BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005N09

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                263   3e-81   Erythranthe guttata [common monkey flower]
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                263   4e-81   Erythranthe guttata [common monkey flower]
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    262   9e-81   Solanum tuberosum [potatoes]
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             260   3e-80   Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    260   4e-80   Citrus sinensis [apfelsine]
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    259   5e-80   Fragaria vesca subsp. vesca
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    260   7e-80   Solanum lycopersicum
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    259   1e-79   Nicotiana sylvestris
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   5e-79   Vitis vinifera
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   7e-79   Populus euphratica
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    257   9e-79   Populus euphratica
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    256   1e-78   Ricinus communis
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    257   1e-78   Nicotiana tomentosiformis
ref|XP_002302634.2|  aspartyl protease family protein                   256   2e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    256   2e-78   Sesamum indicum [beniseed]
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         256   2e-78   Jatropha curcas
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    255   3e-78   Eucalyptus grandis [rose gum]
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          254   5e-78   Phaseolus vulgaris [French bean]
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   5e-78   Glycine max [soybeans]
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             254   5e-78   Phaseolus vulgaris [French bean]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             254   6e-78   Phaseolus vulgaris [French bean]
ref|XP_002320868.1|  aspartyl protease family protein                   254   8e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   1e-77   Sesamum indicum [beniseed]
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  254   2e-77   Morus notabilis
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   7e-77   
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   1e-76   Malus domestica [apple tree]
emb|CDX90023.1|  BnaA10g00590D                                          251   1e-76   
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                251   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   2e-76   Brassica rapa
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             250   2e-76   
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    249   4e-76   Arabis alpina [alpine rockcress]
emb|CDP08669.1|  unnamed protein product                                249   6e-76   Coffea canephora [robusta coffee]
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    249   1e-75   
emb|CDY15187.1|  BnaC05g00660D                                          248   1e-75   Brassica napus [oilseed rape]
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   2e-75   Glycine max [soybeans]
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    245   2e-75   
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             247   5e-75   Eutrema salsugineum [saltwater cress]
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   6e-75   Glycine max [soybeans]
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             248   7e-75   Phaseolus vulgaris [French bean]
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   8e-75   Cucumis melo [Oriental melon]
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    247   8e-75   
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    245   1e-74   Cucumis sativus [cucumbers]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   1e-74   Cucumis sativus [cucumbers]
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       247   1e-74   Cucumis sativus [cucumbers]
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   4e-74   Solanum lycopersicum
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    245   4e-74   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   7e-74   
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             244   1e-73   Capsella rubella
ref|XP_002892074.1|  aspartyl protease family protein                   244   1e-73   
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   1e-73   Pyrus x bretschneideri [bai li]
gb|EPS66029.1|  hypothetical protein M569_08742                         243   1e-73   Genlisea aurea
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    243   2e-73   Camelina sativa [gold-of-pleasure]
gb|KJB09627.1|  hypothetical protein B456_001G154400                    241   3e-73   Gossypium raimondii
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             241   7e-73   Medicago truncatula
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   7e-73   Solanum tuberosum [potatoes]
ref|NP_171637.1|  aspartyl protease family protein                      241   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   1e-72   Camelina sativa [gold-of-pleasure]
gb|KJB09626.1|  hypothetical protein B456_001G154400                    241   2e-72   Gossypium raimondii
gb|KJB49569.1|  hypothetical protein B456_008G125700                    240   2e-72   Gossypium raimondii
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    239   8e-72   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF01866.1|  chloroplast nucleoid DNA binding protein like          227   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      238   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    239   2e-71   
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    236   9e-71   Nicotiana sylvestris
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    236   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    235   2e-70   
emb|CDY25081.1|  BnaC06g18230D                                          229   4e-68   Brassica napus [oilseed rape]
ref|XP_002878415.1|  aspartyl protease family protein                   229   5e-68   
ref|NP_191741.1|  aspartyl protease                                     228   8e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89133.1|  BnaA04g00530D                                          228   9e-68   
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    228   1e-67   Brassica rapa
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   3e-67   Brassica rapa
emb|CDX67868.1|  BnaA07g19080D                                          226   4e-67   
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             226   6e-67   Eutrema salsugineum [saltwater cress]
emb|CDY43952.1|  BnaC04g21580D                                          226   9e-67   Brassica napus [oilseed rape]
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    225   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    225   1e-66   Camelina sativa [gold-of-pleasure]
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    223   1e-65   Arabis alpina [alpine rockcress]
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    221   3e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    215   1e-62   Elaeis guineensis
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    211   5e-61   Phoenix dactylifera
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    210   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795461.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    205   2e-60   Phoenix dactylifera
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    208   6e-60   Elaeis guineensis
gb|ABK24467.1|  unknown                                                 207   9e-60   Picea sitchensis
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          203   4e-58   Amborella trichopoda
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    200   7e-57   Setaria italica
ref|NP_001183392.1|  uncharacterized protein LOC100501808               195   2e-56   
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   5e-56   Brachypodium distachyon [annual false brome]
ref|NP_001043485.1|  Os01g0598600                                       197   6e-56   
gb|EMS49734.1|  Aspartic proteinase nepenthesin-1                       194   6e-56   Triticum urartu
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970          197   1e-55   
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358              196   2e-55   
dbj|BAJ86414.1|  predicted protein                                      195   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM83204.1|  unnamed protein product                                194   1e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001757102.1|  predicted protein                                  190   4e-54   
ref|XP_001759252.1|  predicted protein                                  185   3e-52   
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   8e-52   
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...    186   1e-51   
gb|ABK24255.1|  unknown                                                 185   3e-51   Picea sitchensis
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         185   4e-51   Jatropha curcas
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   4e-51   Fragaria vesca subsp. vesca
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   4e-51   Pyrus x bretschneideri [bai li]
gb|EEE64882.1|  hypothetical protein OsJ_19741                          184   5e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003637416.1|  Aspartic proteinase nepenthesin-2                  175   7e-51   
ref|NP_001056485.1|  Os05g0590000                                       184   8e-51   
gb|EAY99240.1|  hypothetical protein OsI_21202                          183   1e-50   Oryza sativa Indica Group [Indian rice]
gb|AAT38006.1|  unknow protein                                          183   1e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EPS61272.1|  hypothetical protein M569_13524                         183   2e-50   Genlisea aurea
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   2e-50   Sesamum indicum [beniseed]
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   6e-50   
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g             181   6e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   8e-50   Pyrus x bretschneideri [bai li]
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   9e-50   Nelumbo nucifera [Indian lotus]
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   2e-49   
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   2e-49   
gb|KCW48530.1|  hypothetical protein EUGRSUZ_K02206                     179   4e-49   Eucalyptus grandis [rose gum]
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    179   4e-49   
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   179   7e-49   Citrus sinensis [apfelsine]
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             179   7e-49   Citrus clementina [clementine]
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   9e-49   Citrus sinensis [apfelsine]
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   9e-49   Prunus mume [ume]
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   1e-48   Cicer arietinum [garbanzo]
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   1e-48   Populus euphratica
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...    177   2e-48   Ricinus communis
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   2e-48   Phoenix dactylifera
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             177   4e-48   Prunus persica
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   4e-48   Brassica rapa
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein            176   6e-48   Medicago truncatula
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             176   7e-48   Phaseolus vulgaris [French bean]
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein        176   8e-48   
gb|KDO36875.1|  hypothetical protein CISIN_1g037264mg                   170   8e-48   Citrus sinensis [apfelsine]
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   9e-48   Glycine max [soybeans]
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg                175   1e-47   Erythranthe guttata [common monkey flower]
gb|KJB52970.1|  hypothetical protein B456_008G285900                    175   2e-47   Gossypium raimondii
emb|CDY24395.1|  BnaCnng04620D                                          174   4e-47   Brassica napus [oilseed rape]
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   4e-47   Camelina sativa [gold-of-pleasure]
gb|KDO70056.1|  hypothetical protein CISIN_1g0117492mg                  167   5e-47   Citrus sinensis [apfelsine]
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   6e-47   Sesamum indicum [beniseed]
gb|KDP29378.1|  hypothetical protein JCGZ_18299                         173   7e-47   Jatropha curcas
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    173   9e-47   Elaeis guineensis
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    173   9e-47   Elaeis guineensis
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002315953.1|  aspartyl protease family protein                   172   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430          172   2e-46   
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    172   2e-46   Phoenix dactylifera
ref|XP_002890686.1|  aspartyl protease family protein                   172   2e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440          172   2e-46   Amborella trichopoda
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg             171   3e-46   Capsella rubella
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134              168   4e-46   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135              168   4e-46   
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg             171   4e-46   Eutrema salsugineum [saltwater cress]
ref|NP_173922.1|  aspartyl protease family protein                      171   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             171   6e-46   Phaseolus vulgaris [French bean]
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   7e-46   Cucumis sativus [cucumbers]
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    170   8e-46   Vitis vinifera
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    170   8e-46   
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                    170   1e-45   Arabis alpina [alpine rockcress]
gb|EMT00623.1|  Aspartic proteinase nepenthesin-1                       164   1e-45   
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   1e-45   Nicotiana sylvestris
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    169   2e-45   Arabis alpina [alpine rockcress]
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   3e-45   Tarenaya hassleriana [spider flower]
emb|CDP20336.1|  unnamed protein product                                169   3e-45   Coffea canephora [robusta coffee]
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   3e-45   Vitis vinifera
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg             168   4e-45   Citrus clementina [clementine]
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    168   4e-45   Nicotiana tomentosiformis
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    168   4e-45   Solanum lycopersicum
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    168   4e-45   Citrus sinensis [apfelsine]
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   4e-45   Cicer arietinum [garbanzo]
gb|EAY72467.1|  hypothetical protein OsI_00323                          168   5e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    168   8e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001041979.1|  Os01g0140100                                       167   9e-45   
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   1e-44   Brachypodium distachyon [annual false brome]
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein        166   2e-44   
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   2e-44   Solanum tuberosum [potatoes]
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   2e-44   Cucumis sativus [cucumbers]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   3e-44   Cucumis melo [Oriental melon]
gb|KJB50738.1|  hypothetical protein B456_008G185200                    166   3e-44   Gossypium raimondii
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   3e-44   
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   3e-44   
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   3e-44   Prunus mume [ume]
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   3e-44   Populus euphratica
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   3e-44   Nicotiana tomentosiformis
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg             166   4e-44   
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             166   5e-44   Capsella rubella
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   5e-44   Nicotiana sylvestris
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   5e-44   Brassica rapa
emb|CDY69364.1|  BnaCnng63170D                                          166   5e-44   Brassica napus [oilseed rape]
gb|ADJ67210.1|  aspartic proteinase nepenthesin-1 precursor             154   6e-44   Jatropha curcas
emb|CDM80984.1|  unnamed protein product                                166   6e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    165   8e-44   Tarenaya hassleriana [spider flower]
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg             165   9e-44   Eutrema salsugineum [saltwater cress]
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              164   1e-43   
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   1e-43   Brassica rapa
gb|ABR16474.1|  unknown                                                 164   2e-43   Picea sitchensis
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   2e-43   Tarenaya hassleriana [spider flower]
dbj|BAK07248.1|  predicted protein                                      164   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              162   2e-43   
emb|CDX75968.1|  BnaC03g40510D                                          164   2e-43   
gb|ADJ67200.1|  aspartic proteinase nepenthesin-1 precursor             153   2e-43   Jatropha curcas
emb|CDY24483.1|  BnaC05g34710D                                          164   3e-43   Brassica napus [oilseed rape]
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   3e-43   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   4e-43   Setaria italica
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                  163   5e-43   Morus notabilis
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   5e-43   Tarenaya hassleriana [spider flower]
ref|NP_001168599.1|  uncharacterized protein LOC100382383               159   6e-43   
ref|XP_002885261.1|  aspartyl protease family protein                   162   8e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   1e-42   Solanum tuberosum [potatoes]
emb|CDX92240.1|  BnaA05g21670D                                          162   1e-42   
gb|KJB37242.1|  hypothetical protein B456_006G195400                    161   2e-42   Gossypium raimondii
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   2e-42   
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   2e-42   Fragaria vesca subsp. vesca
gb|KJB09628.1|  hypothetical protein B456_001G154400                    160   2e-42   Gossypium raimondii
ref|XP_001784204.1|  predicted protein                                  159   3e-42   
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                  160   4e-42   Morus notabilis
gb|KJB41527.1|  hypothetical protein B456_007G108800                    160   4e-42   Gossypium raimondii
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   5e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210          160   5e-42   Sorghum bicolor [broomcorn]
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   5e-42   Pyrus x bretschneideri [bai li]
emb|CDX82342.1|  BnaA03g34790D                                          160   7e-42   
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1             159   8e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein       159   8e-42   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              160   8e-42   
emb|CDY51131.1|  BnaA07g37140D                                          158   1e-41   Brassica napus [oilseed rape]
gb|ABR17085.1|  unknown                                                 158   2e-41   Picea sitchensis
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   3e-41   Brassica rapa
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   3e-41   Setaria italica
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    158   3e-41   Eucalyptus grandis [rose gum]
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   5e-41   Glycine max [soybeans]
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230              156   5e-41   
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630          157   7e-41   Sorghum bicolor [broomcorn]
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369             156   7e-41   
emb|CDP20730.1|  unnamed protein product                                157   9e-41   Coffea canephora [robusta coffee]
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   1e-40   Solanum lycopersicum
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   1e-40   
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   1e-40   Brassica rapa
emb|CDO98452.1|  unnamed protein product                                154   3e-40   Coffea canephora [robusta coffee]
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg                155   3e-40   Erythranthe guttata [common monkey flower]
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   6e-40   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   7e-40   Nicotiana sylvestris
emb|CDY03848.1|  BnaC07g10730D                                          154   8e-40   
gb|KHN27179.1|  Aspartic proteinase nepenthesin-1                       144   2e-39   Glycine soja [wild soybean]
ref|XP_002442593.1|  hypothetical protein SORBIDRAFT_08g022613          152   4e-39   
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    151   6e-39   Ricinus communis
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   7e-39   
ref|XP_002442590.1|  hypothetical protein SORBIDRAFT_08g022570          151   8e-39   Sorghum bicolor [broomcorn]
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein            151   1e-38   Medicago truncatula
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   1e-38   Glycine max [soybeans]
emb|CAN80962.1|  hypothetical protein VITISV_022007                     142   1e-38   Vitis vinifera
gb|ABR17396.1|  unknown                                                 148   2e-38   Picea sitchensis
gb|AFK45956.1|  unknown                                                 143   9e-38   Medicago truncatula
gb|ABK24480.1|  unknown                                                 148   9e-38   Picea sitchensis
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    148   9e-38   Phoenix dactylifera
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    147   1e-37   Sesamum indicum [beniseed]
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   3e-37   Zea mays [maize]
gb|KDP40474.1|  hypothetical protein JCGZ_24473                         146   3e-37   Jatropha curcas
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161              144   3e-37   
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   4e-37   Vitis vinifera
emb|CBI35367.3|  unnamed protein product                                146   5e-37   Vitis vinifera
emb|CAD31717.1|  putative nucleoid DNA-binding protein                  138   8e-37   Cicer arietinum [garbanzo]
ref|XP_004138238.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   1e-36   Cucumis sativus [cucumbers]
ref|XP_004170575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   1e-36   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075          144   1e-36   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470              144   1e-36   
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2             144   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   3e-36   
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   3e-36   
emb|CDY24567.1|  BnaC05g32510D                                          142   3e-36   
emb|CDY25371.1|  BnaA05g19130D                                          142   4e-36   
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   4e-36   
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   5e-36   
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   5e-36   
emb|CDP04865.1|  unnamed protein product                                143   6e-36   
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   7e-36   
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg             143   7e-36   
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                    142   8e-36   
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein            142   1e-35   
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   1e-35   
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   1e-35   
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   1e-35   
ref|XP_008453384.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   1e-35   
ref|XP_004138341.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   1e-35   
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   2e-35   
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                  141   2e-35   
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein            141   2e-35   
gb|EAZ12575.1|  hypothetical protein OsJ_02481                          141   3e-35   
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   3e-35   
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   3e-35   
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg             141   3e-35   
ref|XP_002885351.1|  pepsin A                                           141   3e-35   
ref|XP_010542095.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   4e-35   
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   4e-35   
ref|XP_006645485.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   4e-35   
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   4e-35   
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   5e-35   
gb|KJB79793.1|  hypothetical protein B456_013G067200                    140   5e-35   
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   6e-35   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   7e-35   
gb|KGN63808.1|  hypothetical protein Csa_1G021980                       138   8e-35   
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   8e-35   
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                  140   9e-35   
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   1e-34   
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   1e-34   
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   3e-34   
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   3e-34   
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   3e-34   
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                   139   3e-34   
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg             138   3e-34   
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g             138   3e-34   
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g             138   3e-34   
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g             138   4e-34   
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   5e-34   
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   6e-34   
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   7e-34   
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   7e-34   
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   8e-34   
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   9e-34   
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg                137   9e-34   
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative        137   1e-33   
ref|XP_002443631.1|  hypothetical protein SORBIDRAFT_08g022620          137   1e-33   
gb|KGN63809.1|  hypothetical protein Csa_1G022480                       136   1e-33   
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   1e-33   
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   2e-33   
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   3e-33   
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   5e-33   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    135   5e-33   
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   5e-33   
gb|EAY75637.1|  hypothetical protein OsI_03542                          134   1e-32   
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   1e-32   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like    133   1e-32   
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   2e-32   
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg             133   2e-32   
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   2e-32   
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   2e-32   
gb|KJB49971.1|  hypothetical protein B456_008G147500                    133   2e-32   
gb|EAZ32412.1|  hypothetical protein OsJ_16623                          132   4e-32   
emb|CAE05761.2|  OSJNBa0064G10.12                                       132   4e-32   
emb|CAA09458.1|  hypothetical protein                                   125   4e-32   
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g             132   4e-32   
ref|NP_001054261.2|  Os04g0677100                                       132   4e-32   
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580          132   4e-32   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900          132   7e-32   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   1e-31   
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   1e-31   
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   1e-31   
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   1e-31   
emb|CAJ86229.1|  H0402C08.5                                             130   2e-31   
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-31   
emb|CDO98457.1|  unnamed protein product                                129   2e-31   
gb|KJB77420.1|  hypothetical protein B456_012G135900                    130   2e-31   
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-30   
gb|KCW64008.1|  hypothetical protein EUGRSUZ_G01690                     127   1e-30   
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966              125   6e-30   
gb|ABR16115.1|  unknown                                                 125   8e-30   
ref|XP_010068575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   9e-30   
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971              125   9e-30   
gb|KCW63938.1|  hypothetical protein EUGRSUZ_G01615                     125   1e-29   
ref|XP_010068543.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   1e-29   
gb|KCW63937.1|  hypothetical protein EUGRSUZ_G01615                     125   1e-29   
emb|CDO98456.1|  unnamed protein product                                125   1e-29   
gb|ABK24493.1|  unknown                                                 125   1e-29   
emb|CDM84701.1|  unnamed protein product                                123   4e-29   
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          123   1e-28   
gb|ABR18297.1|  unknown                                                 122   1e-28   
dbj|BAJ97639.1|  predicted protein                                      122   1e-28   
gb|EMT16849.1|  Aspartic proteinase nepenthesin-1                       116   8e-28   
emb|CDO98455.1|  unnamed protein product                                119   2e-27   
gb|KHN15927.1|  Aspartic proteinase nepenthesin-1                       111   2e-27   
gb|ACN40790.1|  unknown                                                 119   2e-27   
gb|AEW08671.1|  hypothetical protein CL1136Contig1_03                   110   4e-27   
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   5e-27   
ref|XP_003530761.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   5e-27   
gb|KJB71343.1|  hypothetical protein B456_011G117400                    117   7e-27   
gb|KJB58890.1|  hypothetical protein B456_009G230400                    117   8e-27   
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   8e-27   
ref|XP_010916755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   1e-26   
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   1e-26   
ref|XP_006426445.1|  hypothetical protein CICLE_v10025623mg             116   1e-26   
gb|KDO58699.1|  hypothetical protein CISIN_1g013672mg                   116   1e-26   
ref|XP_002460314.1|  hypothetical protein SORBIDRAFT_02g026340          116   1e-26   
ref|XP_006466172.1|  PREDICTED: aspartic proteinase nepenthesin-1...    116   1e-26   
ref|XP_010266606.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   1e-26   
ref|XP_006291078.1|  hypothetical protein CARUB_v10017196mg             116   2e-26   
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   2e-26   
gb|AEW08670.1|  hypothetical protein CL1136Contig1_03                   108   4e-26   
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...    115   4e-26   
ref|XP_010272925.1|  PREDICTED: aspartic proteinase nepenthesin-1...    115   4e-26   
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   5e-26   
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016              115   5e-26   
ref|XP_006847614.1|  hypothetical protein AMTR_s00014p00246430          115   6e-26   
ref|XP_007223364.1|  hypothetical protein PRUPE_ppa005616mg             114   7e-26   
ref|XP_009390629.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   8e-26   
gb|KHN09660.1|  Aspartic proteinase nepenthesin-1                       113   1e-25   
gb|KDP34587.1|  hypothetical protein JCGZ_12216                         113   1e-25   
gb|ABP93696.1|  unknown protein isoform 1                               113   1e-25   
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25   
gb|KDP41467.1|  hypothetical protein JCGZ_15874                         113   2e-25   
ref|NP_001046662.1|  Os02g0314600                                       114   2e-25   
gb|EAY85563.1|  hypothetical protein OsI_06935                          114   2e-25   
ref|XP_008380197.1|  PREDICTED: aspartic proteinase nepenthesin-2       114   2e-25   
ref|XP_007224453.1|  hypothetical protein PRUPE_ppa022256mg             112   3e-25   
ref|XP_008442220.1|  PREDICTED: aspartic proteinase nepenthesin-1       112   3e-25   
ref|XP_009410092.1|  PREDICTED: aspartic proteinase nepenthesin-2...    112   3e-25   
ref|XP_004956985.1|  PREDICTED: aspartic proteinase nepenthesin-1...    112   3e-25   
dbj|BAF98915.1|  aspartic proteinase nepenthesin I                      112   3e-25   
emb|CDP04617.1|  unnamed protein product                                112   4e-25   
gb|KGN54860.1|  hypothetical protein Csa_4G554680                       112   4e-25   
ref|XP_003523200.1|  PREDICTED: aspartic proteinase nepenthesin-1...    112   4e-25   
ref|XP_006395734.1|  hypothetical protein EUTSA_v10004149mg             112   4e-25   
emb|CDO98454.1|  unnamed protein product                                111   4e-25   
ref|XP_010107692.1|  Aspartic proteinase nepenthesin-1                  112   5e-25   
gb|KFK33485.1|  hypothetical protein AALP_AA5G019300                    112   5e-25   
ref|XP_004168776.1|  PREDICTED: aspartic proteinase nepenthesin-1...    112   5e-25   
ref|XP_010916060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   6e-25   
ref|XP_009625615.1|  PREDICTED: aspartic proteinase nepenthesin-1       112   6e-25   
ref|XP_003526889.1|  PREDICTED: aspartic proteinase nepenthesin-1...    111   6e-25   
gb|KCW63732.1|  hypothetical protein EUGRSUZ_G01378                     111   7e-25   
gb|EMT24490.1|  Aspartic proteinase nepenthesin-1                       105   7e-25   
ref|XP_006828037.1|  hypothetical protein AMTR_s00008p00256490          111   7e-25   
ref|XP_011091829.1|  PREDICTED: aspartic proteinase nepenthesin-1       111   8e-25   
gb|AET05305.2|  eukaryotic aspartyl protease family protein             111   9e-25   
ref|XP_002446566.1|  hypothetical protein SORBIDRAFT_06g018170          111   9e-25   
ref|XP_003630829.1|  Aspartic proteinase nepenthesin-2                  112   1e-24   
ref|XP_010674342.1|  PREDICTED: aspartic proteinase nepenthesin-1       111   1e-24   
ref|XP_009801916.1|  PREDICTED: aspartic proteinase nepenthesin-1       110   1e-24   
gb|AFV26024.1|  aspartic proteinase nepenthesin 1                       110   1e-24   
ref|XP_004239638.1|  PREDICTED: aspartic proteinase nepenthesin-1       110   1e-24   
ref|XP_004237984.1|  PREDICTED: aspartic proteinase nepenthesin-1...    110   2e-24   
gb|AFW58416.1|  hypothetical protein ZEAMMB73_998053                    110   2e-24   
ref|XP_002300215.2|  aspartyl protease family protein                   110   2e-24   
gb|AAC34482.2|  putative chloroplast nucleoid DNA binding protein       109   2e-24   
ref|XP_008220626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
emb|CDP11493.1|  unnamed protein product                                110   2e-24   
ref|XP_004144695.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    112   2e-24   
ref|XP_009390624.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
ref|XP_010276658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
ref|XP_009377195.1|  PREDICTED: aspartic proteinase nepenthesin-2...    111   2e-24   
gb|AFK40811.1|  unknown                                                 106   2e-24   
ref|XP_006364268.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
ref|XP_002876869.1|  aspartyl protease family protein                   110   2e-24   
ref|XP_010060093.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
ref|XP_006366418.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   3e-24   
ref|XP_009770124.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   3e-24   
ref|XP_009588036.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   3e-24   
ref|XP_002307559.2|  hypothetical protein POPTR_0005s22630g             111   3e-24   
ref|XP_010514086.1|  PREDICTED: aspartic proteinase nepenthesin-1...    110   3e-24   
emb|CDY03014.1|  BnaC07g22130D                                          110   3e-24   
ref|XP_009356605.1|  PREDICTED: aspartic proteinase nepenthesin-2...    110   3e-24   
ref|NP_565298.2|  aspartyl protease family protein                      109   3e-24   
ref|XP_009386344.1|  PREDICTED: aspartic proteinase nepenthesin-2...    109   3e-24   
ref|XP_010266604.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   3e-24   
ref|XP_004291984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   3e-24   
ref|XP_011045692.1|  PREDICTED: aspartic proteinase nepenthesin-1...    109   3e-24   
ref|XP_008664185.1|  PREDICTED: aspartic proteinase nepenthesin-1       111   3e-24   
gb|KEH35638.1|  aspartic proteinase nepenthesin                         109   3e-24   
ref|XP_006648575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   4e-24   
ref|XP_002520371.1|  basic 7S globulin 2 precursor small subunit,...    110   4e-24   
ref|XP_007048585.1|  Eukaryotic aspartyl protease family protein        109   4e-24   
ref|XP_001774247.1|  predicted protein                                  109   4e-24   
ref|XP_006345762.1|  PREDICTED: aspartic proteinase nepenthesin-1...    109   4e-24   
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   4e-24   
ref|XP_009591885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   4e-24   
gb|AAM74221.1|AF518565_1  putative chloroplast nucleoid DNA-bindi...    105   4e-24   
ref|XP_009359072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   4e-24   
ref|XP_010241283.1|  PREDICTED: aspartic proteinase nepenthesin-1...    110   4e-24   
sp|Q766C3.1|NEP1_NEPGR  RecName: Full=Aspartic proteinase nepenth...    109   5e-24   
ref|XP_008784432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   5e-24   
ref|XP_010025709.1|  PREDICTED: aspartic proteinase nepenthesin-1       108   5e-24   
ref|XP_008670374.1|  PREDICTED: aspartic proteinase nepenthesin-2...    109   5e-24   
gb|AFK42325.1|  unknown                                                 105   5e-24   
ref|XP_010241281.1|  PREDICTED: aspartic proteinase nepenthesin-1...    110   6e-24   
dbj|BAJ04354.1|  pollen allergen CPA63                                  109   6e-24   
gb|KJB23742.1|  hypothetical protein B456_004G112400                    109   6e-24   
ref|XP_007018203.1|  Eukaryotic aspartyl protease family protein        108   6e-24   
gb|ADE76437.1|  unknown                                                 107   7e-24   
ref|XP_002967518.1|  hypothetical protein SELMODRAFT_87804              108   7e-24   
gb|KDP26966.1|  hypothetical protein JCGZ_22200                         110   7e-24   
ref|XP_002324351.1|  nucleoid DNA-binding family protein                108   7e-24   
ref|XP_002515387.1|  Aspartic proteinase nepenthesin-2 precursor,...    108   7e-24   
ref|XP_002324352.2|  hypothetical protein POPTR_0018s03010g             108   7e-24   
ref|XP_009342559.1|  PREDICTED: aspartic proteinase nepenthesin-1...    108   7e-24   
ref|XP_009373927.1|  PREDICTED: aspartic proteinase nepenthesin-1...    108   7e-24   
ref|XP_008220627.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   7e-24   
ref|XP_004252715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   8e-24   
emb|CDP17284.1|  unnamed protein product                                108   8e-24   
ref|XP_002309515.1|  nucleoid DNA-binding family protein                108   9e-24   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                          108   9e-24   



