P
Sbjct  686  QSWWSELRNVGHGDKKDEPWWPKMQTLSELTQTCTIIIWVASALHAAVNFGQYPYAGYLP  745

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD  +L TITAQ QTLLG+SLIEILSRH+SDE+YLG
Sbjct  746  NRPTISRRFMPEPGTPEYAELESNPDTFYLRTITAQLQTLLGVSLIEILSRHSSDEVYLG  805

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QR+ PEWT+D   L+AFERF +KL  IE+RI  MN D++ +NR GPVKVPYTLLFP +  
Sbjct  806  QRDTPEWTTDAAPLEAFERFREKLVEIENRIREMNLDKRLKNRVGPVKVPYTLLFPDTSN  865

Query  155  ----GGLTGRGIPNSISI  114
                GGLTGRGIPNSISI
Sbjct  866  VYGVGGLTGRGIPNSISI  883



>ref|XP_009415714.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+E WWP M +   LIET T IIWI SALHAA+NFGQY YAGY P
Sbjct  655  QAWWKEVREVGHGDKKDEHWWPAMHTTSELIETCTIIIWIGSALHAAINFGQYPYAGYLP  714

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEYEELK NPDK FL+TIT+Q  T+LG++ IEILS HASDE+YLG
Sbjct  715  NRPTMSRRFMPEPGTPEYEELKKNPDKVFLKTITSQLLTVLGLNTIEILSNHASDEVYLG  774

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWTSD   + AFERFGK+L AIE  I+  N+D + +NR GPVK+PYTLLFP+S  
Sbjct  775  QRDTPEWTSDDRAVKAFERFGKRLKAIEAEIMKKNEDPRLKNRNGPVKMPYTLLFPSSGV  834

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNSISI
Sbjct  835  GITGKGIPNSISI  847



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWP+M S   LIET T IIWISSALHAAVNFGQY Y G+ P
Sbjct  672  QSWWKELREKGHADKKDEPWWPRMDSLHDLIETCTIIIWISSALHAAVNFGQYPYGGFAP  731

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+PE GTP+Y+EL++NP+KAFL TIT+Q Q L+G+S+IEILSRH+SDE+YLG
Sbjct  732  NRPSTSRRFLPESGTPDYKELESNPEKAFLRTITSQLQALVGVSVIEILSRHSSDEVYLG  791

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR +PEWT DK  L+AFE+FG+KL  IE +I   N D + +NR GPV +PYTLLFPTS  
Sbjct  792  QRSNPEWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDPQLKNRVGPVDMPYTLLFPTSSE  851

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  852  GLTGRGIPNSISI  864



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWP+M S   LIET T IIWISSALHAAVNFGQY Y G+ P
Sbjct  672  QSWWKELREKGHADKKDEPWWPRMDSLHDLIETCTIIIWISSALHAAVNFGQYPYGGFAP  731

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+PE GTP+Y+EL++NP+KAFL TIT+Q Q L+G+S+IEILSRH+SDE+YLG
Sbjct  732  NRPSTSRRFLPESGTPDYKELESNPEKAFLRTITSQLQALVGVSVIEILSRHSSDEVYLG  791

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR +PEWT DK  L+AFE+FG+KL  IE +I   N D + +NR GPV +PYTLLFPTS  
Sbjct  792  QRSNPEWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDPQLKNRVGPVDMPYTLLFPTSSE  851

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  852  GLTGRGIPNSISI  864



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+E WWP++ +   LIET TTIIW++SALHAAVNFGQY YAGY+P
Sbjct  669  QSWWKEIREKGHGDKKDEKWWPELKTFDELIETCTTIIWVASALHAAVNFGQYPYAGYHP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRR MPEP TPEYEEL+ NPD  FL TI+++ Q++LGISLIE+LSRH +DE+YLG
Sbjct  729  NRPTISRRLMPEPNTPEYEELEKNPDTIFLRTISSKLQSVLGISLIELLSRHPTDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QRE  EWT+D   L+AFERFGKK+  IED+I+  N D +W+NR GPVK+PYTLL+P+SE 
Sbjct  789  QRETREWTADSAPLEAFERFGKKVEEIEDKIVERNKDGRWKNRVGPVKLPYTLLYPSSEA  848

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS S+
Sbjct  849  GLTGRGIPNSTSV  861



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH D K+EPWWPKM +R+ LI++ T I+W++SALHAAVNFGQY Y GY P
Sbjct  771  QSWWKEVREKGHGDMKDEPWWPKMQTRKELIDSCTIIVWVASALHAAVNFGQYPYGGYLP  830

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SR F+P+ GTPEY+ELKT+P+KAFL+TIT+Q Q++LGISLIEILSRH++DE+YLG
Sbjct  831  NRPSTSRHFIPDKGTPEYDELKTDPEKAFLKTITSQLQSVLGISLIEILSRHSADEVYLG  890

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D   + AFE FG++L  IE+RI+ MN D +W+NR+GPVK+PYTLL P+S+ 
Sbjct  891  QRDSPEWTTDTEAIKAFEMFGERLVQIENRIIEMNKDGRWKNRSGPVKMPYTLLCPSSDI  950

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSIS+
Sbjct  951  GLTGRGIPNSISM  963



>gb|KHF98567.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=832

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH D K+EPWWP+M +R  LI+  T IIWI+SALHAAVNFGQY YAGY P
Sbjct  635  QSWWTEIRNEGHGDLKHEPWWPEMKTRAELIQACTIIIWIASALHAAVNFGQYPYAGYLP  694

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+ +PD AFL+TIT QFQTLLG+SLIEILSRH +DEIYLG
Sbjct  695  NRPTVSRRFMPEPGTDEYTELEKDPDLAFLKTITPQFQTLLGVSLIEILSRHTTDEIYLG  754

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AFERFGKKL  IE  +   N+D + +NR GPVKVPYTLLFP +  
Sbjct  755  QRDTPEWTSDNEPLAAFERFGKKLVEIEKTVTERNNDGRLKNRIGPVKVPYTLLFPNTSD  814

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  815  YSKEGGLTGKGIPNSISI  832



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 156/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WWTE    GH DKKNEPWWPKM +R  LIE+ T IIW++SALH AVNFGQYSYAGY P
Sbjct  703  QNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHEAVNFGQYSYAGYLP  762

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEILSRH++DE+YLG
Sbjct  763  NRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLG  822

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV VPYTLL P +  
Sbjct  823  QNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSD  882

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  883  KSREGGLTGKGIPNSVSI  900



>ref|XP_006589595.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Glycine 
max]
Length=448

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+  WWP+M +++ LI++ T IIW++SA HAAVNFGQY +AGY P
Sbjct  251  QSWWKEVRNEGHGDLKDRHWWPEMKTKEELIQSCTIIIWLASAFHAAVNFGQYPFAGYLP  310

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEYEELK++PD AFL+TITAQFQTLLG+SLIE+LSRH+++E+YLG
Sbjct  311  NRPTVSRRFMPEPGTPEYEELKSDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTEEVYLG  370

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q E+PEWT D   L AFERF +KL  IE  I+  N D++ +NR GPVK+PYTLLFP +  
Sbjct  371  QCENPEWTLDAEPLAAFERFRQKLLEIESNIIERNKDKRLKNRNGPVKMPYTLLFPNTSD  430

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  431  YSREGGLTGKGIPNSISI  448



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            + +  ++WW E  ++GH DKK+EPWWPKM + + LIE+ T IIWI+SALHAAVNFGQY Y
Sbjct  666  KDEELQSWWKELREEGHGDKKDEPWWPKMQTLEELIESCTIIIWIASALHAAVNFGQYPY  725

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPT+SRRFMPE GT EY+EL +NPDK FL+TITAQ QTL+GISLIEILS H+SD
Sbjct  726  AGYLPNRPTISRRFMPEIGTAEYDELVSNPDKVFLKTITAQLQTLIGISLIEILSTHSSD  785

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+   WT D   L+AFERFGKKL  IE +I+AMNDD + +NR G VK+PYTLL+
Sbjct  786  EVYLGQRDTVHWTYDAEPLEAFERFGKKLREIEGKIVAMNDDVRLKNRVGVVKMPYTLLY  845

Query  167  PTSEGGLTGRGIPNSISI  114
            PT E GL G GIPNS+SI
Sbjct  846  PTGESGLAGTGIPNSVSI  863



>gb|KHF98566.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=845

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH D K+EPWWP+M +R  LI+  T IIWI+SALHAAVNFGQY YAGY P
Sbjct  648  QSWWTEIRNEGHGDLKHEPWWPEMKTRAELIQACTIIIWIASALHAAVNFGQYPYAGYLP  707

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+ +PD AFL+TIT QFQTLLG+SLIEILSRH +DEIYLG
Sbjct  708  NRPTVSRRFMPEPGTDEYTELEKDPDLAFLKTITPQFQTLLGVSLIEILSRHTTDEIYLG  767

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AFERFGKKL  IE  +   N+D + +NR GPVKVPYTLLFP +  
Sbjct  768  QRDTPEWTSDNEPLAAFERFGKKLVEIEKTVTERNNDGRLKNRIGPVKVPYTLLFPNTSD  827

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  828  YSKEGGLTGKGIPNSISI  845



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =   282 bits (722),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ L E+ T IIW++SALHAAVNFGQY  AGY P
Sbjct  664  QAWWKEVREEGHGDKKSEPWWPKMQTREELTESCTIIIWVASALHAAVNFGQYPIAGYLP  723

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  724  NRPTISRQFMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  783

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW ++K  L+AFE+FG+K+  IE +I   N+D+  +NRTGPVK+PYT LFPTSEG
Sbjct  784  QRDSKEWAAEKEALEAFEKFGEKVKEIEKKIDERNEDENLKNRTGPVKMPYTSLFPTSEG  843

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNS+SI
Sbjct  844  GVTGRGIPNSVSI  856



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score =   282 bits (722),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DK +EPWWPKM +R+ LIE+ T IIW++SALHAAVNFGQY  AGY P
Sbjct  667  QAWWKEVREEGHGDKNSEPWWPKMQNREELIESCTIIIWVASALHAAVNFGQYPIAGYLP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+F+P+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  727  NRPTISRQFIPKQNTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW ++K  LDAFE+FG+K+  IE  I   NDD+  +NRTG VK+PYTLLFPTSEG
Sbjct  787  QRDSKEWAAEKEALDAFEKFGEKVKEIEKNIDERNDDKSLKNRTGLVKMPYTLLFPTSEG  846

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNS+SI
Sbjct  847  GVTGRGIPNSVSI  859



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   282 bits (721),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK E WWP M + + L +T +TIIW++SALHAAVNFGQY YAGY P
Sbjct  669  QAWWKEVREVGHGDKKKETWWPNMRTFRELTKTCSTIIWVASALHAAVNFGQYPYAGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTP YEEL+ NP+  FL+TIT+QFQT+LG+SLIEILSRH+SDE+YLG
Sbjct  729  NRPTISRRFMPEPGTPAYEELEKNPEGVFLKTITSQFQTILGVSLIEILSRHSSDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QR+ PEWT+D+  LDAF+RFG  L  IE RIL MN+D + +NR GPVK+PYTLL+P +  
Sbjct  789  QRDTPEWTTDRKALDAFKRFGDNLVEIEKRILTMNEDTRIKNRNGPVKMPYTLLYPNTSD  848

Query  155  ----GGLTGRGIPNSISI  114
                GGLTG+GIPNS+SI
Sbjct  849  FSRVGGLTGKGIPNSVSI  866



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   282 bits (721),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWP+M S Q L+ET T IIWISSALHAAVNFGQY Y G+ P
Sbjct  671  QSWWKELREKGHADKKDEPWWPRMDSLQDLVETCTIIIWISSALHAAVNFGQYPYGGFAP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRF+PE GT +Y+EL++NP+KAFL TIT+Q Q L+G+S+IEILSRH+SDE+YLG
Sbjct  731  NRPSTSRRFLPESGTSDYKELESNPEKAFLRTITSQLQVLVGVSVIEILSRHSSDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR +PEWT DK  L+AFE+FG+KL  IE +I   N D + +NR GPV +PYTLLFPTS  
Sbjct  791  QRSNPEWTLDKEALEAFEKFGEKLGEIERKIAMRNKDPQLKNRVGPVDMPYTLLFPTSSE  850

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  851  GLTGRGIPNSISI  863



>ref|XP_008465603.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Cucumis 
melo]
Length=341

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 152/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKKNE WWPK+ +   L+ET TTIIWISSALHAAVNFGQY Y G+ P
Sbjct  149  QSWWKEVREKGHADKKNETWWPKLQNFNELVETCTTIIWISSALHAAVNFGQYPYGGFIP  208

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRR MPE G+ EY+EL++ P+KA+L+ I +  QTLLG+SLIEILSRHASDE+YLG
Sbjct  209  NRPTISRRHMPEVGSVEYKELESKPEKAYLKIINSMLQTLLGVSLIEILSRHASDEVYLG  268

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR   EWTSDK  ++ FE FGK+++ +E RI+  N D   +NR+GPV VPYTLL P+S  
Sbjct  269  QRASIEWTSDKAAVELFEYFGKEVSEVESRIIERNKDVNLKNRSGPVNVPYTLLLPSSSE  328

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  329  GLTGRGIPNSISI  341



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  + GH D+K+ PWWPKM +R+ LIE+ T IIW+ SALHAAVNFGQY Y GY P
Sbjct  669  QSWWKEVREVGHGDQKDAPWWPKMRTREELIESCTIIIWVGSALHAAVNFGQYPYGGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+ SRRFMP+  +P+YEELK+NPDK FLETITAQ QTLLGISLIEILSRH+SDE+YLG
Sbjct  729  NRPSTSRRFMPQKDSPQYEELKSNPDKFFLETITAQLQTLLGISLIEILSRHSSDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT+DK   +AF++FG+KLA IEDRIL MN + +++NR GPVKV YTLL PTS  
Sbjct  789  QRDILEWTADKEPTEAFKKFGRKLAVIEDRILDMNREARYKNRVGPVKVSYTLLVPTSGP  848

Query  152  GLTGRGIPNSISI  114
            GLT RGIPNS+SI
Sbjct  849  GLTARGIPNSVSI  861



>ref|XP_009387657.1| PREDICTED: linoleate 9S-lipoxygenase A-like [Musa acuminata subsp. 
malaccensis]
Length=861

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+EPWWP M +   LIE  TTIIWI SALHAA+NFGQY YAGY P
Sbjct  669  QAWWKEVREVGHGDKKDEPWWPAMLTTSELIEACTTIIWIGSALHAAINFGQYPYAGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEYEELK NPDK FL+TIT+Q  T+LG+S IEILS HASDE+YLG
Sbjct  729  NRPTMSRRFMPEPGTPEYEELKKNPDKVFLKTITSQLLTVLGLSTIEILSNHASDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWTSD+  + AFE FG++L AIE  I+  N D   +NR GP K+PYTLLFP+S  
Sbjct  789  QRDTPEWTSDETAVKAFEGFGERLKAIEAEIMKRNGDPSLKNRNGPAKMPYTLLFPSSGV  848

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNSISI
Sbjct  849  GITGRGIPNSISI  861



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ L+E+ T IIW++SALHAAVNFGQY  AGY P
Sbjct  665  QAWWKEVREEGHGDKKSEPWWPKMQTREELVESCTIIIWVASALHAAVNFGQYPVAGYLP  724

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  725  NRPTISRQFMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  784

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW ++K  L+AF +FG+K+  IE  I   NDD+  +NRTG VK+PYTLLFPTSEG
Sbjct  785  QRDSKEWAAEKEALEAFAKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPTSEG  844

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNS+SI
Sbjct  845  GVTGRGIPNSVSI  857



>ref|XP_008449553.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=881

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH D K+EPWWPKM +R+ L+++ T IIWI+SALHAAVNFGQY YAGY P
Sbjct  684  QSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAVNFGQYPYAGYLP  743

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE LSRH+ DEIYLG
Sbjct  744  NRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIESLSRHSVDEIYLG  803

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK+PYT LFP +  
Sbjct  804  QRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVKMPYTFLFPNTSN  863

Query  158  ---EGGLTGRGIPNSISI  114
               E GL  RGIPNSISI
Sbjct  864  YYEEEGLNARGIPNSISI  881



>gb|AHI86055.1| lipoxygenase, partial [Cucumis melo var. makuwa]
Length=880

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH D K+EPWWPKM +R+ L+++ T IIWI+SALHAAVNFGQY YAGY P
Sbjct  683  QSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAVNFGQYPYAGYLP  742

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE LSRH+ DEIYLG
Sbjct  743  NRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIESLSRHSVDEIYLG  802

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK+PYT LFP +  
Sbjct  803  QRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVKMPYTFLFPNTSN  862

Query  158  ---EGGLTGRGIPNSISI  114
               E GL  RGIPNSISI
Sbjct  863  YYEEEGLNARGIPNSISI  880



>ref|NP_001267584.1| probable linoleate 9S-lipoxygenase 5-like [Cucumis sativus]
 emb|CAB83038.1| lipoxygenase-9 [Cucumis sativus]
Length=881

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE    GH D K+EPWWPKM +R+ L+++ T IIWI+SALHAAVNFGQY YAGY P
Sbjct  684  QSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAVNFGQYPYAGYLP  743

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE LSRH+ DEIYLG
Sbjct  744  NRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIESLSRHSVDEIYLG  803

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK+PYT LFP +  
Sbjct  804  QRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVKMPYTFLFPNTSN  863

Query  158  ---EGGLTGRGIPNSISI  114
               E GL  RGIPNSISI
Sbjct  864  YYEEEGLNARGIPNSISI  881



>gb|AHX56188.1| lipoxygenase [Diospyros kaki]
Length=876

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WW E   +GH DKK+E WWP+M  R  LI+T T IIW++SALHAAVNFGQY YAGY P
Sbjct  679  QLWWIELRNEGHGDKKDEAWWPEMQGRAQLIQTCTIIIWVASALHAAVNFGQYPYAGYLP  738