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L G+S+GG RV GI  S+FKLDPTGNGGVIVDSGTSVTRLTR AYVA+RDAFR GAS+
Sbjct  318  VGLNGVSVGGTRVPGIAASLFKLDPTGNGGVIVDSGTSVTRLTRPAYVALRDAFRIGASN  377

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK SSEFSLFDTCFDLSGKTEVKVPTVVLH  GADVSLPA+NYLIPVD+EGKFCFAFAGT
Sbjct  378  LKRSSEFSLFDTCFDLSGKTEVKVPTVVLHLEGADVSLPASNYLIPVDSEGKFCFAFAGT  437

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAG+R+GFA  GCA
Sbjct  438  MSGLSIIGNIQQQGFRVVFDLAGNRVGFAPRGCA  471



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L G+S+GG RV G+  S+FKLDPTGNGGVIVDSGTSVTRLTR AYVA+RDAFR GAS+
Sbjct  316  VGLNGVSVGGTRVPGVAASLFKLDPTGNGGVIVDSGTSVTRLTRPAYVALRDAFRIGASN  375

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK SS+FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD+EGKFCFAFAGT
Sbjct  376  LKRSSDFSLFDTCFDLSGKTEVKVPTVVLHFEGADVSLPASNYLIPVDSEGKFCFAFAGT  435

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAG+R+GFA  GCA
Sbjct  436  MSGLSIIGNIQQQGFRVVFDLAGNRVGFAPRGCA  469



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   262 bits (669),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTGIS+GGARV  I PS+FKLD  G+GGVIVDSGTSVTRLTR AYVA+RD+FR GA D
Sbjct  327  VELTGISVGGARVPAIRPSLFKLDAAGDGGVIVDSGTSVTRLTRPAYVALRDSFRMGARD  386

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVV+HFRGADVSLPA+NYLIPVD++G FCFAFAGT
Sbjct  387  LKRAPDFSLFDTCFDLSGKTEVKVPTVVMHFRGADVSLPASNYLIPVDSDGTFCFAFAGT  446

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GCA
Sbjct  447  MSGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCA  480



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GGA VRGI  S+FKLDP GNGGVI+DSGTSVTRLTR AY+A+RDAFR GAS 
Sbjct  327  VELVGISVGGAHVRGITASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRAGASS  386

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA NYLIPVD+ G FCFAFAGT
Sbjct  387  LKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAGT  446

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  447  MSGLSIIGNIQQQGFRVVYDLAASRIGFAPRGCA  480



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GGA VRGI  S+FKLDP GNGGVI+DSGTSVTRLTR AY+A+RDAFR GAS 
Sbjct  327  VELVGISVGGAHVRGITASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRAGASS  386

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA NYLIPVD+ G FCFAFAGT
Sbjct  387  LKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAGT  446

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  447  MSGLSIIGNIQQQGFRVVYDLAASRIGFAPRGCA  480



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RVRGI  S+FKLDP+GNGGVI+DSGTSVTRLTR+AY+++RDAFR GA  
Sbjct  314  IELLGISVGGTRVRGITASLFKLDPSGNGGVIIDSGTSVTRLTRSAYISLRDAFRAGARS  373

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA NYLIPVD+ G FCFAFAGT
Sbjct  374  LKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAGT  433

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
            T GLSIIGNIQQQGFRVV+DLAG R+GFA  GCA
Sbjct  434  TGGLSIIGNIQQQGFRVVYDLAGKRVGFAPRGCA  467



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTG S+GGARV  I PS+FKLD  G+GGVIVDSGTSVTRLTR AYVA+RDAFR GA D
Sbjct  347  VELTGFSVGGARVPAIRPSLFKLDAAGDGGVIVDSGTSVTRLTRPAYVALRDAFRMGAKD  406

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVV+HFRGADVSLPA+NYLIPVD++G FCFAFAGT
Sbjct  407  LKRAPDFSLFDTCFDLSGKTEVKVPTVVMHFRGADVSLPASNYLIPVDSDGTFCFAFAGT  466

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAG+RLGFA  GCA
Sbjct  467  MSGLSIIGNIQQQGFRVVFDLAGNRLGFAPRGCA  500



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTGIS+GG RV  I PS+FKLD  G+GGVIVDSGTSVTRLTR AYVA+RDAFR GA++
Sbjct  338  VELTGISVGGTRVPSIRPSLFKLDAAGDGGVIVDSGTSVTRLTRPAYVALRDAFRIGAAN  397

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVVLHF+GADVSLPA+NYLIPVD++G FCFAFAGT
Sbjct  398  LKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFKGADVSLPASNYLIPVDSDGTFCFAFAGT  457

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GCA
Sbjct  458  MSGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCA  491



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +ELTGIS+GGARV GI  S+FKLD  GNGGVI+DSGTSVTRLTR AYV++RDAFR GA+D
Sbjct  336  LELTGISVGGARVAGITASLFKLDTAGNGGVIIDSGTSVTRLTRRAYVSLRDAFRAGAAD  395

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + ++SLFDTCFDLSGKTEVKVPTVV+HFRGADVSLPA NYLIPVDT G FCFAFAGT
Sbjct  396  LKRAPDYSLFDTCFDLSGKTEVKVPTVVMHFRGADVSLPATNYLIPVDTNGVFCFAFAGT  455

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFD+A SR+GFAA GCA
Sbjct  456  MSGLSIIGNIQQQGFRVVFDVAASRIGFAARGCA  489



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RV GI+ S+FKLD TGNGGVI+DSGTSVTRLTRAAYVA+RDAFR GAS+
Sbjct  352  LELLGISVGGTRVSGISASLFKLDSTGNGGVIIDSGTSVTRLTRAAYVALRDAFRVGASN  411

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD  G FCFAFAGT
Sbjct  412  LKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVDNSGSFCFAFAGT  471

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+D+A SR+GFA  GCA
Sbjct  472  ASGLSIIGNIQQQGFRVVYDVATSRVGFAPRGCA  505



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL G+S+GG RV GI  S+FKLD TGNGGVI+DSGTSVTRLTR AYVA+RDAFR GAS+
Sbjct  339  VELLGVSVGGTRVPGITASLFKLDSTGNGGVIIDSGTSVTRLTRPAYVALRDAFRVGASN  398

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD  G FCFAFAGT
Sbjct  399  LKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVDNSGSFCFAFAGT  458

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  459  MSGLSIIGNIQQQGFRVVYDLAASRVGFAPRGCA  492



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV GI  S+FKLD TGNGGVI+DSGTSVTRLTR AY+A RDAFR GAS+
Sbjct  316  VELLGISVGGTRVPGITASLFKLDQTGNGGVIIDSGTSVTRLTRPAYIAFRDAFRAGASN  375

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVDT G FC AFAGT
Sbjct  376  LKRAPQFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVDTSGNFCLAFAGT  435

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLAGSR+GFA  GCA
Sbjct  436  MGGLSIIGNIQQQGFRVVYDLAGSRVGFAPHGCA  469



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTGIS+GG RV  I PS+FKLD  G+GGVIVDSGTSVTRLTR AYVA+RD+FR GA++
Sbjct  357  VELTGISVGGTRVPSIRPSLFKLDAAGDGGVIVDSGTSVTRLTRPAYVALRDSFRMGAAN  416

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVVLHF+GA+VSLPA+NYLIPVD++G FCFAFAGT
Sbjct  417  LKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFKGAEVSLPASNYLIPVDSDGTFCFAFAGT  476

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GCA
Sbjct  477  MSGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCA  510



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL G+S+GG RV GI  S+FKLD TGNGGVI+DSGTSVTRLTR AYVA+RDAFR GAS+
Sbjct  337  VELLGVSVGGTRVPGITASLFKLDSTGNGGVIIDSGTSVTRLTRPAYVALRDAFRVGASN  396

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD  G FCFAFAGT
Sbjct  397  LKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVDNSGSFCFAFAGT  456

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSI+GNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  457  MSGLSIVGNIQQQGFRVVYDLAASRVGFAPRGCA  490



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG RV GI PS+FK+D  G+GGVIVDSGTSVTRLTR AYVA+RDAFR GAS+
Sbjct  323  VGLNGISVGGVRVPGITPSLFKMDQMGSGGVIVDSGTSVTRLTRPAYVALRDAFRAGASN  382

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD+EGKFCFAFAGT
Sbjct  383  LKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFGGADVSLPASNYLIPVDSEGKFCFAFAGT  442

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFD+A +R+GFAA GCA
Sbjct  443  MSGLSIIGNIQQQGFRVVFDMASNRVGFAARGCA  476



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV GI  S+FKLD TGNGGVI+DSGTSVTRLTR AYVA+R+AFR GAS+
Sbjct  325  VELLGISVGGTRVPGITASLFKLDQTGNGGVIIDSGTSVTRLTRPAYVALRNAFRVGASN  384

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSGKTEVKVPTV LHFRGADVSLPA+NYLIPVD++G FCFAFAGT
Sbjct  385  LKRAPEFSLFDTCFDLSGKTEVKVPTVALHFRGADVSLPASNYLIPVDSDGSFCFAFAGT  444

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  445  MSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGC  477



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL G+S+GGARVRGI  S+FKLD  GNGG+IVDSGTSVTRLTR AY A+RDAFR GAS 
Sbjct  332  VELLGMSVGGARVRGITASLFKLDAAGNGGLIVDSGTSVTRLTRPAYNALRDAFRAGASG  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD++G FCFAFA T
Sbjct  392  LKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVDSQGTFCFAFAAT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSR+GF+  GCA
Sbjct  452  MSGLSIIGNIQQQGFRVVFDLAGSRVGFSPRGCA  485



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GGA VRGI+ S+F+LD TGNGGVI+DSGTSVTRLTR AYVA+RDAFR GAS 
Sbjct  323  LELLGISVGGAPVRGISASLFRLDSTGNGGVIIDSGTSVTRLTRPAYVALRDAFRVGASH  382

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSG +EVKVPTVV+HFRGADVS PAANYLIPVD  G+FCFAFAGT
Sbjct  383  LKRAPEFSLFDTCYDLSGISEVKVPTVVMHFRGADVSFPAANYLIPVDNSGRFCFAFAGT  442

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  443  MSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  476



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GGA VRGI+ S F+LD TGNGGVI+DSGTSVTRLTR AYV++RDAFR GAS 
Sbjct  320  VELLGISVGGAPVRGISASFFRLDSTGNGGVIIDSGTSVTRLTRPAYVSLRDAFRVGASH  379

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSG +EVKVPTVVLHFRGADVSLPAANYL+PVD  G FCFAFAGT
Sbjct  380  LKRAPEFSLFDTCYDLSGLSEVKVPTVVLHFRGADVSLPAANYLVPVDNSGSFCFAFAGT  439

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  440  MSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  473



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GGA VRGI+ S+F+LD TGNGGVI+DSGTSVTRLTR AYVA+RDAFR GAS 
Sbjct  324  LELLGISVGGAPVRGISASLFRLDSTGNGGVIIDSGTSVTRLTRPAYVALRDAFRVGASH  383

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSG +EVKVPTVV+HFRGADVS PAANYLIPVD  G+FCFAFAGT
Sbjct  384  LKRAPEFSLFDTCYDLSGISEVKVPTVVMHFRGADVSFPAANYLIPVDNSGRFCFAFAGT  443

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  444  MSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  477