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL++NP+ AFL+TITAQFQTLLG+SLIEILSRHA+DEIYLG
Sbjct  739  NRPTISRRFMPEPGTREYAELESNPESAFLKTITAQFQTLLGVSLIEILSRHATDEIYLG  798

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QRE P+WTSD   L+AFERF  +L  IE RI+  N+D++W+NR GPVKVPYTLL+P++  
Sbjct  799  QRESPDWTSDAQPLEAFERFRMQLVQIEHRIVQRNNDKRWKNRFGPVKVPYTLLYPSTSD  858

Query  155  ----GGLTGRGIPNSISI  114
                 GL+G GIPNS+SI
Sbjct  859  SIRASGLSGMGIPNSVSI  876



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW+E   +GH D +NEPWWP+M +   L +  T IIWI+SA HAAVNFGQY YAGY P
Sbjct  676  QSWWSEVKNEGHGDLRNEPWWPEMNTLADLTQACTIIIWIASAFHAAVNFGQYPYAGYLP  735

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY+EL+ +PD AFL+TITAQFQTLLG+SLIE+LSRH++DEIYLG
Sbjct  736  NRPTVSRRFMPEPGTKEYDELENDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTDEIYLG  795

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+  EWT+D   L AFERFGKKL  IE RI+  N+D K +NR GPVKVPYTLL+P +  
Sbjct  796  QRDTAEWTTDDEPLAAFERFGKKLLEIESRIMERNNDSKLKNRVGPVKVPYTLLYPNTSD  855

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  856  YSREGGLTGKGIPNSISI  873



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ L+E+ T IIW++SALHAAVNFGQY  AGY P
Sbjct  667  QAWWKEVREEGHGDKKSEPWWPKMQTREELVESCTIIIWVASALHAAVNFGQYPVAGYLP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR++MP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  727  NRPTISRQYMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW ++K  L+AFE+FG+K+  IE  I   NDD+  +NRTG VK+PYTLLFP+SEG
Sbjct  787  QRDSKEWAAEKEALEAFEKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPSSEG  846

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNS+SI
Sbjct  847  GVTGRGIPNSVSI  859



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E    GH DKK+EPWWPKM S   L +T T IIW++SALHAAVNFGQY YAGY P
Sbjct  654  QAWWKEVRDVGHGDKKDEPWWPKMDSLSELTKTCTIIIWVASALHAAVNFGQYPYAGYLP  713

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEP TPEY+ELK NPD+ FL TIT+Q QT+LG+SLIEILSRH+SDE+YLG
Sbjct  714  NRPTISRRFMPEPNTPEYDELKRNPDQVFLSTITSQLQTILGVSLIEILSRHSSDEVYLG  773

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QR+  EWT+D+  L+AF++FG KL  IE++I+ MN D+  +NR GPVKV YTLL+P +  
Sbjct  774  QRDTHEWTADEKALEAFKKFGDKLVEIENKIVDMNQDKSLKNRNGPVKVSYTLLYPNTSD  833

Query  155  ----GGLTGRGIPNSISI  114
                GGLTGRGIPNS+SI
Sbjct  834  LSHVGGLTGRGIPNSVSI  851



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 156/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WWTE    GH DKKNEPWWPKM +R  LIE+ T IIW++SALHAAVNFGQYSYAGY P
Sbjct  697  QNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLP  756

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEILSRH++DE+YLG
Sbjct  757  NRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLG  816

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q + PEWTSD   L AF RF +KL  IE RI A N D + +NR GPV VPYTLL P +  
Sbjct  817  QNDTPEWTSDAEALIAFARFREKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSD  876

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNS+SI
Sbjct  877  KSREGGLTGKGIPNSVSI  894



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE  + GH D ++EPWWP M +R  LI   T IIWI+SALHAAVNFGQY YAGY P
Sbjct  673  QSWWTELREVGHGDLRDEPWWPNMQTRAELIHACTIIIWIASALHAAVNFGQYPYAGYLP  732

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMP+PGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILSRH++DEIYLG
Sbjct  733  NRPTVSRRFMPKPGTPEYAELESNPDSAFLKTITAQFQTLLGVSLIEILSRHSTDEIYLG  792

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q+E P+WT+D H  +AFERF   L  IE RI   N D + RNR+GPVK+PY LL+P +  
Sbjct  793  QQESPDWTADAHPREAFERFSAALVEIESRITDRNKDGRLRNRSGPVKMPYMLLYPNTSD  852

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  853  NSKEGGLTGKGIPNSISI  870



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ LI++ T IIW++SALHAAVNFGQY  AGY P
Sbjct  665  QAWWKEVREEGHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAVNFGQYPIAGYLP  724

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  725  NRPTISRQFMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  784

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK+PYT LFPTSEG
Sbjct  785  QRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVKMPYTSLFPTSEG  844

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNS+SI
Sbjct  845  GVTGRGIPNSVSI  857



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE  + GH D ++EPWWP M +R  LI   T IIWI+SALHAAVNFGQY YAGY P
Sbjct  684  QSWWTELREVGHGDLRDEPWWPNMQTRAELIHACTIIIWIASALHAAVNFGQYPYAGYLP  743

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMP+PGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILSRH++DEIYLG
Sbjct  744  NRPTVSRRFMPKPGTPEYAELESNPDSAFLKTITAQFQTLLGVSLIEILSRHSTDEIYLG  803

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q+E P+WT+D H  +AFERF   L  IE RI   N D + RNR+GPVK+PY LL+P +  
Sbjct  804  QQESPDWTADAHPREAFERFSAALVEIESRITDRNKDGRLRNRSGPVKMPYMLLYPNTSD  863

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  864  NSKEGGLTGKGIPNSISI  881



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            R    +AWW E  ++GH DKK+EPWWPKM +R+ L+E+ T IIW++SALHAAVNFGQY  
Sbjct  663  RDTELQAWWKEVREEGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAVNFGQYPI  722

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPT+SR+FMP+  TPE+ EL+ NPDK F +TITAQ QTLLGISLIEILS H+SD
Sbjct  723  AGYLPNRPTISRQFMPKENTPEFAELEKNPDKVFFKTITAQLQTLLGISLIEILSTHSSD  782

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+  EW ++K  LDAFE+FG+K+  IE  +   NDD   +NRTG VK+PYTLLF
Sbjct  783  EVYLGQRDSKEWAAEKEALDAFEKFGEKVKEIEKNMDERNDDVNLKNRTGLVKMPYTLLF  842

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG+TGRGIPNS+SI
Sbjct  843  PTSEGGVTGRGIPNSVSI  860



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WW E  ++GH DKK+E WWPKM +R+ LI++ T IIWI+SALHA+VNFGQY  AGY P
Sbjct  667  QTWWKEIREEGHGDKKSELWWPKMQTRKELIDSCTIIIWIASALHASVNFGQYPIAGYMP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMPE GT E+EEL+ NPDK FL TITAQ QTLLGIS+IEILSRH+SDE+YLG
Sbjct  727  NRPTISRQFMPEKGTREFEELEKNPDKVFLRTITAQIQTLLGISIIEILSRHSSDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT++   L+AF RFG++LA IE +I+  NDD   +NR GPVK+PYTL+FPTSEG
Sbjct  787  QRDSNEWTTENEALEAFSRFGERLAEIERKIVERNDDVSLKNRNGPVKMPYTLMFPTSEG  846

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  847  GITGKGIPNSVSI  859



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW+E   +GH D + EPWWP+M +   L +  T IIWI+SA HAAVNFGQY YAGY P
Sbjct  672  QSWWSEVKNEGHGDLRKEPWWPEMNTLADLTQACTIIIWIASAFHAAVNFGQYPYAGYLP  731

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY+EL+ +PD AFL+TITAQFQTLLG+SLIE+LSRH++DEIYLG
Sbjct  732  NRPTVSRRFMPEPGTKEYDELENDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTDEIYLG  791

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+  EWT+D   L AFERFGKKL  IE RI+  N+D K +NR GPVKVPYTLL+P++  
Sbjct  792  QRDTAEWTTDDEPLAAFERFGKKLVEIESRIMERNNDSKLKNRVGPVKVPYTLLYPSTSD  851

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  852  YSREGGLTGKGIPNSISI  869



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            R    +AWW E  ++GH DKK+EPWWPKM +R+ L+E+ T IIW++SALHAAVNFGQY  
Sbjct  663  RDSELQAWWKEVREEGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAVNFGQYPI  722

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPT+SR+FMP+  TPE+ +L+ NPDK F +TITAQ QTLLGISLIEILS H+SD
Sbjct  723  AGYLPNRPTISRQFMPKENTPEFAQLEKNPDKVFFKTITAQLQTLLGISLIEILSTHSSD  782

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+  EW ++K  LDAFE+FG+K+  IE  +   NDD   +NRTG VK+PYTLLF
Sbjct  783  EVYLGQRDSKEWAAEKEALDAFEKFGEKVKEIEKNMDERNDDVNLKNRTGLVKMPYTLLF  842