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GGA VRGI+ S+F+LD TGNGGVI+DSGTSVTRLTR AYVA+RDAFR GAS 
Sbjct  324  LELLGISVGGAPVRGISASLFRLDSTGNGGVIIDSGTSVTRLTRPAYVALRDAFRVGASH  383

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSG +EVKVPTVV+HFRGADVS PAANYLIPVD  G+FCFAFAGT
Sbjct  384  LKRAPEFSLFDTCYDLSGISEVKVPTVVMHFRGADVSFPAANYLIPVDNSGRFCFAFAGT  443

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  444  MSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  477



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV GI+ S+FKLD TGNGGVI+DSGTSVTRLTRAAYVA+RDAF  GAS+
Sbjct  335  VELLGISVGGTRVSGISASLFKLDSTGNGGVIIDSGTSVTRLTRAAYVALRDAFLVGASN  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADV LPA+NYLIPVD  G FCFAFAGT
Sbjct  395  LKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVPLPASNYLIPVDNSGSFCFAFAGT  454

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  455  ASGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  488



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG RV GI  S+FKLD  GNGGVIVDSGTSVTRLTR AYVA+R+AFR GAS+
Sbjct  325  VGLNGISVGGVRVPGITASLFKLDAAGNGGVIVDSGTSVTRLTRPAYVALRNAFRVGASN  384

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LKP+ +FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD++GKFCFAFAGT
Sbjct  385  LKPAPDFSLFDTCFDLSGKTEVKVPTVVLHFAGADVSLPASNYLIPVDSDGKFCFAFAGT  444

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLA +R+GFA  GCA
Sbjct  445  MSGLSIIGNIQQQGFRVVFDLASNRVGFAPRGCA  478



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL  IS+GG+RVRGI+ S+FKLD  GNGGVI+DSGTSVTRLTR AYVA+RDAFR G+ +
Sbjct  338  LELLAISVGGSRVRGISASLFKLDQAGNGGVIIDSGTSVTRLTRPAYVALRDAFRAGSVN  397

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSGKTEVKVPTVVLHFRGADVS PA NYLIPVD+ G FCFAFAGT
Sbjct  398  LKRAPEFSLFDTCYDLSGKTEVKVPTVVLHFRGADVSFPATNYLIPVDSSGTFCFAFAGT  457

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GCA
Sbjct  458  MSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGCA  491



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GGA VRG++ S+FKLDP GNGGVI+DSGTSVTRLTR AY+A+RDAFR GAS 
Sbjct  320  LELLGISVGGAPVRGVSASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRVGASH  379

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSG TEVKVPTVVLHFR +DVSLPA NYLIPVD  G FCFAFAGT
Sbjct  380  LKRAPEFSLFDTCFDLSGLTEVKVPTVVLHFRDSDVSLPATNYLIPVDNSGSFCFAFAGT  439

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  440  MSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGC  472



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G++ S+FKL  TGNGGVI+DSGTSVTRLTR AY+AMRDAFR GA +
Sbjct  314  VELLGISVGGTRVPGVSASLFKLAQTGNGGVILDSGTSVTRLTRPAYIAMRDAFRVGAKN  373

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK ++ FSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  374  LKRATSFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  433

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVV+DL GSR+GFA  GC
Sbjct  434  ASGLSIIGNIQQQGFRVVYDLVGSRVGFAPRGC  466



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RVRGI  S+F LDP GNGGVI+DSGTSVTRLTR+AY A+RDAFR G S 
Sbjct  334  VELIGISVGGTRVRGITASLFNLDPAGNGGVILDSGTSVTRLTRSAYNALRDAFRAGTSG  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK   EFSLFDTCFDLSGKTEVKVPTVVLHFR ADVSLPA NYLIPVD+ G FCFAFAGT
Sbjct  394  LKRGPEFSLFDTCFDLSGKTEVKVPTVVLHFRNADVSLPATNYLIPVDSSGSFCFAFAGT  453

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  454  MGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  487



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLDP GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  328  VELLGISVGGTRVPGVAASLFKLDPIGNGGVIIDSGTSVTRLVRPAYIAMRDAFRVGAKS  387

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + ++SLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  388  LKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  447

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  448  MSGLSIIGNIQQQGFRVVYDLMGSRVGFAPRGCA  481



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L G+S+GGARV GI  S+FKLD +GNGGVIVDSGTSVTRL R AYVA+RDAFR GAS+
Sbjct  321  VGLNGMSVGGARVPGITASLFKLDASGNGGVIVDSGTSVTRLNRPAYVALRDAFRAGASN  380

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK   +FSLFDTCFDLSGKTEVKVPTVV+HF GADVSLPA+NYLIPVD+ GKFCFAFAGT
Sbjct  381  LKRGPDFSLFDTCFDLSGKTEVKVPTVVMHFTGADVSLPASNYLIPVDSNGKFCFAFAGT  440

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVVFDLA +R+GF A+GCA
Sbjct  441  MSGLSIIGNIQQQGFRVVFDLASNRVGFTANGCA  474



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLDP GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  328  VELLGISVGGTRVPGVAASLFKLDPIGNGGVIIDSGTSVTRLVRPAYIAMRDAFRVGAKS  387

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + ++SLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  388  LKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  447

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  448  MSGLSIIGNIQQQGFRVVYDLMGSRVGFAPRGCA  481



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RVRGI  S+FKLDP GNGGVI+DSGTSVTRLTR AY ++RDAFR G S 
Sbjct  315  VELIGISVGGTRVRGITASLFKLDPAGNGGVILDSGTSVTRLTRVAYNSLRDAFRAGTSG  374

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSGK+EVKVPTVVLHFR ADVSLPA NYLIPVD+ G FCFAFAGT
Sbjct  375  LKRAPEFSLFDTCFDLSGKSEVKVPTVVLHFRNADVSLPATNYLIPVDSSGSFCFAFAGT  434

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  435  MGGLSIIGNIQQQGFRVVYDLASSRVGFAPRGCA  468



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  SVFKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR G+  
Sbjct  324  VELLGISVGGTRVPGVTASVFKLDSIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGSRT  383

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +++FSLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  384  LKRATDFSLFDTCFDLSNQNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  443

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  444  MSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGC  476



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG+RV GI  S FKLD  GNGGVIVDSGTSVTRLTR AY+AMRDAFR GAS+
Sbjct  334  VGLNGISVGGSRVPGITESHFKLDAAGNGGVIVDSGTSVTRLTRPAYIAMRDAFRAGASN  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            L+ + +FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD  G+FCFAFAGT
Sbjct  394  LRRAPDFSLFDTCFDLSGKTEVKVPTVVLHFNGADVSLPASNYLIPVDGNGRFCFAFAGT  453

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRV FDLAGSR+GFA  GCA
Sbjct  454  ISGLSIIGNIQQQGFRVSFDLAGSRVGFAPRGCA  487



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RVRG+ PS+FKLD  GNGGVI+DSGTSVTRLTR AY A+RDAFR GA  
Sbjct  364  VELIGISVGGVRVRGVYPSLFKLDSAGNGGVIIDSGTSVTRLTRPAYTALRDAFRAGARH  423

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK   EFSLFDTC+DLSG++ VKVPTVVLHFRGAD+ LPA NYLIPVD  G FCFAFAGT
Sbjct  424  LKRGPEFSLFDTCYDLSGQSSVKVPTVVLHFRGADMPLPATNYLIPVDENGSFCFAFAGT  483

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  484  ISGLSIIGNIQQQGFRVVYDLAGSRIGFAPRGC  516



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLDP GNGGVI+DSGTSVTRL R AYVAMRDAFR  A  
Sbjct  328  VELLGISVGGTRVPGVAASLFKLDPIGNGGVIIDSGTSVTRLVRPAYVAMRDAFRVRARS  387

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + ++SLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  388  LKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  447

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  448  MSGLSIIGNIQQQGFRVVYDLMGSRVGFAPRGCA  481



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG+ VRG++ S+F+LD  GNGGVI+DSGTSVTRLTR AY+A+RDAFR GAS 
Sbjct  319  LELLGISVGGSPVRGLSASLFRLDAAGNGGVIIDSGTSVTRLTRPAYIALRDAFRVGASH  378

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK ++EFSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA NYLIPVD  G FCFAFAGT
Sbjct  379  LKRAAEFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVDNSGSFCFAFAGT  438

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRV FDLAGSR+GFA  GC
Sbjct  439  MSGLSIIGNIQQQGFRVSFDLAGSRVGFAPRGC  471



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG  V GI  S FKLD TGNGGVI+D GTSVTRL + AY+A+RDAFR GAS 
Sbjct  231  VELLGISVGGTPVSGITASHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASS  290

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD  G+FCFAFAGT
Sbjct  291  LKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAGT  350

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
            TSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  351  TSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  384



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  333  VELLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGAKT  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVD+ GKFCFAFAGT
Sbjct  393  LKRAPDFSLFDTCFDLSNQNEVKVPTVVLHFRGADVSLPATNYLIPVDSNGKFCFAFAGT  452

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  453  MSGLSIIGNIQQQGFRVVYDLTGSRVGFAPRGCA  486



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GGA VRG++ S+F+LD  GNGGVI+DSGTSVTRLTR AY+A+RDAFR GAS 
Sbjct  308  LELLGISVGGAPVRGLSASLFRLDAAGNGGVIIDSGTSVTRLTRPAYIALRDAFRIGASH  367

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA NYLIPVD  G FCFAFAGT
Sbjct  368  LKRAPEFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVDNSGSFCFAFAGT  427

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFR+ +DL GSR+GFA  GC
Sbjct  428  MSGLSIIGNIQQQGFRISYDLTGSRVGFAPRGC  460



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   248 bits (633),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG  VRG++ S+F+LD  GNGGVI+DSGTSVTRLTR AY+A+RDAFR GAS 
Sbjct  381  VELLGISVGGTPVRGLSASLFRLDSAGNGGVIIDSGTSVTRLTRPAYIALRDAFRVGASR  440

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +SEFSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA+NYLIPVD  G FCFAFAGT
Sbjct  441  LKRASEFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPASNYLIPVDNSGSFCFAFAGT  500

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRV +DL GSR+GFA  GC
Sbjct  501  MSGLSIIGNIQQQGFRVSYDLGGSRVGFAPRGC  533



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG  V GI+ S FKLD TGNGGVI+D GTSVTRL + AY+A+RDAFR GAS 
Sbjct  321  VELLGISVGGTPVSGISSSHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASS  380

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD  G+FCFAFAGT
Sbjct  381  LKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAGT  440

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
            TSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  441  TSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  474



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RV  I PS+FK+D  GNGGVI+DSGTSVTRLTR AY+AMRDAFR GAS+
Sbjct  335  IELLGISVGGIRVPRITPSLFKMDQAGNGGVIIDSGTSVTRLTRPAYIAMRDAFRIGASN  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKT VKVPTVVLHFRGADVSLPA NYLIPVD  G FCFAFAGT
Sbjct  395  LKGAPDFSLFDTCFDLSGKTSVKVPTVVLHFRGADVSLPATNYLIPVDGSGTFCFAFAGT  454

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRV +DLAGSR+GF   GC
Sbjct  455  MSGLSIIGNIQQQGFRVSYDLAGSRIGFTPRGC  487



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG RVRG++PS+FKLD  GNGGVI+DSGTSVTRLTR AY A+RDAFR GA  
Sbjct  300  VGLIGISVGGVRVRGVSPSLFKLDSAGNGGVIIDSGTSVTRLTRPAYTALRDAFRVGARH  359

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK   EFSLFDTC+DLSG++ VKVPTVVLHFRGAD++LPA NYLIPVD  G FCFAFAGT
Sbjct  360  LKRGPEFSLFDTCYDLSGQSSVKVPTVVLHFRGADMALPATNYLIPVDENGSFCFAFAGT  419

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  420  ISGLSIIGNIQQQGFRVVYDLAGSRIGFAPRGC  452



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG  V GI  S FKLD TGNGGVI+D GTSVTRL + AY+A+RDAFR GAS 
Sbjct  318  VELLGISVGGTPVSGITASHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASS  377

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD  G+FCFAFAGT
Sbjct  378  LKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAGT  437

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
            TSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  438  TSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  471



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG  V GI  S FKLD TGNGGVI+D GTSVTRL + AY+A+RDAFR GAS 
Sbjct  359  VELLGISVGGTPVSGITASHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASS  418

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD  G+FCFAFAGT
Sbjct  419  LKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAGT  478

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
            TSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  479  TSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  512



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTGIS+GG +V  + P +FKLD  GNGGVIVDSGTSVTRLTR  Y+A+RDAFR GA D
Sbjct  304  VELTGISVGGTKVPAVTPELFKLDAEGNGGVIVDSGTSVTRLTRPGYIAVRDAFRLGAKD  363

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  FSLFDTC+DLSGK + KVPT+VLHF GADV+LPAANY+IPV+TEG++CF FAGT
Sbjct  364  LKRAPNFSLFDTCYDLSGKKQAKVPTMVLHFAGADVALPAANYMIPVNTEGRYCFGFAGT  423

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVVFDLAGSRLGFA  GC+
Sbjct  424  NGGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCS  457



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL G S+GG RV GI  S+FKLD  GNGGVI+DSGTSVTRLTR+AY A+RDAFR G S 
Sbjct  333  VELIGXSVGGTRVPGITASLFKLDRAGNGGVILDSGTSVTRLTRSAYNALRDAFRAGTSG  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK   +FSLFDTCFDLSGKTEVKVPTVVLHFR ADVSLPAANYLIPVD+ G FCFAFAGT
Sbjct  393  LKRGPQFSLFDTCFDLSGKTEVKVPTVVLHFRNADVSLPAANYLIPVDSSGSFCFAFAGT  452

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  453  MGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  486



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL G S+GG RV GI  S+FKLD  GNGGVI+DSGTSVTRLTR AY A+RDAFR G S 
Sbjct  333  VELIGXSVGGTRVPGITASLFKLDRAGNGGVILDSGTSVTRLTRXAYNALRDAFRAGTSG  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK   +FSLFDTCFDLSGKTEVKVPTVVLHFR ADVSLPAANYLIPVD+ G FCFAFAGT
Sbjct  393  LKRGPQFSLFDTCFDLSGKTEVKVPTVVLHFRNADVSLPAANYLIPVDSSGSFCFAFAGT  452

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  453  MGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  486



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  328  VELLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGART  387

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  388  LKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  447

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  448  MGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  481



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  332  VELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGAKA  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  392  LKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  452  MGGLSIIGNIQQQGFRVVYDLASSRVGFAPGGCA  485



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV GI  S+FKLD  GNGGVI+DSGTSVTRLTR AY A+RDAFR G S 
Sbjct  332  VELIGISVGGTRVPGITASLFKLDQAGNGGVILDSGTSVTRLTRPAYNALRDAFRAGTSG  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK   +FSLFDTCFDLSG+TEVKVPTVVLHFR ADVSLPA NYLIPVD+ G FCFAFAGT
Sbjct  392  LKRGPQFSLFDTCFDLSGRTEVKVPTVVLHFRNADVSLPATNYLIPVDSSGSFCFAFAGT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  452  MGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  485



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            + LTGIS+GG+RV G+ PS+FKLD +G GGVI+DSGTSVTRLTR AYVA+RDAFR GA  
Sbjct  309  IGLTGISVGGSRVPGVTPSLFKLDSSGAGGVIIDSGTSVTRLTRPAYVALRDAFRIGAYH  368

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            L  + +FSLFDTC+DLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVDT G+FCFAFAGT
Sbjct  369  LNRAPDFSLFDTCYDLSGKTEVKVPTVVLHFEGADVSLPASNYLIPVDTSGRFCFAFAGT  428

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRV FDLA +R+GFA  GC
Sbjct  429  MSGLSIIGNIQQQGFRVSFDLASNRVGFAPRGC  461



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  331  VELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGART  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  391  LKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  450

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  451  MGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  484



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  332  VELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGART  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  392  LKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  452  MGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  485



>gb|KJB09627.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=416

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RV  I+PS+FK+D  GNGGVI+DSGTSVTRLT+ AY A RDAFR GA+ 
Sbjct  263  IELLGISVGGTRVPKISPSLFKMDQDGNGGVIIDSGTSVTRLTQPAYTATRDAFRLGATH  322

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSG+T VKVPT+VLHFRGAD+SLPA NYLIPVD+ G FCFAFAGT
Sbjct  323  LKRAPDFSLFDTCFDLSGQTSVKVPTLVLHFRGADLSLPATNYLIPVDSSGTFCFAFAGT  382

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             +GLSIIGNIQQQGFRV +DLAGSR+GF+  GCA
Sbjct  383  MNGLSIIGNIQQQGFRVAYDLAGSRVGFSPRGCA  416



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GGA VRG++ S+FKLD  GNGGVI+DSGTSVTRLTR AY+A+RDAFR GA+ 
Sbjct  332  VGLLGISVGGAPVRGVSASLFKLDTAGNGGVIIDSGTSVTRLTRPAYIALRDAFRLGATH  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + EFSLFDTCFDLSG TEVKVPT+VLHF+GADVSLPA NYLIPVD  G FCFAFAGT
Sbjct  392  LKKAPEFSLFDTCFDLSGLTEVKVPTLVLHFQGADVSLPAQNYLIPVDNSGSFCFAFAGT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRV +DLA SR+GFA  GC
Sbjct  452  MSGLSIIGNIQQQGFRVSYDLATSRVGFAPKGC  484



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTGIS+GG +V  + P +FKLD  GNGGVIVDSGTSVTRLTR  Y+A+RDAFR GA D
Sbjct  307  VELTGISVGGTKVPAVTPELFKLDTEGNGGVIVDSGTSVTRLTRPGYIAVRDAFRLGAKD  366

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  FSLFDTC+DLSGKT+ KVPT+VLHF GADV+LPAANY+IPV+ EG++C  FAGT
Sbjct  367  LKRAPNFSLFDTCYDLSGKTQAKVPTLVLHFAGADVALPAANYMIPVNGEGRYCLGFAGT  426

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVVFDLAGSRLGFA  GC+
Sbjct  427  NGGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCS  460



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  332  VGLLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGAKT  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  392  LKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  452  MGGLSIIGNIQQQGFRVVYDLASSRVGFAPGGCA  485



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  335  VELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGART  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLS   EVKVPTVVLHFR ADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  395  LKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFREADVSLPATNYLIPVDTNGKFCFAFAGT  454

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  455  MGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  488



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RV  I+PS+FK+D  GNGGVI+DSGTSVTRLT+ AY A RDAFR GA+ 
Sbjct  335  IELLGISVGGTRVPKISPSLFKMDQDGNGGVIIDSGTSVTRLTQPAYTATRDAFRLGATH  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSG+T VKVPT+VLHFRGAD+SLPA NYLIPVD+ G FCFAFAGT
Sbjct  395  LKRAPDFSLFDTCFDLSGQTSVKVPTLVLHFRGADLSLPATNYLIPVDSSGTFCFAFAGT  454

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             +GLSIIGNIQQQGFRV +DLAGSR+GF+  GCA
Sbjct  455  MNGLSIIGNIQQQGFRVAYDLAGSRVGFSPRGCA  488



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+L GIS+GG RV  I PS+FK+D  GNGGVI+DSGTSVTRLTR AY+A+R+AFR G+S+
Sbjct  335  VQLLGISVGGTRVPKIRPSLFKMDRDGNGGVIIDSGTSVTRLTRPAYIALRNAFRLGSSN  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  FSLFDTC+D SGKT VKVPTVVLHFRGADVSLPA NYLIPVD+ G FCFAFAGT
Sbjct  395  LKRAPAFSLFDTCYDFSGKTSVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAGT  454

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             SGLSIIGNIQQQGF V +DLAGSR+GF  +GCA
Sbjct  455  MSGLSIIGNIQQQGFLVAYDLAGSRIGFKPNGCA  488



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG+RV GI   +FK+D TGNGGVIVDSGTSVTRLTR AY+A+RDAFR GA+ 
Sbjct  331  VELVGISVGGSRVPGITGELFKIDRTGNGGVIVDSGTSVTRLTRPAYMALRDAFRAGATS  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  FSLFDTC+DLSGKTEV+VPTVV+H+ GADV+LPA NYLIPVDT G+FCFAFAGT
Sbjct  391  LKSAPGFSLFDTCYDLSGKTEVRVPTVVMHYNGADVALPANNYLIPVDTSGRFCFAFAGT  450

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRV+FD+A +R+GF+ + C
Sbjct  451  MSGLSIIGNIQQQGFRVLFDVASNRVGFSPNAC  483



>dbj|BAF01866.1| chloroplast nucleoid DNA binding protein like [Arabidopsis thaliana]
Length=142

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  707  VRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDT  528
            V G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDT
Sbjct  1    VPGVTASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGAKTLKRAPDFSLFDT  60

Query  527  CFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQ  348
            CFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQ
Sbjct  61   CFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQ  120

Query  347  QGFRVVFDLAGSRLGFAASGCA  282
            QGFRVV+DLA SR+GFA  GCA
Sbjct  121  QGFRVVYDLASSRVGFAPGGCA  142



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG RV G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  
Sbjct  332  VGLLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGAKT  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  FSLFDTCFDLS   EVKVPTVVLHFR ADVSLPA NYLIPVDT GKFCFAFAGT
Sbjct  392  LKRAPNFSLFDTCFDLSNMNEVKVPTVVLHFRRADVSLPATNYLIPVDTNGKFCFAFAGT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
              GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  452  MGGLSIIGNIQQQGFRVVYDLASSRVGFAPGGCA  485



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RV  I PS+FK+D  GNGGVI+DSGTSVTRLTR AY+AMRDAFR GAS+
Sbjct  335  IELLGISVGGIRVPRITPSLFKMDQAGNGGVIIDSGTSVTRLTRPAYIAMRDAFRIGASN  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK + +FSLFDTCFDLSGKT VKVPTVVLHFRGADVSLPA NYLIPVD  G FCFAFAGT
Sbjct  395  LKGAPDFSLFDTCFDLSGKTSVKVPTVVLHFRGADVSLPATNYLIPVDGSGTFCFAFAGT  454

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLG  303
             SGLSIIGNIQQQGFRV +DLAGSR+G
Sbjct  455  MSGLSIIGNIQQQGFRVSYDLAGSRIG  481



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTGIS+GG RV GI P +FKL   GNGGVIVDSGTSVTRLT+ AYVA+RDAFR G  +
Sbjct  321  VELTGISVGGTRVPGITPELFKLGADGNGGVIVDSGTSVTRLTQPAYVALRDAFRLGTKN  380

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTC+DLSGKTEVKVPT+VLHF+ AD++LPA+NYLIPV +  +FCF FAGT
Sbjct  381  LKRAPNYSLFDTCYDLSGKTEVKVPTLVLHFKDADLALPASNYLIPVSSGRRFCFGFAGT  440

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVVFD+AGSRLGFA  GC
Sbjct  441  ASGLSIIGNIQQQGFRVVFDVAGSRLGFAPRGC  473



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RVRG+  S+FK  P GNGGVI+DSGTSVTRLTRAAYVA+RDAFR GAS 
Sbjct  358  LELLGISVGGTRVRGVTASLFKTAPAGNGGVIIDSGTSVTRLTRAAYVALRDAFRAGASR  417

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA NYLIPVD++G+FCFAFAGT
Sbjct  418  LKRAPAYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPATNYLIPVDSKGRFCFAFAGT  477

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
              GLSI GNIQQQ FRVV+DL GSR+GFA  GC
Sbjct  478  MGGLSIFGNIQQQSFRVVYDLIGSRVGFAPRGC  510



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTGIS+GG RV  I   +FKL   G+GGVIVDSGTSVTRLTR AYVA+RDAF  G  +
Sbjct  321  VELTGISVGGTRVPLITSELFKLGANGDGGVIVDSGTSVTRLTRPAYVALRDAFSLGTKN  380

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTC+DLSGKTEVKVPT+VLHF+ ADV+LPA+NYLIPV +EG+FCF FAGT
Sbjct  381  LKRAPNYSLFDTCYDLSGKTEVKVPTLVLHFKDADVALPASNYLIPVSSEGRFCFGFAGT  440

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GC
Sbjct  441  ASGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGC  473



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RVRG++ S FKLDPTG+GGVI+DSGTSVTRLTR AYVA RDAF  GA+ 
Sbjct  333  LQLLGISVGGSRVRGVSESQFKLDPTGDGGVIIDSGTSVTRLTRPAYVAFRDAFLLGATR  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA+NYLIPV+T+G+FCFAFA T
Sbjct  393  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPASNYLIPVNTQGRFCFAFAST  452

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  453  MGSLSIIGNIQQQGFRVAYDLVGSRVGFMSGAC  485



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RV G++ S FKLD TGNGGVI+DSGTSVTRLT++AYVA+RDAFR GA+ 
Sbjct  334  LQLLGISVGGSRVPGVSESQFKLDATGNGGVIIDSGTSVTRLTQSAYVALRDAFRLGATK  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+TEG+FCFAFAGT
Sbjct  394  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVNTEGRFCFAFAGT  453

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  454  MGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  486



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RV G++ S FKLD TGNGGVI+DSGTSVTRLT+ AYVA+RDAFR GA+ 
Sbjct  331  LQLLGISVGGSRVPGVSESQFKLDATGNGGVIIDSGTSVTRLTQPAYVALRDAFRLGATK  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+TEG+FCFAFAGT
Sbjct  391  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVNTEGRFCFAFAGT  450

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  451  MGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  483



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RVRG++ S FKLD TGNGGVI+DSGTSVTRLT++AYVA+RDAFR GA  
Sbjct  331  LQLLGISVGGSRVRGVSESQFKLDATGNGGVIIDSGTSVTRLTQSAYVALRDAFRLGAKR  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG + VKVPTVV HF G +VSLPA+NYLIPV+T+G+FCFAFAGT
Sbjct  391  LKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGT  450

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF    C
Sbjct  451  MGSLSIIGNIQQQGFRVAYDLTGSRVGFLPRAC  483



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RVRG++ S FKLD TGNGGVI+DSGTSVTRLT++AYVA+RDAFR GA  
Sbjct  331  LQLLGISVGGSRVRGVSESQFKLDATGNGGVIIDSGTSVTRLTQSAYVALRDAFRLGAKR  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG + VKVPTVV HF G +VSLPA+NYLIPV+T+G+FCFAFAGT
Sbjct  391  LKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGT  450

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF    C
Sbjct  451  MGSLSIIGNIQQQGFRVAYDLTGSRVGFLPRAC  483



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RVRG++ S FKLD TG+GGVI+DSGTSVTRLT+ AYVA+RDAFR GA  
Sbjct  331  LQLLGISVGGSRVRGVSESQFKLDATGSGGVIIDSGTSVTRLTQPAYVALRDAFRLGARS  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+T+G+FCFAFAGT
Sbjct  391  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGT  450

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  451  MGSLSIIGNIQQQGFRVAYDLVGSRIGFLSRAC  483



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RV G++ S FKLDPTG+GGVI+DSGTSVTRLTR AYVA RDAF  GA+ 
Sbjct  333  LQLLGISVGGSRVPGVSESQFKLDPTGDGGVIIDSGTSVTRLTRPAYVAFRDAFLLGATR  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA+NYLIPV+++G+FCFAFAGT
Sbjct  393  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPASNYLIPVNSQGRFCFAFAGT  452

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  453  MGNLSIIGNIQQQGFRVAYDLVGSRVGFMSGAC  485



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RV G++ S FKLDPTG+GGVI+DSGTSVTRLTR AYVA RDAF  GA+ 
Sbjct  333  LQLLGISVGGSRVPGVSESQFKLDPTGDGGVIIDSGTSVTRLTRPAYVAFRDAFLLGATR  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA+NYLIPV+++G+FCFAFAGT
Sbjct  393  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPASNYLIPVNSQGRFCFAFAGT  452

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  453  MGSLSIIGNIQQQGFRVAYDLVGSRVGFMSGAC  485



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RV G++ S FKLD TGNGGVI+DSGTSVTRLT++AYVA+RDAFR GA+ 
Sbjct  332  LQLLGISVGGSRVPGVSESQFKLDATGNGGVIIDSGTSVTRLTQSAYVALRDAFRLGATR  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+ +G+FCFAFAGT
Sbjct  392  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFTGGEVSLPASNYLIPVNNQGRFCFAFAGT  451

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  452  MGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  484



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RVRG++ S FKLD TGNGGVI+DSGTSVTRLT++AYVA+RDAFR  A  
Sbjct  331  LQLLGISVGGSRVRGVSESQFKLDATGNGGVIIDSGTSVTRLTQSAYVALRDAFRLAAKR  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG + VKVPTVV HF G +VSLPA+NYLIPV+T+G+FCFAFAGT
Sbjct  391  LKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGT  450

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF    C
Sbjct  451  MGSLSIIGNIQQQGFRVAYDLTGSRVGFLPRAC  483



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RVRG++ S FKLD TG+GGVI+DSGTSVTRLT+ AYVA+RDAFR GA+ 
Sbjct  336  LQLLGISVGGSRVRGVSESQFKLDATGSGGVIIDSGTSVTRLTQPAYVALRDAFRLGATS  395

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG   VKVPTVV HF G +VSLPA+NYLIPV+T+G+FCFAFAGT
Sbjct  396  LKRAPPYSLFDTCFDLSGMKTVKVPTVVFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGT  455

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  456  MGSLSIIGNIQQQGFRVAYDLVGSRIGFLSRAC  488



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG+RVRG++ S FKLD TG+GGVI+DSGTSVTRL + AYVA+RDAFR GA  
Sbjct  334  LQLLGISVGGSRVRGVSESQFKLDSTGSGGVIIDSGTSVTRLAQPAYVALRDAFRLGARS  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+T+G+FCFAFAGT
Sbjct  394  LKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGT  453

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  454  MGSLSIIGNIQQQGFRVAYDLVGSRIGFLSRAC  486



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++L GIS+GG RV G++ + FKLD +GNGGVI+DSGTSVTRLT++AYVA+RDAFR GAS 
Sbjct  333  LQLLGISVGGTRVPGVSETQFKLDASGNGGVIIDSGTSVTRLTQSAYVALRDAFRLGASK  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            LK +  +SLFDTC+DL G T VKVPTVV HF G +VSLPA+NYLIPV+T+G+FCFAFAGT
Sbjct  393  LKRAPSYSLFDTCYDLIGMTTVKVPTVVFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGT  452

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  453  IGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  485



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG RV GI  S+FK+D  GNGGVI+DSGTSVTRLTR AYVA+RDAFR GA  
Sbjct  330  VELIGISVGGVRVPGITASLFKMDSAGNGGVIIDSGTSVTRLTRPAYVALRDAFRAGAIQ  389

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK +  FSLFDTC+DLSGKT VKVPTVV+HFR GAD+SLPAANYLIPVD+ G FCFAFAG
Sbjct  390  LKRAEGFSLFDTCYDLSGKTVVKVPTVVMHFRGGADLSLPAANYLIPVDSNGIFCFAFAG  449

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
            TTSGLSI+GNIQQQGFRVVFD A SR+GFAA GCA
Sbjct  450  TTSGLSIVGNIQQQGFRVVFDGASSRIGFAAHGCA  484



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            VELTGIS+GG+RV G++    +LDP TG GGVIVDSGTSVTRL R AY AMRDAF+ GA+
Sbjct  352  VELTGISVGGSRVAGVSAVDLRLDPATGRGGVIVDSGTSVTRLARPAYAAMRDAFKAGAA  411

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            DL+ +   FSLFDTC++L+GKTEVKVPTVV+H  G A VSLPA NYLIPVDT+G FCFAF
Sbjct  412  DLREAPGGFSLFDTCYNLAGKTEVKVPTVVMHLGGGASVSLPAENYLIPVDTKGTFCFAF  471

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT SG+SIIGNIQQQGFRVVFD A SR+GF   GC
Sbjct  472  AGTDSGVSIIGNIQQQGFRVVFDGARSRVGFMPRGC  507



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            VEL GIS+GG+RV G++ +V +LDP TG GGVIVDSGTSVTRL R AY AMRDAF+  A+
Sbjct  349  VELMGISVGGSRVAGVSAAVLRLDPATGKGGVIVDSGTSVTRLARQAYAAMRDAFKAAAA  408

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            +L+ +   FSLFDTC++L+G+T+VKVPTVV+H  G A VSLPA NYLIPVDT+G FCFAF
Sbjct  409  ELREAPGGFSLFDTCYNLAGRTQVKVPTVVMHLGGGAAVSLPAENYLIPVDTKGTFCFAF  468

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT SG+SIIGNIQQQGFRVVFD A SR+GF   GC
Sbjct  469  AGTDSGVSIIGNIQQQGFRVVFDGAQSRVGFMPLGC  504



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 124/156 (79%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            VEL G+S+GG RV G+  S  +LDPT G GGVIVDSGTSVTRL R AY A+RDAF+ G S
Sbjct  344  VELMGVSVGGTRVTGVLASDLRLDPTTGRGGVIVDSGTSVTRLARPAYQALRDAFKAGVS  403

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             LK +   FSLFDTC+DLSG+TEVKVPTVVLH  G A VSLPA NYLIPVDT+G FCFAF
Sbjct  404  GLKLAPGGFSLFDTCYDLSGRTEVKVPTVVLHLAGGAAVSLPAENYLIPVDTKGTFCFAF  463

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT SG+SIIGNIQQQGFRVVFD   SR+GF   GC
Sbjct  464  AGTDSGVSIIGNIQQQGFRVVFDAEKSRVGFMPRGC  499



>ref|XP_008795461.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=343

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 128/156 (82%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            VELT IS+GG+RV G++ +   L+P TG GGVIVDSGTSVTRL R AY A+RDAF+ GA+
Sbjct  188  VELTAISVGGSRVAGVSAAGLGLNPATGRGGVIVDSGTSVTRLARPAYAALRDAFKAGAA  247

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            +L+ +   FSLFDTC+DL+GKTEVKVPTVV+H  G A V+LPA NYLIPVDT+G FCFAF
Sbjct  248  ELREAPGGFSLFDTCYDLAGKTEVKVPTVVMHLGGGASVALPAENYLIPVDTKGTFCFAF  307

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            A T +G+SIIGNIQQQGFRVVFD+A SR+GF   GC
Sbjct  308  AETDNGVSIIGNIQQQGFRVVFDVARSRVGFLPRGC  343



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            VELTGIS+GG++V G++ +  +L+P TG GGVIVDSGTSVTRL R AY A+RDAF+ GA+
Sbjct  353  VELTGISVGGSQVAGVSAADLRLNPATGKGGVIVDSGTSVTRLVRPAYAALRDAFKAGAA  412

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            +L+ +   FSLFDTC++L+GKTEVKVPTVV+H  G A V LPA NYLIPVDT+G FCFAF
Sbjct  413  ELREAPGGFSLFDTCYNLAGKTEVKVPTVVMHLGGGASVPLPAENYLIPVDTKGTFCFAF  472

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT SG+SIIGNIQQQGFRVVFD A SR+GF   GC
Sbjct  473  AGTESGVSIIGNIQQQGFRVVFDGARSRVGFLPRGC  508



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL GIS+GG R+  I  SVF++D TGNGGVI+DSGTSVTRL  +AY  MRDAFR G  +
Sbjct  342  VELVGISVGGRRLTSIPASVFRMDATGNGGVIIDSGTSVTRLVDSAYSTMRDAFRVGTGN  401

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK +  FSLFDTC+DLSG   VKVPT+V HF+ GA +SLPA NYLIPVD+   FCFAFAG
Sbjct  402  LKSAGGFSLFDTCYDLSGLKTVKVPTLVFHFQGGAHISLPATNYLIPVDSSATFCFAFAG  461

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T GLSIIGNIQQQG+RVVFD   +R+GF A  C
Sbjct  462  NTGGLSIIGNIQQQGYRVVFDSLANRVGFKAGSC  495



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L GIS+GGAR+  I+ S+F+LDPTGNGGVIVDSGTSVTRL  +AY  +RDAFR GA+ L 
Sbjct  338  LVGISVGGARLP-ISSSLFRLDPTGNGGVIVDSGTSVTRLVSSAYDVVRDAFRAGATGLP  396

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +  FSLFDTC++L G+  VKVPT+V HF  GAD+SLPA+NYLIPV+ +G FCFAFAGT 
Sbjct  397  LADSFSLFDTCYNLGGRDVVKVPTMVFHFDGGADLSLPASNYLIPVNNQGVFCFAFAGTR  456

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
            SGLSIIGNIQQQGF VVFD   SR+GF   GCA
Sbjct  457  SGLSIIGNIQQQGFSVVFDGKNSRIGFVPKGCA  489



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 122/156 (78%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP TG GGVIVDSGTSVTRL R AY A+RDAFR  A+
Sbjct  338  VQLVGISVGGARVPGVAESDLRLDPSTGRGGVIVDSGTSVTRLARPAYSALRDAFRGAAA  397

Query  566  DLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S S FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYLIPVD++G FCFAF
Sbjct  398  GLRLSPSGFSLFDTCYDLGGRKVVKVPTVSMHFAGGAEAALPPENYLIPVDSKGTFCFAF  457

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  458  AGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  493



>ref|NP_001183392.1| uncharacterized protein LOC100501808 [Zea mays]
 gb|ACR36629.1| unknown [Zea mays]
Length=342

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 120/158 (76%), Gaps = 6/158 (4%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP TG GGVIVDSGTSVTRL RA+Y A+RDAFR  A+
Sbjct  186  VQLVGISVGGARVPGVAESDLRLDPSTGRGGVIVDSGTSVTRLARASYSALRDAFRAAAA  245

Query  566  ---DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCF  399
                L P   FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYLIPVD+ G FCF
Sbjct  246  GGLRLSPGG-FSLFDTCYDLGGRRVVKVPTVSMHFAGGAEAALPPENYLIPVDSRGTFCF  304

Query  398  AFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AFAGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  305  AFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  342



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 121/156 (78%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP+ G GGVIVDSGTSVTRL R AY A+RDAFR  A+
Sbjct  339  VQLVGISVGGARVSGVADSDLRLDPSSGRGGVIVDSGTSVTRLARPAYSALRDAFRAAAA  398

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIPVD++G FCFAF
Sbjct  399  GLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIPVDSKGTFCFAF  458

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD  G R+GF   GC
Sbjct  459  AGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFVPKGC  494



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP TG GGVIVDSGTSVTRL R AY A+RDAFR  A+
Sbjct  345  VQLMGISVGGARVPGVAVSDLRLDPSTGRGGVIVDSGTSVTRLARPAYAALRDAFRAAAA  404

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC+DLSG   VKVPTV +HF G A+ +LP  NYLIPVD+ G FCFAF
Sbjct  405  GLRLSPGGFSLFDTCYDLSGLKVVKVPTVSMHFAGGAEAALPPENYLIPVDSRGTFCFAF  464

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD  G RLGF   GC
Sbjct  465  AGTDGGVSIIGNIQQQGFRVVFDGDGQRLGFVPKGC  500



>gb|EMS49734.1| Aspartic proteinase nepenthesin-1 [Triticum urartu]
Length=352

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 120/156 (77%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP+ G GGVIVDSGTSVTRL R AY A+RDAFR  A+
Sbjct  197  VQLIGISVGGARVPGVANSDLRLDPSSGRGGVIVDSGTSVTRLARPAYSALRDAFRGAAA  256

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIPVD++G FCFAF
Sbjct  257  GLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIPVDSKGTFCFAF  316

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD  G R+ F   GC
Sbjct  317  AGTDGGVSIIGNIQQQGFRVVFDGDGQRVAFVPKGC  352



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 120/156 (77%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP TG GGVIVDSGTSVTRL R +Y A+RDAFR  A+
Sbjct  338  VQLVGISVGGARVPGVAESDLRLDPSTGRGGVIVDSGTSVTRLARPSYSALRDAFRAAAA  397

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYLIPVD+ G FCFAF
Sbjct  398  GLRLSPGGFSLFDTCYDLGGRKVVKVPTVSMHFAGGAEAALPPENYLIPVDSRGTFCFAF  457

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  458  AGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  493