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG+TGRGIPNS+SI
Sbjct  843  PTSEGGVTGRGIPNSVSI  860



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score =   280 bits (715),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WW E   +GH DKK EPWWP+M +R  LI++ T IIW++SALHAAVNFGQ+ YAGY P
Sbjct  687  QKWWEELRNEGHGDKKAEPWWPEMHTRAELIQSCTIIIWVASALHAAVNFGQWPYAGYLP  746

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+TNPD AFL+TIT+Q QTLLG+SLIE+LSRHA+DEIYLG
Sbjct  747  NRPTISRRFMPEPGTAEYAELETNPDVAFLKTITSQLQTLLGVSLIEVLSRHATDEIYLG  806

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AF RFG+KL  IE RI   N D++ +NR GP+K+PYTLL+P++  
Sbjct  807  QRDTPEWTSDGEALAAFGRFGEKLIEIEKRITERNRDERLKNRVGPIKMPYTLLYPSTSD  866

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  867  YSREGGLTGKGIPNSISI  884



>ref|XP_009418148.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=855

 Score =   279 bits (714),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  + GH DKK+E WWP+M +   L +  TTIIW++SALHAA+NFGQY YAGY P
Sbjct  663  QAWWKEVREVGHGDKKDEAWWPQMQTVSELTQACTTIIWVASALHAALNFGQYPYAGYLP  722

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMP PGTPEYEELK +PDKAFL TIT+Q QT+LG+SLIEILS H+SDE+YLG
Sbjct  723  NRPTISRRFMPAPGTPEYEELKAHPDKAFLMTITSQLQTILGVSLIEILSMHSSDEVYLG  782

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D+  L AF RFG  L  IED I+  N D+  +NR G  +VPYTLLFPTSE 
Sbjct  783  QRDTPEWTTDQRALVAFNRFGSTLKRIEDEIIGRNGDESLKNRNGAAQVPYTLLFPTSER  842

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  843  GLTGKGIPNSVSI  855



>ref|XP_008340970.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Malus 
domestica]
Length=850

 Score =   279 bits (713),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 154/196 (79%), Gaps = 5/196 (3%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WWTE    GH DKKNEPWWPKM +R  LIE+ T IIW++SALHAAVNFGQYSYAGY P R
Sbjct  655  WWTELRNVGHGDKKNEPWWPKMQTRDELIESCTIIIWVASALHAAVNFGQYSYAGYLPNR  714

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SRRFMPE GT EY EL++NPD AFL+TITAQ QTLLG+SLIE+LSRH++DE+YLGQ 
Sbjct  715  PTVSRRFMPEAGTAEYAELESNPDAAFLKTITAQLQTLLGVSLIEVLSRHSTDEVYLGQN  774

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS----  159
            + PEWTSD   L AF RFG+KL  IE  I   N D + +NR GPV +PYTLL+P +    
Sbjct  775  DTPEWTSDAEALAAFARFGEKLMDIEKGINERNKDMRLKNRVGPVDMPYTLLYPNTSDTS  834

Query  158  -EGGLTGRGIPNSISI  114
             EGGLTG+GIPNS+SI
Sbjct  835  REGGLTGKGIPNSVSI  850



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score =   280 bits (715),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW+E   +GH D + EPWWP+M +   L +  T IIWI+SA HAAVNFGQY YAGY P
Sbjct  703  QSWWSEVKNEGHGDLRKEPWWPEMNTLADLTQACTIIIWIASAFHAAVNFGQYPYAGYLP  762

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY+EL+ +PD AFL+TITAQFQTLLG+SLIE+LSRH++DEIYLG
Sbjct  763  NRPTVSRRFMPEPGTKEYDELENDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTDEIYLG  822

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+  EWT+D   L AFERFGKKL  IE RI+  N+D K +NR GPVKVPYTLL+P++  
Sbjct  823  QRDTAEWTTDDEPLAAFERFGKKLVEIESRIMERNNDSKLKNRVGPVKVPYTLLYPSTSD  882

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  883  YSREGGLTGKGIPNSISI  900



>ref|XP_004496744.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496745.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496746.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=858

 Score =   278 bits (712),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WW E   +GH D K++ WWP+M +R  LI++ T IIW++SA HAAVNFGQY YAGY P
Sbjct  661  QCWWKEVRTEGHGDLKDKSWWPQMKTRVELIQSCTIIIWVASAFHAAVNFGQYPYAGYLP  720

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEYEELKT+P+ AFL+TITAQFQTLLG+SLIE+LSRH+++EIYLG
Sbjct  721  NRPTVSRRFMPEPGTPEYEELKTDPELAFLKTITAQFQTLLGVSLIEVLSRHSTEEIYLG  780

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QRE+P+WT D   L AFERF +KL  IED I+  N D   +NR GPVK+PYTLLFP +  
Sbjct  781  QRENPDWTLDAEPLAAFERFSQKLLKIEDNIMKRNKDPSLKNRNGPVKLPYTLLFPNTSD  840

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  841  YSREGGLTGKGIPNSISI  858



>gb|AEZ50136.1| lipoxygenase [Diospyros kaki]
Length=901

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WW E  +KGH DKK+EPWWP+M +R+ L+ET T IIW++SALHAA+NFGQY Y GY P
Sbjct  709  QTWWKELREKGHADKKDEPWWPEMQTRKELVETCTIIIWVASALHAALNFGQYPYGGYLP  768

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP +SRRF+P+ GTPEY+EL+++P+KAFL+T+T Q  ++LGISL+EILSRH SDE++LG
Sbjct  769  NRPAMSRRFIPKQGTPEYDELESDPEKAFLKTVTPQMLSILGISLVEILSRHTSDEVFLG  828

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +R+  EWT+D+  + AF +FG+KLA IEDRI+ MN D++WRNR GP K+PYTLL PTS  
Sbjct  829  KRDTAEWTADEEAVKAFGKFGEKLAGIEDRIIRMNSDEEWRNRVGPAKMPYTLLIPTSGV  888

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  889  GLTGRGIPNSVSI  901



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E    GH DKK+EPWWPKM S   L +T T IIW++SALHAAVNFGQY YAGY P
Sbjct  655  QAWWKEVRDVGHGDKKDEPWWPKMDSLSELTKTCTIIIWVASALHAAVNFGQYPYAGYLP  714

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEP +PEY+ELK NPD+ FL TIT+Q QT+LG+SLIEILSRH+SDE+YLG
Sbjct  715  NRPTISRRFMPEPNSPEYDELKRNPDRVFLSTITSQLQTILGVSLIEILSRHSSDEVYLG  774

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSE-  156
            QR+  EWT+D+  L+AF++FG KL  IE++I+ MN D+  +NR GPV+V YTLL+P +  
Sbjct  775  QRDTHEWTADEKALEAFKKFGDKLVEIENKIVDMNQDKSLKNRNGPVEVSYTLLYPNTSD  834

Query  155  ----GGLTGRGIPNSISI  114
                GGLTGRGIPNS+SI
Sbjct  835  FSQVGGLTGRGIPNSVSI  852



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 156/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH D K+E WWP+M +R  LI+  T IIWI+SALHAAVNFGQY YAGY P
Sbjct  680  QSWWTEIRNEGHGDLKHELWWPEMKTRAELIQACTIIIWIASALHAAVNFGQYPYAGYLP  739

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+ +PD AFL+TIT QFQTLLG+SLIEILSRH +DEIYLG
Sbjct  740  NRPTVSRRFMPEPGTDEYAELEKDPDLAFLKTITPQFQTLLGVSLIEILSRHTTDEIYLG  799

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AFERFGKKL  IE R+   N+D + +NR G VKVPYTLLFP +  
Sbjct  800  QRDTPEWTSDNEPLAAFERFGKKLVEIEKRVTERNNDGRLKNRIGAVKVPYTLLFPNTSD  859

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  860  YSKEGGLTGKGIPNSISI  877



>ref|XP_002278007.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=876

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = -2

Query  710  CRTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYS  531
            C T+  ++WW E   KGH DKK+EPWW +M +   L +T T IIW++SALHAAVNFGQY 
Sbjct  674  CDTE-LQSWWMELRNKGHGDKKDEPWWSEMQTLVDLTKTCTIIIWVASALHAAVNFGQYP  732

Query  530  YAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHAS  351
            YAGY P RPT+SRRFMPEPGTPEY+EL+ NPD AFL+TITAQ QTLLG+SLIEILSRH++
Sbjct  733  YAGYLPNRPTISRRFMPEPGTPEYQELERNPDLAFLKTITAQLQTLLGVSLIEILSRHST  792

Query  350  DEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLL  171
            DEIYLGQR+ PEWTSD   L AFERFG +L  IE RI  MN D++W NR GPV++ YTLL
Sbjct  793  DEIYLGQRDTPEWTSDAEPLAAFERFGSRLRGIETRINQMNQDRRWNNRFGPVEMQYTLL  852