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 120/158 (76%), Gaps = 6/158 (4%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP TG GGVIVDSGTSVTRL RA+Y A+RDAFR  A+
Sbjct  329  VQLVGISVGGARVPGVAESDLRLDPSTGRGGVIVDSGTSVTRLARASYSALRDAFRAAAA  388

Query  566  ---DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCF  399
                L P   FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYLIPVD+ G FCF
Sbjct  389  GGLRLSPGG-FSLFDTCYDLGGRRVVKVPTVSMHFAGGAEAALPPENYLIPVDSRGTFCF  447

Query  398  AFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AFAGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  448  AFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  485



>dbj|BAJ86414.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 120/156 (77%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP+ G GGVIVDSGTSVTRL R AY A+RDAFR  A+
Sbjct  337  VQLIGISVGGARVPGVANSDLRLDPSSGRGGVIVDSGTSVTRLARPAYSALRDAFRGAAA  396

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIPVD++G FCFAF
Sbjct  397  GLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIPVDSKGTFCFAF  456

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD  G R+ F   GC
Sbjct  457  AGTDGGVSIIGNIQQQGFRVVFDGDGQRVAFTPKGC  492



>emb|CDM83204.1| unnamed protein product [Triticum aestivum]
Length=492

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 120/156 (77%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V+L GIS+GGARV G+  S  +LDP+ G GGVIVDSGTSVTRL R AY A+RDAFR  A+
Sbjct  337  VQLIGISVGGARVPGVANSDLRLDPSSGRGGVIVDSGTSVTRLARPAYSALRDAFRGAAA  396

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIPVD++G FCFAF
Sbjct  397  GLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIPVDSKGTFCFAF  456

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD  G R+ F   GC
Sbjct  457  AGTDGGVSIIGNIQQQGFRVVFDGDGQRVAFVPKGC  492



>ref|XP_001757102.1| predicted protein [Physcomitrella patens]
 gb|EDQ77961.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 3/154 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +++TGIS+GG  +  I  S F+LD  GNGGVI+DSGTSVTRL  AAY ++RDAFR G SD
Sbjct  254  LKMTGISVGGT-ILTIPTSAFQLDSLGNGGVIIDSGTSVTRLQNAAYASLRDAFRAGTSD  312

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L P++ FSLFDTC+DLSG   V VPTV LHF+ G D+ LPA+NYLIPVD    FC AFAG
Sbjct  313  LAPTAGFSLFDTCYDLSGLASVDVPTVTLHFQGGTDLKLPASNYLIPVDNSNTFCLAFAG  372

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TT G SIIGNIQQQGFRV++D   +++GF  S C
Sbjct  373  TT-GPSIIGNIQQQGFRVIYDNLHNQVGFVPSQC  405



>ref|XP_001759252.1| predicted protein [Physcomitrella patens]
 gb|EDQ75936.1| predicted protein [Physcomitrella patens]
Length=385

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +++TGIS+GG+ +  I  S F+LD  GNGGVI+DSGTSVTRL  AAY ++R+AFR G SD
Sbjct  233  LKMTGISVGGS-ILTIPTSAFQLDSLGNGGVIIDSGTSVTRLQNAAYASLREAFRAGTSD  291

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++EFSLFDTC++LS  + V VPTV LHF+ GAD+ LPA+NYL+PVD    FC AFAG
Sbjct  292  LVLTTEFSLFDTCYNLSDLSSVDVPTVTLHFQGGADLKLPASNYLVPVDNSSTFCLAFAG  351

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TT G SIIGNIQQQGFRV++D   +++GF  S C
Sbjct  352  TT-GPSIIGNIQQQGFRVIYDNLHNQVGFVPSQC  384



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  + PS+F +D +GNGG+IVDSGT++TRL   AY ++RDAF++  SD
Sbjct  335  VGLTGFSVGGQPV-SVPPSLFAVDQSGNGGIIVDSGTAITRLQTQAYNSLRDAFKRFTSD  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC+DLS +T V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  394  LPTASSFALFDTCYDLSSRTRVQVPTVAFQFSGGKSLSLPAKNYLIPVDSAGTFCFAFAP  453

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +DLA  R+GF+ + C
Sbjct  454  TSSSLSIIGNVQQQGIRVSYDLANKRVGFSPNKC  487



>ref|XP_002529147.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF33260.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=479

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V +TG+S+GG  +  I  S+F++D +GNGG+I+DSGT+VTRL  AAY A+RDAF KG  D
Sbjct  327  VGMTGLSVGG-ELLSIPESMFEMDESGNGGIIIDSGTAVTRLQTAAYNALRDAFVKGTKD  385

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L  +SE +LFDTC+DLS KT V+VPTV  H  G  V  LPA NYLIPVD++G FCFAFA 
Sbjct  386  LPVTSEVALFDTCYDLSRKTSVEVPTVTFHLAGGKVLPLPATNYLIPVDSDGTFCFAFAP  445

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV FDLA S +GF    C
Sbjct  446  TSSALSIIGNVQQQGTRVGFDLANSLVGFEPRQC  479



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GG ++  I+ SVF +D +GNGGVIVDSGT+VTRL  AAY ++RDAFR G  +
Sbjct  333  VSLSGISVGG-KMLSISDSVFGIDASGNGGVIVDSGTAVTRLQTAAYDSLRDAFRAGTKN  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +   SLFDTC+DLS K  V VPTVV HF  G  +SLPA NYL+PVD+ G FCFAFA 
Sbjct  392  LPSTDGVSLFDTCYDLSSKESVDVPTVVFHFSGGGSMSLPAKNYLVPVDSMGTFCFAFAP  451

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSI+GNIQQQG RV FD A +++GFA + C
Sbjct  452  TSSSLSIVGNIQQQGIRVSFDRANNQVGFAVNKC  485



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGISIGG  +  I  S+F+LD +GNGGVIVD GT++TRL   AY ++RDAF      
Sbjct  341  VGLTGISIGG-HMLSIPESIFQLDESGNGGVIVDCGTAITRLQSQAYSSLRDAFVSMTQH  399

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK +S  +LFDTC+DLSG+  VKVPTV  HF +G   +LPA NYLIPVD++G +CFAFA 
Sbjct  400  LKSTSGVALFDTCYDLSGQNSVKVPTVSFHFSQGQSWNLPAMNYLIPVDSDGTYCFAFAP  459

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA +R+GF+   C
Sbjct  460  TTSSLSIIGNVQQQGTRVSFDLANNRVGFSTDKC  493



>ref|XP_004299230.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG R   I PS+F++D +GNGG+IVDSGT++TRL  AAY A+RD F++   D
Sbjct  340  VGLTGLSVGG-RPVSIPPSLFQMDESGNGGIIVDSGTAITRLQTAAYDALRDQFKRLTPD  398

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +  F+LFDTC+DLSG+T V+VPTV   F  G  ++LPA NYLIPVD  G FCFAFA 
Sbjct  399  LPAAGNFALFDTCYDLSGRTSVRVPTVSFLFAGGKSLALPAKNYLIPVDNSGTFCFAFAP  458

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +DLA +R+GF+ + C
Sbjct  459  TSSSLSIIGNVQQQGTRVSYDLANNRVGFSPNKC  492



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  + PS+F +D +GNGG+IVDSGT++TRL   AY ++RDAF++   D
Sbjct  335  VGLTGFSVGGQPV-SVPPSLFAVDESGNGGIIVDSGTAITRLQTQAYNSLRDAFKRYTRD  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC+DLS +T V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  394  LPTASSFALFDTCYDLSSRTRVQVPTVAFQFSGGKSLSLPAKNYLIPVDSAGTFCFAFAP  453

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +DLA  R+GF+ + C
Sbjct  454  TSSSLSIIGNVQQQGTRVSYDLANKRVGFSPNKC  487



>gb|EEE64882.1| hypothetical protein OsJ_19741 [Oryza sativa Japonica Group]
Length=456

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R  Y A+RDAFR  A 
Sbjct  301  VHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLARPVYEAVRDAFRAAAV  360

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIPVDT G FCFA 
Sbjct  361  GLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIPVDTSGTFCFAM  420

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  421  AGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  456



>ref|XP_003637416.1| Aspartic proteinase nepenthesin-2, partial [Medicago truncatula]
Length=165

 Score =   175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG  +  I  + F++D  GNGG+IVDSGT+VTRL    Y  +RDAF KG  D
Sbjct  13   VGLVGISVGG-ELLAIPETSFEVDSAGNGGIIVDSGTAVTRLQSDVYNVVRDAFVKGTKD  71

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++E SLFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PVD+ G FCFAFA 
Sbjct  72   LLATNEVSLFDTCYDLSSKTSVEVPTVAFHFGEGKVLVLPAKNYLVPVDSVGTFCFAFAP  131

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S LSIIGNIQQQG RV FDLA S +GF+ + C
Sbjct  132  TMSSLSIIGNIQQQGTRVSFDLANSLVGFSPNRC  165



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R  Y A+RDAFR  A 
Sbjct  326  VHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLARPVYEAVRDAFRAAAV  385

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIPVDT G FCFA 
Sbjct  386  GLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIPVDTSGTFCFAM  445

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  446  AGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  481



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R  Y A+RDAFR  A 
Sbjct  320  VHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLARPVYEAVRDAFRAAAV  379

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIPVDT G FCFA 
Sbjct  380  GLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIPVDTSGTFCFAM  439

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  440  AGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  475



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R  Y A+RDAFR  A 
Sbjct  320  VHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLARPVYEAVRDAFRAAAV  379

Query  566  DLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
             L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIPVDT G FCFA 
Sbjct  380  GLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIPVDTSGTFCFAM  439

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  440  AGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  475



>gb|EPS61272.1| hypothetical protein M569_13524, partial [Genlisea aurea]
Length=489

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+L+GIS+GG  +  I P  F L  +G GGVI+DSGT+VTRL   AY +MRDAF+KG +D
Sbjct  337  VDLSGISVGGQSL-PIPPETFALTDSGTGGVIIDSGTAVTRLQSDAYSSMRDAFKKGTAD  395

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L P++  SLFDTC+DLS +  V+VPTV  HF  G +V LPA NY+IPVD+ G FCFAFA 
Sbjct  396  LPPANAVSLFDTCYDLSSRKSVEVPTVSFHFSNGKEVKLPAKNYMIPVDSSGTFCFAFAP  455

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S L IIGN+QQQG RV +DLA S +GF+ + C
Sbjct  456  TSSSLGIIGNVQQQGTRVSYDLANSLVGFSPNKC  489



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  ++PS+F +D +GNGG+IVDSGT++TRL   AY A+RDAF++   D
Sbjct  335  VGLTGFSVGGQPV-SVSPSLFAVDDSGNGGIIVDSGTAITRLQTQAYNALRDAFKRLTRD  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S FSLFDTC++LS +T+V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  394  LPTASSFSLFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPVDSAGAFCFAFAP  453

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  454  TSSQLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>ref|XP_011077177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Sesamum 
indicum]
Length=492

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+LTGIS+ G  +  I PS F+L+  GNGGVIVDSGT+VTRL   AY +MRDAF+KG  D
Sbjct  340  VDLTGISVAG-ELLPIPPSTFQLNDNGNGGVIVDSGTAVTRLQTEAYNSMRDAFKKGTKD  398

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +   +LFDTC+DLS +  V+VPTV  HF  G ++SLPA NY+IPVD+ G FCFAFA 
Sbjct  399  LASTEGVALFDTCYDLSSRKSVEVPTVAFHFGNGKELSLPAKNYMIPVDSSGTFCFAFAP  458

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S L IIGN+QQQG RV +DL  S +GF+ + C
Sbjct  459  TSSSLGIIGNVQQQGTRVSYDLTNSLIGFSPNKC  492



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  + PS+F +D +GNGG+IVDSGT++TRL   AY A+RDAF++   D
Sbjct  335  VXLTGFSVGGXPV-SVPPSLFAVDNSGNGGIIVDSGTAITRLQTQAYNALRDAFKRLTRD  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC++LS +T+V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  394  LPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPVDSAGTFCFAFAP  453

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  454  TSSPLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>ref|XP_006374138.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
 gb|ABK94105.1| unknown [Populus trichocarpa]
 gb|ERP51935.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
Length=499

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G+S+GG  V  I  S F+LD +GNGG+IVD GT++TRL   AY  +RDAF +   +
Sbjct  346  VGLSGMSVGGQMV-SIPESTFRLDESGNGGIIVDCGTAITRLQTQAYNPLRDAFVRMTQN  404

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK +S  +LFDTC+DLSG+  V+VPTV  HF  G   +LPAANYLIPVD+ G +CFAFA 
Sbjct  405  LKLTSAVALFDTCYDLSGQASVRVPTVSFHFADGKSWNLPAANYLIPVDSAGTYCFAFAP  464

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA +R+GF+ + C
Sbjct  465  TTSSLSIIGNVQQQGTRVTFDLANNRMGFSPNKC  498



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  ++PS+F +D +GNGG+IVDSGT++TRL   AY A+RDAF++   D
Sbjct  335  VGLTGFSVGGQPV-SVSPSLFAVDNSGNGGIIVDSGTAITRLQTQAYNALRDAFKRLTRD  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S FSLFDTC++LS +T+V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  394  LPTASSFSLFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPVDSAGTFCFAFAP  453

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +D    R+GF+ + C
Sbjct  454  TSSQLSIIGNVQQQGTRVSYDFENKRVGFSPNKC  487



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG  +  I PS+F +D +GNGGVIVDSGT+VTRL   AY ++RDAF KG  D
Sbjct  342  VGLTGISVGG-ELLSIPPSLFAVDESGNGGVIVDSGTAVTRLKTEAYNSLRDAFVKGTGD  400

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  +LFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PVD++G FCFAFA 
Sbjct  401  LPSTSGVALFDTCYDLSSKTSVEVPTVTFHFPGGKSLPLPAKNYLVPVDSQGTFCFAFAP  460

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGNIQQQG RV  D   S +GF+ S C
Sbjct  461  TSSALSIIGNIQQQGTRVSVDFQKSVVGFSPSKC  494



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  + PS+F +D +GNGG+IVDSGT++TRL   AY A+RDAF++   D
Sbjct  335  VGLTGFSVGGXPV-SVPPSLFAVDNSGNGGIIVDSGTAITRLQTQAYNALRDAFKRLTRD  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC++LS +T+V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  394  LPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPVDSAGTFCFAFAP  453

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  454  TSSPLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  + PS+F +D +GNGG+IVDSGT++TRL   AY A+RDAF++   D
Sbjct  335  VGLTGFSVGGXPV-SVPPSLFAVDNSGNGGIIVDSGTAITRLQTQAYNALRDAFKRLTRD  393

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC++LS +T+V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  394  LPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPVDSAGTFCFAFAP  453

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  454  TSSPLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>gb|KCW48530.1| hypothetical protein EUGRSUZ_K02206 [Eucalyptus grandis]
Length=497

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG  V  I PS+F++D +G+GG+IVDSGT++TRL   AY ++RDAF K   D
Sbjct  345  VGLTGMSVGGKTV-SIPPSLFQMDESGDGGIIVDSGTAITRLQTQAYNSLRDAFVKLTPD  403

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAG  387
            LK +S  +LFDTC+D S  + V+VPTV   F G   ++LPA NYLIPVD+ G FCFAFA 
Sbjct  404  LKSTSGVALFDTCYDFSSLSSVQVPTVSFQFTGGRSLALPAKNYLIPVDSAGTFCFAFAP  463

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA SR+GF  + C
Sbjct  464  TTSSLSIIGNVQQQGTRVTFDLANSRVGFTPNKC  497



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG  V  I PS+F++D +G+GG+IVDSGT++TRL   AY ++RDAF K   D
Sbjct  344  VGLTGMSVGGKTV-SIPPSLFQMDESGDGGIIVDSGTAITRLQTQAYNSLRDAFVKLTPD  402

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAG  387
            LK +S  +LFDTC+D S  + V+VPTV   F G   ++LPA NYLIPVD+ G FCFAFA 
Sbjct  403  LKSTSGVALFDTCYDFSSLSSVQVPTVSFQFTGGRSLALPAKNYLIPVDSAGTFCFAFAP  462

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA SR+GF  + C
Sbjct  463  TTSSLSIIGNVQQQGTRVTFDLANSRVGFTPNKC  496



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V+ I PS+F++D  G+GG+IVD GT++TRL   AY ++RD+F + A +
Sbjct  343  VGLTGFSVGGQAVQ-IPPSLFEMDEAGDGGIIVDCGTAITRLQTQAYNSLRDSFVRLAGN  401

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            LKP+S  +LFDTC+D SG   V+VPTV LHF  G  + LPA NYLIPVD+ G FCFAFA 
Sbjct  402  LKPTSGVALFDTCYDFSGLRSVRVPTVSLHFGAGKALDLPAKNYLIPVDSAGTFCFAFAP  461

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV FDLA +R+GF  + C
Sbjct  462  TSSALSIIGNVQQQGTRVSFDLANNRVGFTPNKC  495



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V+ I PS+F++D  G+GG+IVD GT++TRL   AY ++RD+F + A +
Sbjct  343  VGLTGFSVGGQAVQ-IPPSLFEMDEAGDGGIIVDCGTAITRLQTQAYNSLRDSFVRLAGN  401

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            LKP+S  +LFDTC+D SG   V+VPTV LHF  G  + LPA NYLIPVD+ G FCFAFA 
Sbjct  402  LKPTSGVALFDTCYDFSGLRSVRVPTVSLHFGAGKALDLPAKNYLIPVDSAGTFCFAFAP  461

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV FDLA +R+GF  + C
Sbjct  462  TSSALSIIGNVQQQGTRVSFDLANNRVGFTPNKC  495



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V+ I PS+F++D  G+GG+IVD GT++TRL   AY ++RD+F + A +
Sbjct  343  VGLTGFSVGGQAVQ-IPPSLFEMDEAGDGGIIVDCGTAITRLQTQAYNSLRDSFVRLAGN  401

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            LKP+S  +LFDTC+D SG   V+VPTV LHF  G  + LPA NYLIPVD+ G FCFAFA 
Sbjct  402  LKPTSGVALFDTCYDFSGLRSVRVPTVSLHFGAGKALDLPAKNYLIPVDSAGTFCFAFAP  461

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S +SIIGN+QQQG RV FDLA +R+GF  + C
Sbjct  462  TSSAMSIIGNVQQQGTRVSFDLANNRVGFTPNKC  495



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L G S+GG  V  + PSVF++D +GNGG+IVDSGT++TRL   AY ++RDAF++   D
Sbjct  342  VGLKGFSVGGQPV-SVPPSVFEVDESGNGGIIVDSGTAITRLQTEAYNSLRDAFKRLTRD  400

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC+DLS ++ V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  401  LPSASGFALFDTCYDLSSRSRVQVPTVSFLFAGGKSLSLPAKNYLIPVDSAGTFCFAFAP  460

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S  SIIGN+QQQG RV +DLA +R+GF+A+ C
Sbjct  461  TSSSPSIIGNVQQQGTRVSYDLANNRVGFSANKC  494



>ref|XP_004497116.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=469

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG  +  I  + F++DPTG+GG+IVDSGT+VTRL    Y  +RDAF++G  D
Sbjct  317  VGLTGISVGG-ELLPIPETSFEVDPTGSGGIIVDSGTAVTRLQSNVYNLVRDAFKRGTKD  375

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +++ SLFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PVD+ G FCFAFA 
Sbjct  376  LPATNDVSLFDTCYDLSSKTSVEVPTVAFHFGEGKGLVLPAKNYLVPVDSVGTFCFAFAP  435

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S LSIIGNIQQQG RV FDL  S +GF+ + C
Sbjct  436  TMSSLSIIGNIQQQGTRVSFDLGRSIVGFSPNSC  469



>ref|XP_011004863.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=501

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G+S+GG  V  I  S F+LD +GNGG+IVD GT++TRL   AY  +RDAF +   +
Sbjct  348  VGLSGMSVGGQMV-SIPESAFRLDESGNGGIIVDCGTAITRLQTQAYNPLRDAFVRMTQN  406

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK +   +LFDTC+DLSG+  V+VPTV  HF  G   +LPAANY+IPVD+ G +CFAFA 
Sbjct  407  LKVAGAVALFDTCYDLSGQASVRVPTVSFHFADGKSWNLPAANYMIPVDSAGTYCFAFAP  466

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA +R+GF+ + C
Sbjct  467  TTSSLSIIGNVQQQGTRVTFDLANNRMGFSPNKC  500



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G+S+GG  +R I   VFKLD +G+GGVIVD GT++TRL   AY ++RD+F   +  
Sbjct  343  VGLSGMSVGGELLR-IPQEVFKLDDSGDGGVIVDCGTAITRLQSEAYNSLRDSFVSMSRH  401

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L+ +S  +LFDTC+DLSG++ VKVPTV  HF  G    LPAANYLIPVD+ G +CFAFA 
Sbjct  402  LRSTSGVALFDTCYDLSGQSSVKVPTVSFHFDGGKSWDLPAANYLIPVDSAGTYCFAFAP  461

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA +R+GF+ + C
Sbjct  462  TTSSLSIIGNVQQQGTRVSFDLANNRVGFSTNKC  495



>ref|XP_008782298.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=513

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VEL+GIS+GG  +  I PS F +D +G+GGVIVDSGT+VTRL   AY A+RDAFR+G S 
Sbjct  361  VELSGISVGG-ELLSIPPSAFAMDESGSGGVIVDSGTAVTRLQAEAYEALRDAFRRGTSG  419

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  SLFD+C+DLS +T V+VPTV  HF  G D+ LPA NYLIPVD  G +C AFA 
Sbjct  420  LPAAAGVSLFDSCYDLSSRTSVEVPTVAFHFPEGRDLRLPAKNYLIPVDGTGTYCLAFAP  479

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T + LSIIGN+QQQG RV FDL  S +GF    C
Sbjct  480  TKAPLSIIGNVQQQGTRVSFDLDNSVVGFTPKNC  513



>ref|XP_010677970.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=507

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG ++  I PS+F +D +G+GGVIVDSGT+VTRL   AY ++R+AF +    
Sbjct  355  VALSGFSVGGQQI-SIPPSLFNMDESGSGGVIVDSGTAVTRLPTQAYNSLRNAFTRLTQH  413

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  +LFDTC+D S  + VKVPTV LHF G   + LPA NYLIPVD+ G +CFAFA 
Sbjct  414  LTSASAVALFDTCYDFSSMSSVKVPTVALHFSGGQTLDLPAKNYLIPVDSSGTYCFAFAE  473

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS +SIIGN+QQQG RV +DLA S++ F+A+ C
Sbjct  474  TTSSMSIIGNVQQQGIRVHYDLARSQVAFSANNC  507



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L G S+GG  V  + PSVF++D +GNGG+IVDSGT++TRL   AY ++RDAF++   D
Sbjct  342  VGLKGFSVGGQPV-SVPPSVFEVDESGNGGIIVDSGTAITRLQTEAYNSLRDAFKRLTRD  400

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC+DLS ++ V+VPTV   F  G  +SLPA NYLIPVD+ G FCFAFA 
Sbjct  401  LPSASGFALFDTCYDLSSRSRVQVPTVSFLFADGKSLSLPAKNYLIPVDSAGTFCFAFAP  460

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S  SIIGN+QQQG RV +DLA +R+GF+ + C
Sbjct  461  TSSSPSIIGNVQQQGTRVSYDLANNRVGFSPNKC  494



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  I+ S F++D +G GGVI+DSGTSVTRL    Y ++RDAF KG +DL+
Sbjct  332  LTGISVGGEMLE-ISASSFEMDESGGGGVIIDSGTSVTRLQTGVYDSLRDAFVKGTTDLE  390

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
             + E ++FDTC+DLSGKT ++VP+V  HF G ++ +LPA NY+IPVD+ G FC AFA T 
Sbjct  391  RAGEVAMFDTCYDLSGKTTIEVPSVAFHFPGGNMLALPAKNYMIPVDSVGTFCLAFAPTA  450

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+IIGN+QQQG RV FDLA S + F+A+ C
Sbjct  451  SSLAIIGNVQQQGTRVGFDLANSLIRFSANKC  482



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG  +  I  + F++D  GNGG+IVDSGT+VTRL    Y  +RDAF KG  D
Sbjct  315  VGLVGISVGG-ELLAIPETSFEVDSAGNGGIIVDSGTAVTRLQSDVYNVVRDAFVKGTKD  373

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++E SLFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PVD+ G FCFAFA 
Sbjct  374  LLATNEVSLFDTCYDLSSKTSVEVPTVAFHFGEGKVLVLPAKNYLVPVDSVGTFCFAFAP  433

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S LSIIGNIQQQG RV FDLA S +GF+ + C
Sbjct  434  TMSSLSIIGNIQQQGTRVSFDLANSLVGFSPNRC  467



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTG S+GG  V  I P  F +D +G GGVIVDSGT++TRL   AY A+RDAF++   +
Sbjct  334  VELTGFSVGGDIV-SIPPETFAVDQSGVGGVIVDSGTAITRLRTQAYNAVRDAFKRMTQN  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L+P+   +LFDTC+DLS    V+VPTV  HF G    +LPA NYLIPVD+ G +CFAFA 
Sbjct  393  LRPADGVALFDTCYDLSSLQSVRVPTVSFHFAGDKTWALPAKNYLIPVDSAGTYCFAFAP  452

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA S +GF+ + C
Sbjct  453  TTSSLSIIGNVQQQGTRVSFDLANSVVGFSPNKC  486



>ref|XP_007036465.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY20966.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=491

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V+ +   +F +D +G GGVIVD GT+VTRL   AY A+RDAF K   D
Sbjct  340  VGLTGFSVGGQPVQ-LPTGLFDMDASGKGGVIVDCGTAVTRLQTQAYNALRDAFVKLTHD  398

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
            L  +S  +LFDTC+DLS +T V+VPTV  HF G  + LPA NYLIPVD+ G FCFAFA T
Sbjct  399  LPTASGVALFDTCYDLSSRTSVRVPTVAFHFGGQSLDLPAKNYLIPVDSSGVFCFAFAPT  458

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            +S LSIIGN+QQQG RV FDLA +++GF+   C
Sbjct  459  SSSLSIIGNVQQQGTRVSFDLANNKVGFSPRKC  491



>gb|KDO36875.1| hypothetical protein CISIN_1g037264mg, partial [Citrus sinensis]
Length=249

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  I+ + FK+D +GNGG+IVDSGT+VTRL    Y A+RDAF +G   L 
Sbjct  99   LTGISVGG-DLLPISETAFKIDESGNGGIIVDSGTAVTRLQTETYNALRDAFVRGTRALS  157

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
            P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA NYLIPVD+ G FCFAFA T+
Sbjct  158  PTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNYLIPVDSNGTFCFAFAPTS  217

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  218  SSLSIIGNVQQQGTRVSFNLRNSLIGFTPNKC  249



>ref|XP_003534178.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Glycine 
max]
Length=492

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTG+S+GG  V  + P  F +D +G GGVIVDSGT++TRL   AY ++RDAF++  S+
Sbjct  340  VELTGVSVGGEIVT-VPPETFAVDQSGAGGVIVDSGTAITRLRTQAYNSVRDAFKRKTSN  398

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L+P+   +LFDTC+DLS    V+VPTV  HF G    +LPA NYLIPVD  G +CFAFA 
Sbjct  399  LRPAEGVALFDTCYDLSSLQSVRVPTVSFHFSGDRAWALPAKNYLIPVDGAGTYCFAFAP  458

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS +SIIGN+QQQG RV FDLA S +GF+ + C
Sbjct  459  TTSSMSIIGNVQQQGTRVSFDLANSLVGFSPNKC  492



>gb|EYU40867.1| hypothetical protein MIMGU_mgv1a023461mg [Erythranthe guttata]
Length=479

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V++TGIS+ G  +  I PS F+++  G+GGVIVDSGT+VTRL   AY +MRDAFRKG  +
Sbjct  327  VDVTGISVAG-DLLPIPPSTFEMNDNGSGGVIVDSGTAVTRLQTEAYNSMRDAFRKGTKE  385

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC+DLS +  V+VPTV  HF  G  +SLPA NY+IPVD+ G FCFAFA 
Sbjct  386  LPTAAGVALFDTCYDLSSRKSVEVPTVSFHFSNGKSLSLPAKNYIIPVDSSGTFCFAFAP  445

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S L IIGN+QQQG RV +DLA S +GF+ + C
Sbjct  446  TASELGIIGNVQQQGTRVSYDLANSLIGFSPNKC  479



>gb|KJB52970.1| hypothetical protein B456_008G285900 [Gossypium raimondii]
Length=492

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG  V+ + P  F+L+ +GNGGVIVD GT++TRL   AY A+RDAF K + D
Sbjct  340  VGLTGLSVGGQPVQ-LPPGFFELEQSGNGGVIVDCGTAITRLQAEAYNALRDAFVKLSPD  398

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +   +LFDTC+DLS +T V+VPTV  HF G   + LPA NYLIPVD+ G +C AFA 
Sbjct  399  LPTTGGVALFDTCYDLSSRTSVRVPTVAFHFSGGMSLDLPAKNYLIPVDSSGTYCLAFAP  458

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV FDLA +++GF+   C
Sbjct  459  TTSSLSIIGNVQQQGTRVSFDLANNKVGFSPHKC  492



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L GIS+GG  +  I  S F++D +G GGVI+DSGT+VTRL    Y ++RDAF KG +DL+
Sbjct  332  LAGISVGGEMLE-IPASSFEMDESGGGGVIIDSGTAVTRLQTGVYDSLRDAFVKGTTDLE  390

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  ++FDTC+DLSGKT ++VP+V  HF G ++ +LPA NY+IPVDT G FC AFA T 
Sbjct  391  RAAGVAMFDTCYDLSGKTTIEVPSVAFHFPGGNMLALPAKNYMIPVDTVGTFCLAFAPTA  450

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+IIGN+QQQG RV FDLA S +GF+A+ C
Sbjct  451  SSLAIIGNVQQQGTRVGFDLANSLIGFSANKC  482



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG  ++ I  S F++D +G+GG+I+DSGT+VTRL    Y ++RD+F KG SD
Sbjct  331  VGLTGISVGGELLQ-IPQSSFEMDESGSGGIIIDSGTAVTRLQTGIYNSLRDSFLKGTSD  389

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPVD+ G FC AFA 
Sbjct  390  LEKANGVAMFDTCYNLSSKTTIEVPTVAFHFPGGKMLALPAKNYMIPVDSMGTFCLAFAP  449

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  450  TASSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  483



>gb|KDO70056.1| hypothetical protein CISIN_1g0117492mg, partial [Citrus sinensis]
Length=243

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  I+ + FK+D +GNGG+IVDSGT+VTRL    Y A+RDAF +G   L 
Sbjct  93   LTGISVGG-DLLPISETAFKIDESGNGGIIVDSGTAVTRLQTETYNALRDAFVRGTRALS  151

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
            P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA N+LIPVD+ G FCFAFA T+
Sbjct  152  PTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLIPVDSNGTFCFAFAPTS  211

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  212  SSLSIIGNVQQQGTRVSFNLRNSLVGFTPNKC  243



>ref|XP_011072934.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Sesamum 
indicum]
Length=510

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+LTGIS+GG R   I  S+  +   G GGVIVDSGTSVTRL    Y  +RDAF+    +
Sbjct  358  VDLTGISVGG-RALPIPSSLLAIGSDGKGGVIVDSGTSVTRLQTEVYSLVRDAFKNMTQN  416

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAG  387
            L P+S  SLFDTC++LSG++ V+VPTV   F G   +SLP  NYLIPVD EGKFCFAFAG
Sbjct  417  LPPASRLSLFDTCYNLSGRSRVQVPTVSFQFSGGRTLSLPPTNYLIPVDDEGKFCFAFAG  476

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+  +SI+GN+QQQG RV FDLA + +GF+ + C
Sbjct  477  TSGPMSIMGNVQQQGTRVSFDLANNYIGFSPNKC  510



>gb|KDP29378.1| hypothetical protein JCGZ_18299 [Jatropha curcas]
Length=484

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            +TG+S+GG  +  I  S FK+D +GNGG+IVDSGT++TRL    Y ++RDAF KG   L 
Sbjct  334  MTGLSVGG-ELLSIPESAFKIDESGNGGIIVDSGTAITRLQTDVYNSLRDAFVKGTEGLP  392

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  +LFDTC+DLS K  V+VP +  HF  G  + LPA NYLIPVD++G FCFAFA T 
Sbjct  393  STNSVALFDTCYDLSSKYSVEVPALSFHFPDGKVLPLPAKNYLIPVDSDGTFCFAFAPTA  452

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FDLA SR+GF  + C
Sbjct  453  SALSIIGNVQQQGTRVSFDLANSRIGFEPNKC  484



>ref|XP_010926497.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Elaeis guineensis]
Length=508

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GGA +  I PS F +D +G+GGVIVDSGT+VTRL   AY A+RDAFR+G + 
Sbjct  356  VGLSGISVGGAML-SIPPSAFAMDESGSGGVIVDSGTAVTRLQAEAYEALRDAFRRGTAG  414

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  SLFDTC+DLS +T V VPTV  HF  G ++ LPA NYLIPVD  G +C AFA 
Sbjct  415  LPAAAGVSLFDTCYDLSSRTSVDVPTVAFHFPEGRELRLPAKNYLIPVDGVGTYCLAFAP  474

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T + LSIIGN+QQQG RV FDL  S +GF  + C
Sbjct  475  TKAPLSIIGNVQQQGTRVSFDLDKSVVGFTPNNC  508



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GG ++  I PS F +D +G+GGVIVDSGT+VTRL   AY A+RDAFR+G + 
Sbjct  360  VGLSGISVGG-KMLSIPPSSFAMDESGSGGVIVDSGTAVTRLQADAYGALRDAFRRGTAG  418

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +   SLFDTC+DLS +T V+VPTV  HF +G ++ LPA NYLIPVD  G +C AFA 
Sbjct  419  LPAAEGVSLFDTCYDLSSRTSVEVPTVGFHFPQGRELRLPAKNYLIPVDGVGTYCLAFAP  478

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TT+ LSIIGN+QQQG RV FDL  S +GF  + C
Sbjct  479  TTAPLSIIGNVQQQGIRVSFDLDNSVVGFTPNNC  512



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG  ++ I  S F++D +G+GG+I+DSGT+VTRL    Y ++RD+F KG SD
Sbjct  330  VGLTGISVGGELLQ-IPQSSFEMDESGSGGIIIDSGTAVTRLQTGIYNSLRDSFLKGTSD  388

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPVD+ G FC AFA 
Sbjct  389  LEKANGVAMFDTCYNLSTKTTIEVPTVAFHFPGGKMLALPAKNYMIPVDSVGTFCLAFAP  448

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  449  TASSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  482



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG  V  I  S F++D +GNGGVIVDSGT++TRL    Y ++RDAF K   D
Sbjct  332  VGLTGLSVGGELV-SIPESAFQIDESGNGGVIVDSGTAITRLQTDVYNSLRDAFVKRTRD  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC+DLS K  V+VPTV  HF  G ++ LPA NYL+P+D+EG FCFAFA 
Sbjct  391  LPSTNGIALFDTCYDLSSKGNVEVPTVSFHFPDGKELPLPAKNYLVPLDSEGTFCFAFAP  450

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S LSIIGN+QQQG RVV+DL    +GF  + C
Sbjct  451  TASSLSIIGNVQQQGTRVVYDLVNHLVGFVPNKC  484



>ref|XP_002440367.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
 gb|EES18797.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
Length=462

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -1

Query  722  IGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK-PSS  549
            +GGARVRG+     +LDP TG GGVI+DSGTSVTRL R  YVA+R+AFR  A  L+    
Sbjct  314  VGGARVRGVGERSLRLDPSTGRGGVILDSGTSVTRLARPVYVAVREAFRAAAGGLRLAPG  373

Query  548  EFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGL  372
             FSLFDTC+DL G+  VKVPTV +H  G A+V+LP  NYLIPVDT G FC A AGT  G+
Sbjct  374  GFSLFDTCYDLRGRRVVKVPTVSVHLAGGAEVALPPENYLIPVDTRGTFCLALAGTDGGV  433

Query  371  SIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            SI+GNIQQQGFRVVFD    R+      C
Sbjct  434  SIVGNIQQQGFRVVFDGDRQRVALVPKSC  462



>ref|XP_008799310.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=507

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GG ++  I PS F +D +G+GGVIVDSGT+VTRL   AY A+RDAFR+  S 
Sbjct  355  VGLSGISVGG-KMLSIPPSSFAMDESGSGGVIVDSGTAVTRLQAEAYGALRDAFRRETSG  413

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +   SLFDTC+DLS ++ V+VPTV  HF  G ++ LPA NYLIPVD  G +C AFA 
Sbjct  414  LPSAEGMSLFDTCYDLSSRSSVEVPTVAFHFPEGRELRLPAKNYLIPVDGGGTYCLAFAP  473

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TT+ LSIIGN+QQQG RV FDL  S LGF  + C
Sbjct  474  TTAPLSIIGNVQQQGTRVSFDLDKSVLGFTPNNC  507



>ref|XP_002890686.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66945.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  ++ I  S F++D +G+GG+I+DSGT+VTRL    Y ++RD+F KG SDL+
Sbjct  336  LTGISVGGELLQ-IPQSSFEMDESGSGGIIIDSGTAVTRLQTGIYNSLRDSFLKGTSDLE  394

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPVD+ G FC AFA T 
Sbjct  395  KAAGVAMFDTCYNLSAKTTIEVPTVAFHFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTA  454

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  455  SSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  486



>ref|XP_006843768.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
 gb|ERN05443.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
Length=496

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L+GI +GG+ V  I PS F++D  G+GG IVDSGT++TRL   AY  +RDAF KGA  L 
Sbjct  346  LSGIGVGGS-VLSIPPSSFQMDEGGDGGTIVDSGTAITRLQSQAYTTLRDAFVKGAQALP  404

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +S  SLFDTC+DLSG+  V VPTV LHF  G  + LPA NYL+PVD+ G FCFAFA T 
Sbjct  405  RTSGVSLFDTCYDLSGRASVDVPTVSLHFPEGQALVLPAKNYLVPVDSTGTFCFAFAPTN  464

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FD A S + F  + C
Sbjct  465  SQLSIIGNVQQQGTRVAFDTANSVVSFTPNKC  496



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  ++ I  S F++D +G+GG+I+DSGT+VTRL    Y ++RD+F KG SDL+
Sbjct  332  LTGISVGGELLQ-IPQSSFEMDESGSGGIIIDSGTAVTRLQTGIYNSLRDSFLKGTSDLE  390

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPVD+ G FC AFA T 
Sbjct  391  KTTGVAMFDTCYNLSTKTTIEVPTVAFHFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTA  450

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+I+GN+QQQG RV FDLA S +GF+++ C
Sbjct  451  SSLAIVGNVQQQGTRVTFDLANSLIGFSSNKC  482



>ref|XP_002971459.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
 gb|EFJ27208.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
Length=357

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 104/153 (68%), Gaps = 3/153 (2%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDL  561
            L+GISIGG  +  I  + FKL   TG GGVI+DSGTSVTRL   AY  MRDAFR     L
Sbjct  206  LSGISIGGTLL-SIPSTAFKLSSSTGRGGVIIDSGTSVTRLPTYAYTVMRDAFRSATQKL  264

Query  560  KPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGT  384
              +++FSLFDTC+D S  T V +PTV  HF  GA V LP +NYL+PVDT G FCFAF+ T
Sbjct  265  PRAADFSLFDTCYDFSALTSVTIPTVSFHFEGGASVQLPPSNYLVPVDTSGTFCFAFSKT  324

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            +  LSIIGNIQQQ  RV  DL  SR+GFA   C
Sbjct  325  SLDLSIIGNIQQQTMRVAIDLDSSRVGFAPRQC  357



>ref|XP_002966033.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
 gb|EFJ33453.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
Length=357

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 104/153 (68%), Gaps = 3/153 (2%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDL  561
            L+GISIGG  +  I  + FKL   TG GGVI+DSGTSVTRL   AY  MRDAFR     L
Sbjct  206  LSGISIGGTLL-SIPSTAFKLSSSTGRGGVIIDSGTSVTRLPTYAYTVMRDAFRSATQKL  264