Query  170  FPTS-----EGGLTGRGIPNSISI  114
            +P +     +GGL G+GIPNS+SI
Sbjct  853  YPNTSDYSRQGGLAGKGIPNSVSI  876



>gb|KFK35600.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=857

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ L+E+ T IIW++SALHAAVNFGQY  AGY P
Sbjct  665  QAWWKEVREEGHGDKKSEPWWPKMKTREELMESCTIIIWVASALHAAVNFGQYPIAGYLP  724

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP+  TPE+EEL+ NP+K FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  725  NRPTISRQFMPKENTPEFEELEKNPEKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  784

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW +DK  L+AFE+FG+K+  IE +I   N D+  +NR GPVK+PYT LFPTSEG
Sbjct  785  QRDDKEWAADKEALEAFEKFGEKVKEIEKKIDERNVDENLKNRNGPVKMPYTALFPTSEG  844

Query  152  GLTGRGIPNSISI  114
            G+T RGIPNS+SI
Sbjct  845  GVTNRGIPNSVSI  857



>gb|KFK35599.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=856

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ L+E+ T IIW++SALHAAVNFGQY  AGY P
Sbjct  664  QAWWKEVREEGHGDKKSEPWWPKMKTREELMESCTIIIWVASALHAAVNFGQYPIAGYLP  723

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP+  TPE+EEL+ NP+K FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  724  NRPTISRQFMPKENTPEFEELEKNPEKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  783

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW +DK  L+AFE+FG+K+  IE +I   N D+  +NR GPVK+PYT LFPTSEG
Sbjct  784  QRDDKEWAADKEALEAFEKFGEKVKEIEKKIDERNVDENLKNRNGPVKMPYTALFPTSEG  843

Query  152  GLTGRGIPNSISI  114
            G+T RGIPNS+SI
Sbjct  844  GVTNRGIPNSVSI  856



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            R    +AWW E  ++GH DKK+EPWWPKM +R+ L+E+ T IIW++SALHAAVNFGQY  
Sbjct  663  RDTELQAWWKEVREEGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAVNFGQYPI  722

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY P RPT+SR+FMP+  TPE+ EL+ NPDK F +TITAQ QTLLGISLIEILS H+SD
Sbjct  723  AGYLPNRPTISRQFMPKENTPEFAELEKNPDKVFFKTITAQLQTLLGISLIEILSTHSSD  782

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+  EW ++K   DAFE+FG+K+  IE  +   NDD   +NRTG VK+PYTLLF
Sbjct  783  EVYLGQRDSKEWAAEKEASDAFEKFGEKIKEIEKNMDERNDDVNLKNRTGLVKMPYTLLF  842

Query  167  PTSEGGLTGRGIPNSISI  114
            PTSEGG+TGRGIPNS+SI
Sbjct  843  PTSEGGVTGRGIPNSVSI  860



>gb|KFK39531.1| hypothetical protein AALP_AA3G256400 [Arabis alpina]
Length=882

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   +GH DK++E WWP M +R  LIET TTIIWI+SALHAAVNFGQYSYAG+ P
Sbjct  685  QSWWTELRTEGHGDKQHEAWWPLMQTRDDLIETCTTIIWIASALHAAVNFGQYSYAGFLP  744

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL  N D AFL+TIT Q QTLLGIS+IEILS H++DEIYLG
Sbjct  745  NRPTVSRRFMPEPGTDEYTELSENVDLAFLKTITPQLQTLLGISIIEILSMHSTDEIYLG  804

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ P WT+D   L+AF+RFGK L  IE+ I+  N+D++++NRTGPV +PYTLL+P    
Sbjct  805  QRDSPNWTADDEALEAFKRFGKNLELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTD  864

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGGLTG+GIPNS+SI
Sbjct  865  FTREGGLTGKGIPNSVSI  882



>gb|ABZ05753.1| lipoxygenase [Prunus armeniaca]
Length=603

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LIE+ T IIW+SSA HAA+N+GQYS  GY P
Sbjct  411  QSWWKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWLSSAYHAAINYGQYSIGGYVP  470

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+S  FMPE GTPEYEELKTNPDKAFL+T T Q QTLLG++ IEILSRH  DE+YLG
Sbjct  471  NRPTISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEILSRHPVDELYLG  530

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR  PEWT+D  +L A E F KKL  IE RI+ MN D+K +NR GP K+PYTLL+P+SE 
Sbjct  531  QRGTPEWTTDADMLQASEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAKIPYTLLYPSSEP  590

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS++I
Sbjct  591  GLTGKGIPNSVNI  603



>gb|KCW61799.1| hypothetical protein EUGRSUZ_H04497 [Eucalyptus grandis]
Length=598

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -2

Query  701  KSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAG  522
            K  ++WW E V++GH DKK EPWWPKM + + L ET T  IWI+SALHAAVNFGQY YAG
Sbjct  414  KELQSWWKELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAVNFGQYPYAG  473

Query  521  YNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEI  342
            Y P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQ QTLLGISLIEI         
Sbjct  474  YLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEI---------  524

Query  341  YLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPT  162
                R+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+VPY LL+PT
Sbjct  525  --PFRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNRDKRWRNRVGPVEVPYMLLYPT  582

Query  161  SEGGLTGRGIPNSISI  114
            SEGG+T +GIPNS+SI
Sbjct  583  SEGGVTAKGIPNSVSI  598



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+EPWWPKM +R+ LI++ T IIW++SALHAAV+FGQY  AGY P
Sbjct  665  QAWWKEVREEGHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAVSFGQYPIAGYLP  724

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SR+FMP+  TPE+EEL+ NPDK FL++ITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  725  NRPTISRQFMPKENTPEFEELEKNPDKVFLKSITAQLQTLLGISLIEILSTHSSDEVYLG  784

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK+PYT LFPTSEG
Sbjct  785  QRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVKMPYTSLFPTSEG  844

Query  152  GLTGRGIPNSISI  114
            G+TGRGIPNS+SI
Sbjct  845  GVTGRGIPNSVSI  857



>ref|XP_007225308.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
 gb|ACH90245.1| lipoxygenase LOX-2 [Prunus persica]
 gb|EMJ26507.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
Length=881

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            K+WWTE   +GH DKK+EPWWP+M +R  LI++ T IIW++SALHAAVNFGQY YAG+ P
Sbjct  684  KSWWTELRNEGHGDKKDEPWWPEMKTRDELIQSCTIIIWVASALHAAVNFGQYPYAGFLP  743

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GT EY EL++NPD AFL+TIT+QF TLLGISLIEILSRH++DE+YLG
Sbjct  744  NRPTVSRRFMPEAGTDEYAELESNPDLAFLKTITSQFNTLLGISLIEILSRHSTDEVYLG  803

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q ++PEW SD     AF++FG  L  IE RI   N+D+K++NR GPVKVPYTLL+P++  
Sbjct  804  QTDNPEWISDDKPRAAFKKFGDTLMEIEKRIDERNNDEKYKNRVGPVKVPYTLLYPSTSD  863

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTGRGIPNS+SI
Sbjct  864  TKREGGLTGRGIPNSVSI  881



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            + WW E   +GH DKK EPWWP+M +R  LI++ T IIW++SALHAAVNFGQ+ YAGY P
Sbjct  687  QKWWEELRNEGHGDKKAEPWWPEMHTRAELIQSCTIIIWVASALHAAVNFGQWPYAGYLP  746

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+TNPD AFL+TIT+Q QTLLG+SLIE+LSRHA+DEIYLG
Sbjct  747  NRPTISRRFMPEPGTAEYAELETNPDVAFLKTITSQLQTLLGVSLIEVLSRHATDEIYLG  806

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            QR+ PEWTSD   L AF RFG+KL  IE RI     D++ +NR GP+K+PYTLL+P++  
Sbjct  807  QRDTPEWTSDGEALAAFGRFGEKLIEIEKRITERTRDERLKNRVGPIKMPYTLLYPSTSD  866

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  867  YSREGGLTGKGIPNSISI  884



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 153/196 (78%), Gaps = 5/196 (3%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WW E    GH DKKNEPWWP+M +R  LIE+ T IIW++SALHAAVNFGQYSYAGY P R
Sbjct  689  WWAELRNVGHGDKKNEPWWPQMQTRDELIESCTIIIWVASALHAAVNFGQYSYAGYLPNR  748

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SRRFMPE GT EY EL++NPD AFL+TITAQ QTLLG+SLIEILSRH++DE+YLGQ 
Sbjct  749  PTVSRRFMPEAGTAEYAELESNPDAAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLGQN  808

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS----  159
            + PEWTSD   L AF RFG+KL  IE  I   N D + +NR GPV +PYTLL+P +    
Sbjct  809  DTPEWTSDAEALAAFARFGEKLMDIEKNINERNKDMRLKNRVGPVDMPYTLLYPNTSDKS  868

Query  158  -EGGLTGRGIPNSISI  114
             EGGLTG+GIPNS+SI
Sbjct  869  REGGLTGKGIPNSVSI  884



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   276 bits (707),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+E WWPKM +RQ LI+  T IIWI+SALHAAVNFG YSYAG+ P
Sbjct  668  QAWWKELREEGHGDKKDEAWWPKMQTRQELIDCCTIIIWIASALHAAVNFGLYSYAGFLP  727