Query  560  KPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGT  384
              +++FSLFDTC+D S  T V +PTV  HF  GA V LP +NYL+PVDT G FCFAF+ T
Sbjct  265  PRAADFSLFDTCYDFSALTSVTIPTVSFHFEGGASVQLPPSNYLVPVDTSGTFCFAFSKT  324

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            +  LSIIGNIQQQ  RV  DL  SR+GFA   C
Sbjct  325  SLDLSIIGNIQQQTMRVAIDLDSSRVGFAPRQC  357



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  ++ I  S F++D +G+GG+I+DSGT+VTRL    Y ++RDAF KG +DL+
Sbjct  337  LTGISVGGELLQ-IPASSFEMDESGSGGIIIDSGTAVTRLQTEVYNSLRDAFVKGTTDLE  395

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  ++FDTC++LS KT ++VPTV  HF G   ++LPA NY+IPVD+ G FC AFA T 
Sbjct  396  RAAGVAMFDTCYNLSAKTTIEVPTVAFHFPGGKMMALPAKNYMIPVDSVGTFCLAFAPTG  455

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  456  SSLAIIGNVQQQGTRVAFDLANSLIGFSSNKC  487



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  ++ I  S F++D +G+GG+I+DSGT+VTRL    Y ++RD+F KG  DL+
Sbjct  333  LTGISVGGELLQ-IPQSSFEMDESGSGGIIIDSGTAVTRLQTEIYNSLRDSFVKGTLDLE  391

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  ++FDTC++LS KT V+VPTV  HF G  + +LPA NY+IPVD+ G FC AFA T 
Sbjct  392  KAAGVAMFDTCYNLSAKTTVEVPTVAFHFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTA  451

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  452  SSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  483



>ref|XP_009380958.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=523

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V +TGIS+GG  +  I PS F +D +G GGVIVDSGT+VTRL   AY A+RDAFR G + 
Sbjct  371  VGVTGISVGG-EMLSIPPSAFAVDESGAGGVIVDSGTAVTRLQEGAYSALRDAFRAGTAS  429

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  SLFDTC+DLS +T V+VPTV  HF G  ++ LPA NYLIPVD  G +C AFA 
Sbjct  430  LPSASGVSLFDTCYDLSSRTSVEVPTVGFHFPGGRELRLPAKNYLIPVDGAGTYCLAFAP  489

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T++ LSIIGN+QQQG RV FDL  + +GF  + C
Sbjct  490  TSAPLSIIGNVQQQGTRVSFDLENASVGFTPNKC  523



>ref|XP_010499100.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG  ++ I  S F++D +G+GG+I+DSGT+VTRL    Y ++RD+F KG SD
Sbjct  330  VGLTGISVGGELLQ-IPQSSFEMDESGSGGIIIDSGTAVTRLQTGIYNSLRDSFLKGTSD  388

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPVD+ G FC AFA 
Sbjct  389  LEKANGVAMFDTCYNLSTKTTIEVPTVAFHFPGGKMLALPAKNYMIPVDSVGTFCLAFAP  448

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS L+IIGN+QQQG RV F LA S +GF+++ C
Sbjct  449  TTSSLAIIGNVQQQGTRVTFYLANSLIGFSSNKC  482



>ref|XP_009409187.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG ++  I PS F +D +G GGVIVDSGT+VTRL    Y A+RDAFR G + 
Sbjct  370  VGLTGISVGG-QMLSIPPSAFAMDESGAGGVIVDSGTAVTRLQGPTYTALRDAFRAGTAS  428

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S +SLFDTC+DLS +T V+VPTV  HF  + ++ LPA NYL+PVD  G +C AFA 
Sbjct  429  LPSASAWSLFDTCYDLSSRTSVEVPTVGFHFPSSKELRLPAKNYLVPVDDAGTYCLAFAP  488

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T++ LSIIGN+QQQ  RV FDL  + +GF+ + C
Sbjct  489  TSASLSIIGNVQQQEIRVSFDLDNAVVGFSPNKC  522



>ref|XP_007153356.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
 gb|ESW25350.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
Length=483

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L GIS+GG  ++ +  S F +D TG GG+IVDSGT+VTRL    Y A+RDAF +G   L 
Sbjct  333  LKGISVGGETLQ-VPESSFAVDATGGGGIIVDSGTAVTRLRSEVYDALRDAFVRGTKGLP  391

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  SLFDTC+DLS +  V VPTV LHF  G ++ LPA NYLIPVD+ G FCFAFA TT
Sbjct  392  KTNGVSLFDTCYDLSSRNSVDVPTVSLHFPEGRELPLPAKNYLIPVDSVGTFCFAFAPTT  451

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FD+  S +GF+A+ C
Sbjct  452  SSLSIIGNVQQQGTRVSFDIGNSLVGFSANSC  483



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTG+S+GGA V  I  + F++   GNGG+IVDSGT+VTRL    Y  +RDAF K   DL+
Sbjct  336  LTGMSVGGA-VLPIPETSFQMSEDGNGGIIVDSGTAVTRLQTTVYNVLRDAFVKSTHDLQ  394

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFDTC+DLS K+ V+VPTV  HF  G ++ LPA NYLIPVD+EG FCFAFA T 
Sbjct  395  TARGVALFDTCYDLSSKSRVEVPTVSFHFANGNELPLPAKNYLIPVDSEGTFCFAFAPTD  454

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSI+GN QQQG RV FDLA S +GF+ + C
Sbjct  455  STLSILGNAQQQGTRVGFDLANSLVGFSPNKC  486



>ref|XP_002281973.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=491

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            +TGI +GG ++  I  S F++D +GNGG+IVDSGT+VTRL    Y ++RD+F +G   L 
Sbjct  341  MTGIGVGG-QMLSIPRSSFEVDESGNGGIIVDSGTAVTRLQSDVYNSLRDSFVRGTQHLP  399

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +S  +LFDTC+DLS ++ V+VPTV  HF  G  ++LPA NYLIPVD+ G FCFAFA TT
Sbjct  400  STSGVALFDTCYDLSSRSSVEVPTVSFHFPDGKYLALPAKNYLIPVDSAGTFCFAFAPTT  459

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV +DL+ S +GF+ +GC
Sbjct  460  SALSIIGNVQQQGTRVSYDLSNSLVGFSPNGC  491



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTG+S+GGA V  I  + F++   GNGG+IVDSGT+VTRL    Y  +RDAF K   DL+
Sbjct  336  LTGMSVGGA-VLPIPETSFQMSEDGNGGIIVDSGTAVTRLQTTVYNVLRDAFVKSTHDLQ  394

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFDTC+DLS K+ V+VPTV  HF  G ++ LPA NYLIPVD+EG FCFAFA T 
Sbjct  395  TARGVALFDTCYDLSSKSRVEVPTVSFHFANGNELPLPAKNYLIPVDSEGTFCFAFAPTD  454

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSI+GN QQQG RV FDLA S +GF+ + C
Sbjct  455  STLSILGNAQQQGTRVGFDLANSLVGFSPNKC  486



>gb|KFK44545.1| hypothetical protein AALP_AA1G270600 [Arabis alpina]
Length=485

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 113/154 (73%), Gaps = 4/154 (3%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  +  S F++D +G+GG+I+DSGT+VTRL    Y  +RDAF KG  DL+
Sbjct  333  LTGISVGG-EMLDVPVSFFEMDESGSGGIIIDSGTAVTRLQTEVYNMLRDAFVKGTMDLE  391

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD---VSLPAANYLIPVDTEGKFCFAFAG  387
              +  ++FDTC+DLS KT ++VPTV LHF G     ++LPA NY+IPVD+ G FCFAFA 
Sbjct  392  RVNGVAMFDTCYDLSTKTTIEVPTVALHFSGGGGGMLALPAKNYMIPVDSVGTFCFAFAP  451

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  452  TASSLAIIGNVQQQGTRVGFDLANSLIGFSSNKC  485



>gb|EMT00623.1| Aspartic proteinase nepenthesin-1 [Aegilops tauschii]
Length=246

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GG +   I  S F +D  G+GGVIVDSGT+VTRL   AY A+R+AF +G   
Sbjct  94   VGLSGISVGG-QTLSIPSSAFAMDDAGSGGVIVDSGTAVTRLQSGAYGALREAFVQGTQS  152

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  SLFDTC+DL+G+  V+VP V L F  G ++ LPA NYLIPVD  G +C AFAG
Sbjct  153  LPRASGISLFDTCYDLAGRQSVQVPAVALRFEGGGELKLPAKNYLIPVDGAGTYCLAFAG  212

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+  +SIIGN+QQQG RV FD A + +GF A  C
Sbjct  213  TSGAVSIIGNVQQQGVRVSFDTAKNTVGFTADKC  246



>ref|XP_009762361.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
sylvestris]
Length=483

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG ++  I  SVF++D +GNGG+IVDSGT+VTRL   AY A+RD+F K   +
Sbjct  331  VGLTGISVGG-QMLSIPASVFQVDGSGNGGIIVDSGTAVTRLQTTAYNALRDSFVKFTQN  389

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  + +F+LFDTC+DLS  T+V VPTV LHF G   +SL   NYLI VD+ GKFC AFA 
Sbjct  390  LPSAGQFALFDTCYDLSSMTKVSVPTVALHFTGDKTLSLHPKNYLIAVDSSGKFCLAFAP  449

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T   LSIIGNIQQQG RV +DLA + +GF+   C
Sbjct  450  TEGSLSIIGNIQQQGTRVSYDLASNLVGFSPDKC  483



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG  V+ I  SVF++D +G GGVI+D GT++TRL   AY ++RD+F K  S+
Sbjct  346  VGLSGFSVGGQEVK-IPSSVFEVDASGTGGVILDCGTAITRLKTEAYNSLRDSFVKLTSN  404

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP+D  G FCFAFA
Sbjct  405  LKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIPIDDAGTFCFAFA  464

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA +R+G +A+ C
Sbjct  465  PTSSSLSIIGNVQQQGTRITYDLANNRIGLSANKC  499



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L+G S+GG +V  I+ S+F +D +G+GGVI+D GT+VTRL   AY ++RDAF +  ++LK
Sbjct  350  LSGFSVGGQKVM-ISDSIFAVDASGSGGVILDCGTAVTRLQTEAYNSLRDAFLRLTTNLK  408

Query  557  P-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGT  384
              +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA T
Sbjct  409  KGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPT  468

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            +S LSIIGN+QQQG R+ +DLA +R+G +A+ C
Sbjct  469  SSSLSIIGNVQQQGTRITYDLANNRIGLSANKC  501



>ref|XP_010527532.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=484

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  I  S F++  TG GG+I+DSGT+VTRL    Y ++RD+F KG  DL 
Sbjct  334  LTGISVGGGLLP-IPESAFQMTETGTGGIIIDSGTAVTRLQTEIYNSLRDSFVKGTPDLP  392

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
              S  +LFDTC+DLSGKT+V+VPTV LHF G  +  LPA N LIPVD++G FC AFA T 
Sbjct  393  TVSGVALFDTCYDLSGKTKVEVPTVALHFPGGRMLPLPAKNCLIPVDSKGTFCLAFAPTA  452

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+IIGN+QQQG RV FDLA S + F+++ C
Sbjct  453  SSLAIIGNVQQQGTRVTFDLANSVIAFSSNKC  484



>emb|CDP20336.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++LTGIS+ G  +  + PS FKL   G GGVI+DSGT+VTRL    Y A+RDAF KG  +
Sbjct  332  LDLTGISVAG-ELLPVPPSNFKLADNGEGGVIIDSGTAVTRLPTETYNALRDAFVKGTKN  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTCF L  +  V+VPTV  HF  G D+SLPA NYLIPVD+ G FCFAFA 
Sbjct  391  LPSANGVALFDTCFALGSRKSVEVPTVSFHFSNGKDLSLPAKNYLIPVDSTGTFCFAFAP  450

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV +D+A S + F+++ C
Sbjct  451  TSSTLSIIGNVQQQGTRVSYDIAHSLIAFSSNKC  484



>ref|XP_002275164.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=496

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V +TG+S+GG ++  I PS+F++D +G GG+IVD GT+VTRL   AY A+RD F K   D
Sbjct  344  VGITGMSVGGEKL-AIPPSIFEVDGSGKGGIIVDCGTAVTRLQTQAYNALRDTFVKLTKD  402

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S F+LFDTC++LS +T V+VPTV   F  G  + LP +NYLIPVD+ G FC AFA 
Sbjct  403  LPSTSGFALFDTCYNLSSRTSVRVPTVAFLFDGGKSLPLPPSNYLIPVDSAGTFCLAFAP  462

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TT+ LSIIGN+QQQG RV +DLA S++ F++  C
Sbjct  463  TTASLSIIGNVQQQGTRVTYDLANSQVSFSSRKC  496



>ref|XP_006437718.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
 gb|ESR50958.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
Length=485

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  I+ + FK+D +GNGG+IVDSGT+VTRL    Y A+RDAF +G   L 
Sbjct  335  LTGISVGG-DLLPISETAFKIDESGNGGIIVDSGTAVTRLQTETYNALRDAFVRGTRALS  393

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
            P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA N+LIPVD+ G FCFAFA T+
Sbjct  394  PTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLIPVDSNGTFCFAFAPTS  453

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  454  SSLSIIGNVQQQGTRVSFNLRNSLVGFTPNKC  485



>ref|XP_009608744.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
tomentosiformis]
Length=488

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +ELTG+S+ G  +  + PS FK+   G+GGVI+DSGT+VTRL    Y  +RD F KG   
Sbjct  336  LELTGLSVAG-NLLSVPPSAFKVSDNGDGGVIIDSGTAVTRLQTDVYNTLRDEFVKGTRH  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC+DL     V+VPTV  HF  G ++ LPA NYLIPVD+ G FCFAFA 
Sbjct  395  LPSTNSVALFDTCYDLKSMKSVEVPTVSFHFSNGKELPLPAKNYLIPVDSSGTFCFAFAP  454

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV FDL  S +GF+++ C
Sbjct  455  TSSSLSIIGNVQQQGTRVSFDLKNSLIGFSSNKC  488



>ref|XP_004238952.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=482

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+LTGIS+ G  +  +NPS FK+   G+GGVIVDSGT+VTRL    Y  +RD F KG   
Sbjct  330  VDLTGISVAG-NMLSVNPSAFKIADNGDGGVIVDSGTAVTRLKTDVYNTLRDEFVKGTRH  388

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC+DL     V+VPTV  HF  G +++LPA NYLIPVD+   FCFAFA 
Sbjct  389  LPSTNAVALFDTCYDLKSMKSVEVPTVSFHFSNGNELALPAKNYLIPVDSSSTFCFAFAP  448

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            ++S LSIIGN+QQ+G RV FDL  S +GF+++ C
Sbjct  449  SSSSLSIIGNVQQEGTRVSFDLVNSLIGFSSNQC  482



>ref|XP_006484425.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=485

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  I+ + FK+D +GNGG+IVDSGT+VTRL    Y A+RDAF +G   L 
Sbjct  335  LTGISVGG-DLLPISETAFKIDESGNGGIIVDSGTAVTRLQTETYNALRDAFVRGTRALS  393

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
            P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA N+LIPVD+ G FCFAFA T+
Sbjct  394  PTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLIPVDSNGTFCFAFAPTS  453

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  454  SSLSIIGNVQQQGTRVSFNLRNSLVGFTPNKC  485



>ref|XP_004512945.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=502

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+LTG+S+GG  V  + P +F+ D +  GGVI+DSGT+VTRL   AY ++RDAF++   +
Sbjct  350  VQLTGMSVGGEMV-NVPPEIFETDQSTGGGVIIDSGTAVTRLQSQAYESVRDAFKRLTQN  408

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L+ +   ++FDTC+DLS    V+VPTV  HF    V  LPA NYLIPVD++G FCFAFA 
Sbjct  409  LRSAEGVAIFDTCYDLSSLRSVRVPTVSFHFGNDRVWDLPAKNYLIPVDSDGTFCFAFAP  468

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV FD+A S +GF+ + C
Sbjct  469  TSSSLSIIGNVQQQGTRVSFDIANSLVGFSPNKC  502



>gb|EAY72467.1| hypothetical protein OsI_00323 [Oryza sativa Indica Group]
Length=500

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GG ++  I PS F +D TG GGVIVDSGT+VTRL  +AY A+RDAF +G   
Sbjct  348  VGLSGISVGG-QILSIPPSAFAMDGTGAGGVIVDSGTAVTRLQSSAYAALRDAFVRGTQS  406

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  SLFDTC+DLS +T V+VP V L F  G ++ LPA NYLIPVD  G +C AFA 
Sbjct  407  LPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFAGGGELRLPAKNYLIPVDGAGTYCLAFAP  466

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T + +SIIGN+QQQG RV FD A S +GF ++ C
Sbjct  467  TNAAVSIIGNVQQQGTRVSFDTAKSTVGFTSNKC  500



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L+G S+GG +V  I+ S+F +D +G+GGVI+D GT+VTRL   AY ++RDAF +  ++LK
Sbjct  351  LSGFSVGGQKVM-ISDSIFAVDASGSGGVILDCGTAVTRLQTEAYNSLRDAFLRLTTNLK  409

Query  557  P-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGT  384
              +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA T
Sbjct  410  KGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPT  469

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            +S LSIIGN+QQQG R+ +DLA +R+G + + C
Sbjct  470  SSSLSIIGNVQQQGTRITYDLANNRIGLSPNKC  502



>ref|NP_001041979.1| Os01g0140100 [Oryza sativa Japonica Group]
 dbj|BAB21205.1| putative aspartic proteinase nepenthesin I [Oryza sativa Japonica 
Group]
 dbj|BAF03893.1| Os01g0140100 [Oryza sativa Japonica Group]
 gb|EAZ10476.1| hypothetical protein OsJ_00309 [Oryza sativa Japonica Group]
 dbj|BAG91200.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G+S+GG ++  I PS F +D TG GGVIVDSGT+VTRL  +AY A+RDAF +G   
Sbjct  352  VGLSGLSVGG-QILSIPPSAFAMDSTGAGGVIVDSGTAVTRLQSSAYAALRDAFVRGTQS  410

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  SLFDTC+DLS +T V+VP V L F  G ++ LPA NYLIPVD  G +C AFA 
Sbjct  411  LPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFAGGGELRLPAKNYLIPVDGAGTYCLAFAP  470

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T + +SIIGN+QQQG RV FD A S +GF  + C
Sbjct  471  TNAAVSIIGNVQQQGTRVSFDTAKSTVGFTTNKC  504



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG  +  I P+ F +D  G+GGVIVDSGT+VTRL  +AY A+RDAF +G   
Sbjct  376  VALNGISVGGETLSDIPPAAFAMDEQGSGGVIVDSGTAVTRLQSSAYSALRDAFVRGTQA  435

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  SLFDTC+DL+G++ V+VP V L F  G ++ LPA NYLIPVD  G +C AFA 
Sbjct  436  LPRASGVSLFDTCYDLAGRSSVQVPAVSLRFEGGGELKLPAKNYLIPVDGAGTYCLAFAA  495

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T   +SI+GN+QQQG RV FD A + +GF+ + C
Sbjct  496  TGGAVSIVGNVQQQGIRVSFDTAKNTVGFSPNKC  529



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG S+GG  V  I PSVF +  +GNGGVIVD GT+VTRL   AY ++RDAF +  ++
Sbjct  349  VGLTGFSVGGHPV-AIPPSVFAVGDSGNGGVIVDCGTAVTRLQTQAYNSLRDAFARLTAN  407

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  SS  SLFDTC+D S  + V+VPTV LHF G   + LPA NYLIPVD+ G FCFAFA
Sbjct  408  LKSASSSISLFDTCYDFSSLSTVRVPTVALHFAGGKSLELPAKNYLIPVDSAGIFCFAFA  467

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T++ LSIIGN+QQQG R+ FDLA + +GF  + C
Sbjct  468  PTSTPLSIIGNVQQQGTRIRFDLANNLVGFLPNKC  502