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP+LS   MPEPG+ EYEELKTNPDK FL+T   Q QTLL +S+ E+LSRH SDE+YLG
Sbjct  728  NRPSLSWNLMPEPGSAEYEELKTNPDKVFLKTFVPQLQTLLEMSIFEVLSRHDSDEVYLG  787

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT DK  L AFERF K L  IE+RI+ MN  + W+NR+GPVKVPYTLLFP S+ 
Sbjct  788  QRDSPEWTKDKEPLVAFERFVKMLNDIENRIMIMNSHKSWKNRSGPVKVPYTLLFPKSQE  847

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  848  GLTGKGIPNSVSI  860



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score =   276 bits (706),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            +    +AWW E  ++GH DKK+EPWWPKM +RQ LIE+ T  IWI+SALHAAVNFGQY Y
Sbjct  655  KDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPY  714

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY   RP+LSR  MPEPG+PEYEELKTNPDK FL+T     QTLL IS+++ILSRH SD
Sbjct  715  AGYLVNRPSLSRMLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKILSRHGSD  774

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPVKVPYTLL  171
             +YLGQR+ PEWT D+  L AFERFGKKL+ I ++IL MN D +KW+NR GPVKVPY  L
Sbjct  775  TLYLGQRDSPEWTKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPVKVPYISL  834

Query  170  FPTSEGGLTGRGIPNSISI  114
            FPTS  GLTG+GIPNS+SI
Sbjct  835  FPTSGEGLTGKGIPNSVSI  853



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score =   276 bits (706),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            +    +AWW E  ++GH DKK+EPWWPKM +RQ LIE+ T  IWI+SALHAAVNFGQY Y
Sbjct  656  KDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPY  715

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY   RP+LSR  MPEPG+PEYEELKTNPDK FL+T     QTLL IS+++ILSRH SD
Sbjct  716  AGYLVNRPSLSRMLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKILSRHGSD  775

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPVKVPYTLL  171
             +YLGQR+ PEWT D+  L AFERFGKKL+ I ++IL MN D +KW+NR GPVKVPY  L
Sbjct  776  TLYLGQRDSPEWTKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPVKVPYISL  835

Query  170  FPTSEGGLTGRGIPNSISI  114
            FPTS  GLTG+GIPNS+SI
Sbjct  836  FPTSGEGLTGKGIPNSVSI  854



>gb|KJB80909.1| hypothetical protein B456_013G121100 [Gossypium raimondii]
Length=254

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 151/198 (76%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW+E   +GH++ + EPWWP+M +   + +  T IIWI+SA H AVNFGQY Y GY P
Sbjct  57   QSWWSEVKNEGHDNLRKEPWWPEMNTLAEITQAYTIIIWIASAFHVAVNFGQYLYIGYLP  116

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+S RFMPEPGT EY++L+ NPD AFL+TITAQFQTLLG+SLIE+LSRHA+DEIYLG
Sbjct  117  NRPTVSHRFMPEPGTKEYDKLENNPDLAFLKTITAQFQTLLGVSLIEVLSRHATDEIYLG  176

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            +R+  EWT D   L  FERFGKKL  I+ RI+  N+D   +NR G +KVPYTLL+P +  
Sbjct  177  KRDTAEWTIDDEPLATFERFGKKLVEIDSRIMETNNDINLKNRVGSMKVPYTLLYPNTSD  236

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  237  YSREGGLTGKGIPNSISI  254



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =   276 bits (706),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            +    +AWW E  ++GH DKK+EPWWPKM +RQ LIE+ T  IWI+SALHAAVNFGQY Y
Sbjct  664  KDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPY  723

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
            AGY   RP+LSR  MPEPG+PEYEELKTNPDK FL+T     QTLL IS+++ILSRH SD
Sbjct  724  AGYLVNRPSLSRMLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKILSRHGSD  783

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPVKVPYTLL  171
             +YLGQR+ PEWT D+  L AFERFGKKL+ I ++IL MN D +KW+NR GPVKVPY  L
Sbjct  784  TLYLGQRDSPEWTKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPVKVPYISL  843

Query  170  FPTSEGGLTGRGIPNSISI  114
            FPTS  GLTG+GIPNS+SI
Sbjct  844  FPTSGEGLTGKGIPNSVSI  862



>gb|AAM28285.1| lipoxygenase I, partial [Ananas comosus]
Length=331

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWWTE  + GH DKK+EPWWP+M +   L    TTIIW++SALHAAVNFGQY YAGY P
Sbjct  139  QAWWTEVREVGHGDKKDEPWWPEMQAVSELTHACTTIIWVASALHAAVNFGQYPYAGYMP  198

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
              PT+SRRFMP PGT EY+ELKTNPDKAF+ T T   QT+L +SLIEILS H SDE YLG
Sbjct  199  NGPTISRRFMPAPGTVEYDELKTNPDKAFVRTTTGMLQTILVLSLIEILSTHTSDEKYLG  258

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+ PEWT+D+  L AFERF   LA IE  I+  N D   +NR GPVK+PYTLL+ TSE 
Sbjct  259  QRDTPEWTTDQSALRAFERFNAALAQIEADIVKRNRDPSLKNRNGPVKMPYTLLYRTSEA  318

Query  152  GLTGRGIPNSISI  114
            G+T +GIPNS+SI
Sbjct  319  GITAKGIPNSVSI  331



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+EPWWP+M +R  L+E  T IIW++SALHAAVNFGQY Y+G   
Sbjct  679  QSWWMEVRNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNFGQYPYSGLTS  738

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILSR ASDEIYLG
Sbjct  739  NRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRTASDEIYLG  798

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE+PEWTSD     +F+RF  KL  +E++I+  N+D +W+NR GPVKVPY LL+P    
Sbjct  799  QRENPEWTSDVEPRQSFQRFHDKLVDVENKIVERNNDSRWKNRNGPVKVPYMLLYPNASG  858

Query  164  -TSEGGLTGRGIPNSISI  114
              SE GLTG+GIPNS+SI
Sbjct  859  DNSESGLTGKGIPNSVSI  876



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH D K++PWWPKM + +VLIET T IIWISSALHAAVNFGQY Y GY P
Sbjct  668  QSWWKELKEKGHVDLKDKPWWPKMETLEVLIETCTIIIWISSALHAAVNFGQYPYGGYLP  727

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTP+Y EL+++P+K FL TI +Q QTLLGISL+EILSRH+SDEIYLG
Sbjct  728  NRPTISRRFMPEKGTPQYIELESDPEKGFLRTINSQVQTLLGISLVEILSRHSSDEIYLG  787

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +RE  EW SD+  L+AFE+FGK+L  IE  I+  N D K +NR GP+ VPYT L+PTS  
Sbjct  788  KRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPINVPYTSLYPTSNE  847

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNSISI
Sbjct  848  GLTGKGIPNSISI  860



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=860

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH D K++PWWPKM + +VLIET T IIWISSALHAAVNFGQY Y GY P
Sbjct  668  QSWWKELKEKGHVDLKDKPWWPKMETLEVLIETCTIIIWISSALHAAVNFGQYPYGGYLP  727

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTP+Y EL+++P+K FL TI +Q QTLLGISL+EILSRH+SDEIYLG
Sbjct  728  NRPTISRRFMPEKGTPQYIELESDPEKGFLRTINSQVQTLLGISLVEILSRHSSDEIYLG  787

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +RE  EW SD+  L+AFE+FGK+L  IE  I+  N D K +NR GP+ VPYT L+PTS  
Sbjct  788  KRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPINVPYTSLYPTSNE  847

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNSISI
Sbjct  848  GLTGKGIPNSISI  860



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LI++ T IIWI+SALHAAVNFGQY  AGY P
Sbjct  669  QSWWKEVREEGHGDKKSEPWWPKMQTCEELIDSCTIIIWIASALHAAVNFGQYPIAGYLP  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMP  G+ E+EEL+ NP+K FL TITAQ QTLLG+S+IE+LSRH++DE+YLG
Sbjct  729  NRPTVSRRFMPRKGSKEFEELEKNPEKVFLRTITAQIQTLLGVSIIEVLSRHSTDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT++   L+AF RFG++L  IE +I+  N+D   +NR GPVK+PYTLLFPTSEG
Sbjct  789  QRDSKEWTAENEALEAFSRFGERLVEIEKKIVERNEDVSLKNRNGPVKMPYTLLFPTSEG  848

Query  152  GLTGRGIPNSISI  114
            G+TG+GIPNS+SI
Sbjct  849  GITGKGIPNSVSI  861



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692   KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
             +AWW E  ++GH DKK+EPWWPK+ +R+ LI++ T IIW++SALHAAVNFGQY  AGY P
Sbjct  1011  QAWWKEVREEGHGDKKSEPWWPKLQTRKELIDSCTIIIWVASALHAAVNFGQYPIAGYLP  1070

Query  512   CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
              RPT+SR+FMP+  TPE+E+L+ NPDK FL+TITAQ QTLLGISLIEILS H+SDE+YLG
Sbjct  1071  NRPTISRQFMPKENTPEFEQLEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLG  1130

Query  332   QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
             QR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK+PYT LFPTSEG
Sbjct  1131  QRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVKMPYTSLFPTSEG  1190

Query  152   GLTGRGIPNSISI  114
             G+TGRGIPNS+SI
Sbjct  1191  GVTGRGIPNSVSI  1203



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -2

Query  686  WWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNPCR  507
            WW E  ++GH DKKNEPWWPKM +R+ LI++ T IIW++SALHAAVNFGQY YAGY P R
Sbjct  682  WWRELREEGHGDKKNEPWWPKMHARKELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNR  741

Query  506  PTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLGQR  327
            PT+SR+FMPE GTPEY  L+ NPDKAFL TITAQ Q LLGISLIEILSRH++DE+YLGQR
Sbjct  742  PTMSRKFMPEEGTPEYAGLEKNPDKAFLRTITAQLQALLGISLIEILSRHSTDEVYLGQR  801

Query  326  EHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEGGL  147
              PEWT D   L AF+ FG  LA IE+RIL +N+++  +NR GPVK+PYTLL+PTS GGL
Sbjct  802  ATPEWTLDDQPLQAFQEFGNTLAKIEERILKLNNNENLKNRVGPVKMPYTLLYPTSGGGL  861

Query  146  TGRGIPNSISI  114
            TG+GIPNS+SI
Sbjct  862  TGKGIPNSVSI  872



>ref|XP_002883361.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59620.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   KGH DK++E WWP M +R  LIET T IIWI+SALHAAVNFGQY YAG+ P
Sbjct  641  QSWWTELRTKGHGDKQHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLP  700

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL  + D AFL+TIT Q QTLLGIS+IEILS H++DEIYLG
Sbjct  701  NRPTVSRRFMPEPGTDEYAELAEDADVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLG  760

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ P WT+D   L+AF+RFGK+L  IE+ I+  N+D++++NRTGPV +PYTLL+P    
Sbjct  761  QRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTSD  820

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGGLTG+GIPNS+SI
Sbjct  821  YTREGGLTGKGIPNSVSI  838



>emb|CAC19365.1| lipoxygenase [Arabidopsis thaliana]
Length=854

 Score =   274 bits (700),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   KGH DK++E WWP M +R  LIET T IIWI+SALHAAVNFGQY YAG+ P
Sbjct  657  QSWWTELRTKGHGDKRHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLP  716

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+ + D AFL+TIT Q QTLLGIS+IEILS H++DEIYLG
Sbjct  717  NRPTVSRRFMPEPGTDEYAELEEDADVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLG  776

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ P WT+D   L+AF+RFGK+L  IE+ I+  N+D++++NRTGPV +PYTLL+P    
Sbjct  777  QRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTD  836

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGG+TG+GIPNS+SI
Sbjct  837  YTREGGITGKGIPNSVSI  854



>ref|XP_007150490.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
 gb|ESW22484.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
Length=860

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E V+ GH DKKNEPWWPKM +R+ L+E  + +IW +SALHAAVNFGQY Y G   
Sbjct  668  QAWWKELVEVGHGDKKNEPWWPKMQTREELVEACSIVIWTASALHAAVNFGQYPYGGLIL  727

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPE G+ EYEELK +P KA L+TIT +FQTL+ +S+IEILSRHASDE+YLG
Sbjct  728  NRPTLSRRFMPEEGSAEYEELKKSPQKALLKTITPKFQTLVDLSVIEILSRHASDEVYLG  787

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +R++P WTSD   L+AF+RFGKKL+ IE ++   N+D+K RNR GPV +PYTLLFP+S+ 
Sbjct  788  ERDNPNWTSDTRALEAFKRFGKKLSEIEKKLSQRNNDEKLRNRYGPVMMPYTLLFPSSDE  847

Query  152  GLTGRGIPNSISI  114
            GLT RGIPNSISI
Sbjct  848  GLTFRGIPNSISI  860



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH D K+ PWWPKM +R+ LI++ T IIW++SALHAA+NFGQY + G+ P
Sbjct  671  QSWWKEVREEGHGDLKDAPWWPKMQTREELIDSCTIIIWVASALHAAINFGQYPFGGFLP  730

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++SRR MPE G+ EYEELK+NP+KAFL+TIT+Q+QTLLGISLIEILSRH SDE+YLG
Sbjct  731  NRPSMSRRLMPEEGSAEYEELKSNPEKAFLKTITSQYQTLLGISLIEILSRHTSDEVYLG  790

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT+D   ++A ++F KKLA IE RI  MN D K +NR GPVK+PYTLL PTS+ 
Sbjct  791  QRDTLEWTTDSKPMEALDKFRKKLADIEKRIFDMNRDDKLKNRFGPVKMPYTLLVPTSKV  850

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNS+SI
Sbjct  851  GLTGRGIPNSVSI  863



>gb|ABV32552.1| lipoxygenase [Prunus persica]
Length=933

 Score =   275 bits (702),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  ++GH DKK+EPWWPKM + + LIE+ T IIW+SSA HAA+N+GQYS  GY P
Sbjct  741  QSWWKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWLSSAYHAAINYGQYSIGGYVP  800

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RP++S  FMPE GTPEYEELKTNPDKAFL+T T Q QTLLG++ IEILSRH  DE+YLG
Sbjct  801  NRPSISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEILSRHPVDELYLG  860

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR  PEWT+D ++L AFE F KKL  IE RI+ MN D+K +NR GP K+PYTLL+P+SE 
Sbjct  861  QRGTPEWTTDANMLQAFEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAKIPYTLLYPSSEP  920

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS++I
Sbjct  921  GLTGKGIPNSVNI  933



>dbj|BAB01777.1| lipoxygenase [Arabidopsis thaliana]
Length=882

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   KGH DK++E WWP M +R  LIET T IIWI+SALHAAVNFGQY YAG+ P
Sbjct  685  QSWWTELRTKGHGDKRHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLP  744

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+ + D AFL+TIT Q QTLLGIS+IEILS H++DEIYLG
Sbjct  745  NRPTVSRRFMPEPGTDEYAELEEDADVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLG  804

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ P WT+D   L+AF+RFGK+L  IE+ I+  N+D++++NRTGPV +PYTLL+P    
Sbjct  805  QRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTD  864

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGG+TG+GIPNS+SI
Sbjct  865  YTREGGITGKGIPNSVSI  882



>ref|NP_188879.2| lipoxygenase 5 [Arabidopsis thaliana]
 sp|Q9LUW0.2|LOX5_ARATH RecName: Full=Linoleate 9S-lipoxygenase 5, chloroplastic; AltName: 
Full=Lipoxygenase 5; Short=AtLOX5 [Arabidopsis thaliana]
 gb|AEE76630.1| lipoxygenase 5 [Arabidopsis thaliana]
Length=886

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   KGH DK++E WWP M +R  LIET T IIWI+SALHAAVNFGQY YAG+ P
Sbjct  689  QSWWTELRTKGHGDKRHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLP  748

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL+ + D AFL+TIT Q QTLLGIS+IEILS H++DEIYLG
Sbjct  749  NRPTVSRRFMPEPGTDEYAELEEDADVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLG  808

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QR+ P WT+D   L+AF+RFGK+L  IE+ I+  N+D++++NRTGPV +PYTLL+P    
Sbjct  809  QRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTD  868

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGG+TG+GIPNS+SI
Sbjct  869  YTREGGITGKGIPNSVSI  886



>emb|CAP59449.1| lipoxygenase [Momordica charantia]
Length=880

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 154/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH DKK+EPWWPKM +   LIE+ T IIWISSALHAAVNFGQY Y GY P
Sbjct  688  QSWWKELREKGHTDKKDEPWWPKMQTFSELIESCTIIIWISSALHAAVNFGQYPYGGYVP  747

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT SRRFMPE GT EY+E+++NP+KAFL TI++Q   LLG+S+IEILS+HASDE+YLG
Sbjct  748  NRPTTSRRFMPEVGTAEYKEVESNPEKAFLRTISSQIVALLGLSIIEILSKHASDEVYLG  807

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR   EWTSDK  ++AFE+FGK+L  +EDRI+  N D   +NR GPV +PYTLL P+S  
Sbjct  808  QRASIEWTSDKSAIEAFEKFGKELFEVEDRIMRRNQDVNLKNRAGPVNMPYTLLVPSSTE  867

Query  152  GLTGRGIPNSISI  114
            GLTGRGIPNSISI
Sbjct  868  GLTGRGIPNSISI  880



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   273 bits (699),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+E WWPK+ +RQ L +  T IIWI+SALHAA++FG YSYAGY P
Sbjct  667  QAWWKELREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAALHFGLYSYAGYLP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLS   MPEPG+ EYEELKTNPDK FL+T   Q Q+LL IS+ E+ SRHASDE+YLG
Sbjct  727  NRPTLSCNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEVSSRHASDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT DK  L AFERFGK L+ IE+RI+ MN  + W+NR+GPV VPYTLLFPTSE 
Sbjct  787  QRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFPTSEE  846

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  847  GLTGKGIPNSVSI  859



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =   273 bits (698),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E  +KGH D K++PWWPKM + + LIET T IIWISSALHAAVNFGQY Y GY P
Sbjct  666  QSWWKELKEKGHVDLKDKPWWPKMETLEELIETCTIIIWISSALHAAVNFGQYPYGGYLP  725

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPE GTP+Y EL+++P+K FL TI +Q QTLLGISLIEILSRH+SDEIYLG
Sbjct  726  NRPTISRRFMPEKGTPQYVELESDPEKGFLRTINSQVQTLLGISLIEILSRHSSDEIYLG  785

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +RE  EW SD+  L+AFE+FGK+L  IE  I+  N D K +NR GP+ VPYT L+PTS  
Sbjct  786  KRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPINVPYTSLYPTSNE  845

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNSISI
Sbjct  846  GLTGKGIPNSISI  858



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   273 bits (698),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+E WWPK+ +RQ L +  T IIWI+SALHAA++FG YSYAGY P
Sbjct  667  QAWWKELREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAALHFGLYSYAGYLP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLS   MPEPG+ EYEELKTNPDK FL+T   Q Q+LL IS+ E+ SRHASDE+YLG
Sbjct  727  NRPTLSCNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEVSSRHASDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT DK  L AFERFGK L+ IE+RI+ MN  + W+NR+GPV VPYTLLFPTSE 
Sbjct  787  QRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFPTSEE  846

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  847  GLTGKGIPNSVSI  859



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E  ++GH DKK+E WWPK+ +RQ L +  T IIWI+SALHAA++FG YSYAGY P
Sbjct  667  QAWWKELREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAALHFGLYSYAGYLP  726

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLS   MPEPG+ EYEELKTNPDK FL+T   Q Q+LL IS+ E+ SRHASDE+YLG
Sbjct  727  NRPTLSCNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEVSSRHASDEVYLG  786

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            QR+  EWT DK  L AFERFGK L+ IE+RI+ MN  + W+NR+GPV VPYTLLFPTSE 
Sbjct  787  QRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFPTSEE  846

Query  152  GLTGRGIPNSISI  114
            GLTG+GIPNS+SI
Sbjct  847  GLTGKGIPNSVSI  859



>gb|ACH91370.1| lipoxygenase LOX-3 [Prunus persica]
Length=933

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  707  RTKSYKAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSY  528
            +    ++WW E  ++GH DKK+EPWWPKM + + LIE+ T IIWI+SA HAA+NFGQY +
Sbjct  736  KDSELQSWWKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWIASAHHAAINFGQYPF  795

Query  527  AGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASD  348
             GY P RP++S +FMPE GTPEYEELKTNP+KAFL+TIT Q QTLLG++ IEILSRH++D
Sbjct  796  GGYPPNRPSISLQFMPEEGTPEYEELKTNPEKAFLKTITPQLQTLLGMASIEILSRHSAD  855

Query  347  EIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLF  168
            E+YLGQR+ PEWT+D  +L AF++F KKL  IE+ +  MN D+K +NR GP K+PYTLL 
Sbjct  856  ELYLGQRDAPEWTADNDILQAFKKFRKKLEEIEENMKRMNKDEKLKNRVGPAKMPYTLLH  915

Query  167  PTSEGGLTGRGIPNSISI  114
            P+SE GLTG+GIPNS+SI
Sbjct  916  PSSEAGLTGKGIPNSVSI  933



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WW E   +GH D K+  WWP+M +++ LI++ T IIW++SA HAAVNFGQY +AGY P
Sbjct  653  QSWWKEVRNEGHGDLKDRHWWPEMKTKEELIQSCTIIIWLASAFHAAVNFGQYPFAGYLP  712

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGTPEYEELK++PD AFL+TITAQFQTLLG+SLIE+LSRH+++E+YLG
Sbjct  713  NRPTVSRRFMPEPGTPEYEELKSDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTEEVYLG  772

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTS--  159
            Q E+PEWT D   L AFERF +KL  IE  I+  N D++ +NR GPVK+PYTLLFP +  
Sbjct  773  QCENPEWTLDAEPLAAFERFRQKLLEIESNIIERNKDKRLKNRNGPVKMPYTLLFPNTSD  832

Query  158  ---EGGLTGRGIPNSISI  114
               EGGLTG+GIPNSISI
Sbjct  833  YSREGGLTGKGIPNSISI  850



>sp|P09918.1|LOX3_PEA RecName: Full=Seed linoleate 9S-lipoxygenase-3; AltName: Full=Lipoxygenase-3 
[Pisum sativum]
 emb|CAA30666.1| unnamed protein product [Pisum sativum]
 emb|CAA55319.1| lipoxygenase [Pisum sativum]
Length=861

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E V+ GH DKKNEPWWPKM +R+ LIE  + +IW +SALHAAVNFGQYSY G   
Sbjct  669  QAWWKELVEVGHGDKKNEPWWPKMQTREDLIEVCSIVIWTASALHAAVNFGQYSYGGLIL  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPE G+ E+EEL  +P KA+L+TIT +FQTL+ +S+IEILSRHASDE+YLG
Sbjct  729  NRPTLSRRFMPEKGSAEFEELVKSPQKAYLKTITPKFQTLIDLSVIEILSRHASDELYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +R++P WTSDK  L+AF++FG KLA IE ++   N+D+K RNR GPV++PYTLL+P+S+ 
Sbjct  789  ERDNPNWTSDKRALEAFKKFGNKLAEIEKKLTQRNNDEKLRNRHGPVEMPYTLLYPSSKE  848

Query  152  GLTGRGIPNSISI  114
            GLT RGIPNSISI
Sbjct  849  GLTFRGIPNSISI  861



>ref|XP_003597559.1| Seed lipoxygenase-3 [Medicago truncatula]
 gb|AES67810.1| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=861

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            +AWW E V+ GH DKKNEPWWPKM +R+ L+E  TT+IWI+SALHAAVNFGQYSY G   
Sbjct  669  QAWWKELVEVGHGDKKNEPWWPKMQAREELVEVCTTVIWIASALHAAVNFGQYSYGGLIL  728

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPTLSRRFMPE G+ EY EL  +P KA+L+TIT +FQTL+ +S+IEILSRHASDE+YLG
Sbjct  729  NRPTLSRRFMPEKGSAEYNELVKSPQKAYLKTITPKFQTLIDLSVIEILSRHASDEVYLG  788

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFPTSEG  153
            +R++P WTSD   L+AF++FG KLA IE  +   N+D+K R+R GPV++PYTLL P+SE 
Sbjct  789  ERDNPNWTSDTRALEAFKKFGNKLAEIEKNLAQRNNDEKLRHRLGPVQMPYTLLHPSSEE  848

Query  152  GLTGRGIPNSISI  114
            GLT RGIPNSISI
Sbjct  849  GLTFRGIPNSISI  861



>ref|XP_010488264.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=889

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   KGH DK++E WWP M +R  LIE+ T IIWI+SALHAAVNFGQY YAG+ P
Sbjct  692  QSWWTELRTKGHGDKQHESWWPSMQTRDDLIESCTIIIWIASALHAAVNFGQYPYAGFLP  751

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL  + D AFL+TIT Q QTLLGIS+IE LS H++DEIYLG
Sbjct  752  NRPTVSRRFMPEPGTVEYTELVEDTDVAFLKTITPQLQTLLGISIIETLSMHSTDEIYLG  811

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE P WT+D   L+AF+RFGK+L  IE+ I+  N+D+K++NRTGPV +PYTLL+P    
Sbjct  812  QRESPNWTADDEALEAFKRFGKELELIENNIIKRNNDKKFKNRTGPVNIPYTLLYPNTTD  871

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGGLTG+GIPNS+SI
Sbjct  872  YTREGGLTGKGIPNSVSI  889



>ref|XP_010488263.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=890

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -2

Query  692  KAWWTETVQKGHEDKKNEPWWPKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYAGYNP  513
            ++WWTE   KGH DK++E WWP M +R  LIE+ T IIWI+SALHAAVNFGQY YAG+ P
Sbjct  693  QSWWTELRTKGHGDKQHESWWPSMQTRDDLIESCTIIIWIASALHAAVNFGQYPYAGFLP  752

Query  512  CRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDEIYLG  333
             RPT+SRRFMPEPGT EY EL  + D AFL+TIT Q QTLLGIS+IE LS H++DEIYLG
Sbjct  753  NRPTVSRRFMPEPGTVEYTELVEDTDVAFLKTITPQLQTLLGISIIETLSMHSTDEIYLG  812

Query  332  QREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP----  165
            QRE P WT+D   L+AF+RFGK+L  IE+ I+  N+D+K++NRTGPV +PYTLL+P    
Sbjct  813  QRESPNWTADDEALEAFKRFGKELELIENNIIKRNNDKKFKNRTGPVNIPYTLLYPNTTD  872

Query  164  -TSEGGLTGRGIPNSISI  114
             T EGGLTG+GIPNS+SI
Sbjct  873  YTREGGLTGKGIPNSVSI  890



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840