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 110/153 (72%), Gaps = 3/153 (2%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L+G S+GG +V  I+ S+F +D +G+GGVI+D GT+VTRL   AY ++RDAF +  + LK
Sbjct  350  LSGFSVGGQKVM-ISDSIFAVDASGSGGVILDCGTAVTRLQTEAYNSLRDAFLRLTTKLK  408

Query  557  P-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGT  384
              +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA T
Sbjct  409  KGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPT  468

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            +S LSIIGN+QQQG R+ +DL  +R+G +A+ C
Sbjct  469  SSSLSIIGNVQQQGTRITYDLTNNRIGLSANKC  501



>ref|XP_007046283.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY02115.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=489

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +  I  S F++D +GNGG I+DSGT+VTRL    Y  +RDAF KG  +L 
Sbjct  339  LTGISVGG-ELLPIPQSAFQMDESGNGGTIIDSGTAVTRLQSDTYDILRDAFVKGTKNLP  397

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFDTC+DLS ++ V VPTV  HF  G  + LPA NYLIPVD+EG FCFAFA T+
Sbjct  398  STDSVALFDTCYDLSKRSSVDVPTVSFHFPEGQVLPLPAKNYLIPVDSEGTFCFAFAPTS  457

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FDL  S + F    C
Sbjct  458  SSLSIIGNVQQQGTRVGFDLGNSLVEFVPDKC  489



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+LTGIS+ G  +  +NPS F++   G+GGVIVDSGT+VTRL    Y  +RD F KG   
Sbjct  330  VDLTGISVAG-NMLSVNPSDFEIADNGDGGVIVDSGTAVTRLKTDVYNTLRDEFVKGTRH  388

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC+DL     V+VPTV  HF  G +++LPA NYLIPVD+   FCFAFA 
Sbjct  389  LPSTNGVALFDTCYDLKSMKSVEVPTVSFHFSNGNELALPAKNYLIPVDSSSTFCFAFAP  448

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            ++S LSIIGN+QQQG RV FDL  S +GF+++ C
Sbjct  449  SSSSLSIIGNVQQQGTRVSFDLVNSLIGFSSNQC  482



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG ++  I P++F++D +G GG+IVDSGT++TRL   AY  +RDAF      
Sbjct  339  VGLTGMSVGG-QLLSIPPNLFQMDDSGYGGIIVDSGTAITRLQTQAYNTLRDAFVSRTPY  397

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK ++ F+LFDTC+DLS ++ V +PTV   F  G  + LP  NYLIPVD+ G FCFAFA 
Sbjct  398  LKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYLIPVDSVGTFCFAFAP  457

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  458  TTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  491



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTG+S+GG  V  I  + F++   GNGG+IVDSGT+VTRL    Y  +RD+F K   DL+
Sbjct  336  LTGMSVGGT-VLPIPETSFQMSEDGNGGIIVDSGTAVTRLQTTVYNVLRDSFVKSTHDLQ  394

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFDTC+DLS K+ V+VPTV  HF  G ++ LPA NYLIPVD+EG FCFAFA T 
Sbjct  395  SARGVALFDTCYDLSSKSSVEVPTVSFHFANGNELPLPAKNYLIPVDSEGTFCFAFAPTD  454

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSI+GN QQQG RV FDL+ S +GF+ + C
Sbjct  455  STLSILGNAQQQGTRVGFDLSNSLVGFSPNKC  486



>gb|KJB50738.1| hypothetical protein B456_008G185200 [Gossypium raimondii]
Length=495

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L GIS+GG  +  I  S F++D +GNGG+I+DSGT+VTRL    Y  +RDAF KG  +L 
Sbjct  345  LIGISVGG-ELLPIPESAFQMDESGNGGIIIDSGTAVTRLQSDTYNVLRDAFAKGTKNLP  403

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFDTC++LS K+ V VPT+  HF  G  + LPA NY+IPVD+ G FCFAFA T+
Sbjct  404  SADSVALFDTCYNLSTKSSVDVPTLSFHFPEGKVLPLPAKNYMIPVDSVGTFCFAFAPTS  463

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FDL  SR+GF  + C
Sbjct  464  SSLSIIGNVQQQGTRVGFDLGNSRVGFVPNKC  495



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG ++  I P++F++D +G GG+IVDSGT++TRL   AY  +RDAF      
Sbjct  337  VGLTGMSVGG-QLLSIPPNLFQMDDSGYGGIIVDSGTAITRLQTQAYNTLRDAFVSRTPY  395

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK ++ F+LFDTC+DLS ++ V +PTV   F  G  + LP  NYLIPVD+ G FCFAFA 
Sbjct  396  LKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYLIPVDSVGTFCFAFAP  455

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  456  TTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  489



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG ++  I P++F++D +G GG+IVDSGT++TRL   AY  +RDAF      
Sbjct  339  VGLTGMSVGG-QLLSIPPNLFQMDDSGYGGIIVDSGTAITRLQTQAYNTLRDAFVSRTPY  397

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            LK ++ F+LFDTC+DLS ++ V +PTV   F  G  + LP  NYLIPVD+ G FCFAFA 
Sbjct  398  LKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYLIPVDSVGTFCFAFAP  457

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  458  TTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  491



>ref|XP_008243190.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=556

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTG+S+GG  +  I  S F +D +GNGG+I+DSGT+VTRL    Y A+RDAF KG  DL 
Sbjct  406  LTGLSVGG-ELLPIPESAFLIDDSGNGGIIIDSGTAVTRLQTDTYNALRDAFVKGTKDLT  464

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFD C+DLS K  V+VPTV  HF  G  + LPA NYLIP+D+EG FCFAFA T 
Sbjct  465  STQGAALFDVCYDLSAKKSVEVPTVSFHFADGKVLPLPAKNYLIPIDSEGTFCFAFAPTP  524

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FD+A S +GF    C
Sbjct  525  SSLSIIGNVQQQGTRVGFDIANSVVGFFPDQC  556



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG  V  I  S F++D +G+GGVIVDSGT++TRL    Y ++RDAF K   D
Sbjct  332  VGLTGLSVGGELV-SIPESAFQIDESGDGGVIVDSGTAITRLQTDVYNSLRDAFVKRTRD  390

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC++LS K  V+VPTV  HF  G ++ LPA NYL+P+D+EG FCFAFA 
Sbjct  391  LPSTNGIALFDTCYNLSSKGNVEVPTVSFHFPDGKELPLPAKNYLVPLDSEGTFCFAFAP  450

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S LSIIGN+QQQG RV +DL    +GF  + C
Sbjct  451  TASSLSIIGNVQQQGTRVSYDLVNHLVGFVPNRC  484



>ref|XP_009616228.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG ++  I  SVF++D +GNGG+IVDSGT+VTRL   AY A+RD+F K   +
Sbjct  333  VGLTGISVGG-QMLSIPASVFQVDGSGNGGIIVDSGTAVTRLQTTAYNALRDSFVKLTQN  391

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +  FSLFDTC+DLS    V VPTV  HF     +SL   NYLIPVD+ GKFC AFA 
Sbjct  392  LPTAGRFSLFDTCYDLSSMKRVSVPTVAFHFSDDKTLSLHPKNYLIPVDSSGKFCLAFAP  451

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T   LSIIGNIQQQG RV +DLA + +GF+   C
Sbjct  452  TEGSLSIIGNIQQQGTRVSYDLANNLVGFSPDKC  485



>ref|XP_007225636.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
 gb|EMJ26835.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
Length=540

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L G+S+GG  +  I  S F++D +GNGG+I+DSGT+VTRL    Y A+RDAF KG  DL 
Sbjct  390  LAGLSVGG-ELLPIPESAFQIDDSGNGGIIIDSGTAVTRLQTDTYNALRDAFVKGTKDLT  448

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFD C+DLS K  V+VPTV  HF  G  + LPA NYLIP+D+EG FCFAFA T 
Sbjct  449  STQGAALFDVCYDLSSKKSVEVPTVSFHFADGKVLPLPAKNYLIPIDSEGTFCFAFAPTP  508

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S +SIIGN+QQQG RV FD+A S +GF  + C
Sbjct  509  SSMSIIGNVQQQGTRVGFDIANSVVGFFPNQC  540



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  I  S+F++  +G GGVI+D GT+VTRL   AY ++RDAF +  ++
Sbjct  348  VGLSGFSVGGQKVT-IPDSIFEVSTSGTGGVILDCGTAVTRLQTEAYNSLRDAFIRLTAN  406

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA
Sbjct  407  LKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIPVDDSGTFCFAFA  466

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA +R+G +A+ C
Sbjct  467  PTSSSLSIIGNVQQQGTRITYDLANNRIGLSANKC  501



>ref|XP_009800603.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
sylvestris]
Length=488

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            ++LTG+S+ G  +  + PS FK+   G+GGVI+DSGT+VTRL    Y  +RD F KG   
Sbjct  336  LDLTGLSVAG-NLLSVPPSAFKVSNNGDGGVIIDSGTAVTRLQTDVYNTLRDEFVKGTRH  394

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC+DL     V+VPTV  HF  G ++ LPA NYLIPVD+ G FCFAFA 
Sbjct  395  LPSTNGVALFDTCYDLKSMKSVEVPTVSFHFSNGKELPLPAKNYLIPVDSSGTFCFAFAP  454

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+S LSIIGN+QQQG RV FDL  S +GF+++ C
Sbjct  455  TSSSLSIIGNVQQQGTRVSFDLKNSLIGFSSNKC  488



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  I  SVF +D +G GGVI+D GT+VTRL   AY ++RDAF K  ++
Sbjct  346  VGLSGFSVGGQQV-SIPSSVFAVDASGAGGVILDCGTAVTRLQTQAYNSLRDAFVKLTAN  404

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA
Sbjct  405  LKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSIDLPAKNYLIPVDDAGTFCFAFA  464

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  465  PTSSSLSIIGNVQQQGTRITYDLANNLIGLSANQC  499



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  I  SVF +D +G GGVI+D GT+VTRL   AY ++RDAF K  ++
Sbjct  348  VGLSGFSVGGQQV-SIPSSVFAVDASGAGGVILDCGTAVTRLQTQAYNSLRDAFVKLTAN  406

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA
Sbjct  407  LKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSIDLPAKNYLIPVDDAGTFCFAFA  466

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  467  PTSSSLSIIGNVQQQGTRITYDLANNLIGLSANQC  501



>gb|ADJ67210.1| aspartic proteinase nepenthesin-1 precursor [Jatropha curcas]
Length=84

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  533  DTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNI  354
            DTCFDLSGKTEVKVPTV LHFRGADVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNI
Sbjct  1    DTCFDLSGKTEVKVPTVALHFRGADVSLPASNYLIPVDSDGSFCFAFAGTMSGLSIIGNI  60

Query  353  QQQGFRVVFDLAGSRLGFAASGC  285
            QQQGFRVV+DLAGSR+GFA  GC
Sbjct  61   QQQGFRVVYDLAGSRVGFAPRGC  83



>emb|CDM80984.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GG +   I  S F +D  G+GGVIVDSGT+VTRL   AY A+R+AF +G   
Sbjct  351  VGLSGISVGG-QALSIPASAFAMDDAGSGGVIVDSGTAVTRLQSGAYAALREAFVQGTQS  409

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  SLFDTC+DL+G++ V+VP V L F  G ++ LPA NYLIPVD  G +C AFAG
Sbjct  410  LPRASGISLFDTCYDLAGRSSVQVPAVALRFEGGGELKLPAKNYLIPVDGAGTYCLAFAG  469

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+  +SIIGN+QQQG RV FD A + +GF A  C
Sbjct  470  TSGAVSIIGNVQQQGVRVSFDTAKNTVGFTADKC  503



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            + GIS+GG  +  +  S F++  +G GGVI+DSGT+VTRL    Y ++RD+F KG +DL 
Sbjct  361  IAGISVGGEFL-PVPKSAFRMAESGIGGVIIDSGTAVTRLQTETYNSLRDSFVKGTADLP  419

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
             +S  +LFDTC+DLSG T V+VPTV LHF G  + +LPA NYLIPVD+ G FC AFA TT
Sbjct  420  TASGVALFDTCYDLSGNTTVEVPTVALHFTGGRMLALPAKNYLIPVDSAGTFCLAFAPTT  479

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S + IIGN+QQQG RV  DLA S +GF+++ C
Sbjct  480  SPMGIIGNVQQQGTRVTLDLANSAIGFSSNQC  511



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  I  S+F++D +G GGVI+D GT+VTRL   AY ++RDAF K  +D
Sbjct  349  VGLSGFSVGGQQV-SIPSSLFEVDASGAGGVILDCGTAVTRLQTQAYNSLRDAFVKLTTD  407

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
             K  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP+D  G FCFAFA
Sbjct  408  FKKGTSPISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLNLPAKNYLIPIDDAGTFCFAFA  467

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  468  PTSSSLSIIGNVQQQGTRITYDLANNLIGLSANKC  502



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            + G+S+GGA++  I+    +L  +G+GGVI+DSGTSVTR   + Y  +RDAFR   ++L 
Sbjct  332  MIGVSVGGAQL-PISLKSLQLSQSGSGGVIIDSGTSVTRFPTSVYATIRDAFRNATTNLP  390

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +  +SLFDTC++ SGK  V VP +VLHF  GAD+ LP  NYLIP++T G FC AFA T+
Sbjct  391  SAPRYSLFDTCYNFSGKASVDVPALVLHFENGADLQLPPTNYLIPINTAGSFCLAFAPTS  450

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
              L IIGNIQQQ FR+ FDL  S L FA   C
Sbjct  451  MELGIIGNIQQQSFRIGFDLQKSHLAFAPQQC  482



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V  TG S+GG +   I  S F +D +G GGVI+D GT+VTRL   AY ++RDAF K  ++
Sbjct  338  VGFTGFSVGGQQQVSIPSSAFAVDASGTGGVILDCGTAVTRLQTQAYNSLRDAFVKLTAN  397

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP+D  G FCFAFA
Sbjct  398  LKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIPIDDAGTFCFAFA  457

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA   +G +A+ C
Sbjct  458  PTSSSLSIIGNVQQQGTRITYDLANHLIGLSANKC  492



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L  IS+GGA +  + P VF++D T G GG IVDSGT+VTRL    Y A+RDAF  G  
Sbjct  384  VPLISISVGGALLDSVPPDVFRIDETSGRGGFIVDSGTAVTRLQTPVYDAVRDAFVAGTR  443

Query  566  DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFA  390
             L  +   S+FDTC+DLSG   V VPTVV HF  GA + LPA NY+IP+D  G FCFAFA
Sbjct  444  QLPKAEGVSIFDTCYDLSGLPLVNVPTVVFHFSNGASLILPAKNYMIPMDFMGTFCFAFA  503

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
              TS LSI+GNIQQQG RV FD A S +GFA   C
Sbjct  504  PATSDLSIMGNIQQQGIRVSFDTANSLVGFALRQC  538



>ref|XP_010549135.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=496

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L G S+GG R   I PSVF +D +G+GGVIVD GT+VTRL   AY ++RD+F +  + 
Sbjct  343  VGLPGFSVGG-RPVAIPPSVFAVDESGSGGVIVDCGTAVTRLQTQAYNSLRDSFARLTTH  401

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            L+  +S  SLFDTC+D S  + V+VPTV LHF G   + LPA NYLIPVD+ G FCFAFA
Sbjct  402  LRSATSTISLFDTCYDFSSLSTVRVPTVALHFAGGKSLDLPAKNYLIPVDSAGTFCFAFA  461

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T++ LSIIGN+QQQG RV FDLA + +GF+ + C
Sbjct  462  PTSTSLSIIGNVQQQGTRVSFDLANNLVGFSPNKC  496



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+GIS+GG  +  I  S F +D  G+GGVIVDSGT+VTRL   AY A+R+AF +G   
Sbjct  348  VALSGISVGGEAL-SIPSSAFAMDDAGSGGVIVDSGTAVTRLQSGAYGALREAFVQGTQS  406

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +S  SLFDTC+DL+G++ V+VP V L F  G ++ LPA NYLIPVD  G +C AFAG
Sbjct  407  LPRASGVSLFDTCYDLAGRSSVQVPAVALWFEGGGELKLPAKNYLIPVDAAGTYCLAFAG  466

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+  +SIIGN+QQQG RV FD A + +GF A  C
Sbjct  467  TSGPVSIIGNVQQQGVRVSFDTAKNTVGFTADKC  500



>ref|XP_002978584.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
 gb|EFJ20570.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
Length=407

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            + G+S+GGA++  I+    +L  +G+GGVI+DSGTSVTR   + Y  +RDAFR    +L 
Sbjct  257  MIGVSVGGAQLP-ISLKSLQLSQSGSGGVIIDSGTSVTRFPTSVYATIRDAFRNATINLP  315

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +  +SLFDTC++ SGK  V VP +VLHF  GAD+ LP  NYLIP++T G FC AFA T+
Sbjct  316  SAPRYSLFDTCYNFSGKASVDVPALVLHFENGADLQLPPTNYLIPINTAGSFCLAFAPTS  375

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
              L IIGNIQQQ FR+ FDL  S L FA   C
Sbjct  376  MELGIIGNIQQQSFRIGFDLQKSHLAFAPQQC  407



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  I  SVF++D  G GGVI+D GT+VTRL   AY A+RDAF K A D
Sbjct  350  VGLSGFSVGGEKVE-IPSSVFEVDAAGAGGVILDCGTAVTRLQTEAYNALRDAFVKLAKD  408

Query  563  LK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
             K  +S  SLFDTC+D S  + V VPTV  HF G   + LPA NYLIP+D  G FCFAFA
Sbjct  409  FKNATSSISLFDTCYDFSSMSSVNVPTVAFHFTGGKSIDLPAKNYLIPIDDAGTFCFAFA  468

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ ++L  + +G +A+ C
Sbjct  469  PTSSELSIIGNVQQQGTRITYNLENNLIGLSANKC  503



>gb|ADJ67200.1| aspartic proteinase nepenthesin-1 precursor [Jatropha curcas]
Length=84

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  533  DTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNI  354
            DTCFDLSGKTEVKVPTV LHFRG DVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNI
Sbjct  1    DTCFDLSGKTEVKVPTVALHFRGVDVSLPASNYLIPVDSDGSFCFAFAGTMSGLSIIGNI  60

Query  353  QQQGFRVVFDLAGSRLGFAASGC  285
            QQQGFRVV+DLAGSR+GFA  GC
Sbjct  61   QQQGFRVVYDLAGSRVGFAPRGC  83



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V  TG S+GG +V  I  S F +D +G GGVI+D GT+VTRL   AY ++RDAF K  ++
Sbjct  338  VGFTGFSVGGQQV-SIPSSAFAVDASGTGGVILDCGTAVTRLQTQAYNSLRDAFVKLTAN  396

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP+D  G FCFAFA
Sbjct  397  LKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIPIDDAGTFCFAFA  456

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA   +G +A+ C
Sbjct  457  PTSSSLSIIGNVQQQGTRITYDLANHLIGLSANKC  491



>ref|XP_004235788.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=486

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG ++  I  SVF++D +G+GG+IVDSGT+VTRL   AY  +RD+FRK    
Sbjct  334  VGLTGISVGG-QMLSIPASVFQVDRSGSGGIIVDSGTAVTRLKNTAYNTLRDSFRKYTQH  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFAG  387
            L  + +F+LFDTC+DLS      VPT+  HF G   + L   NYLIPVD+ GKFC AFA 
Sbjct  393  LPSAGQFALFDTCYDLSSMKRASVPTLSFHFSGGKALPLHPKNYLIPVDSSGKFCLAFAP  452

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T   LSIIGNIQQQG RV +DLA + +GF+   C
Sbjct  453  TDGSLSIIGNIQQQGTRVSYDLANNLVGFSPDKC  486



>ref|XP_004968151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V +TGIS+GG +   I  S F +D T G+GGVIVDSGT+VTRL  AAY A+RDAF +G  
Sbjct  364  VAMTGISVGG-QALSIPTSAFAMDATSGSGGVIVDSGTAVTRLQSAAYAALRDAFVRGTP  422

Query  566  DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFA  390
             L  SS  SLFDTC+DLSG+T V+VP V L F  G  + LPA NYLIPVD  G +C AFA
Sbjct  423  SLPRSSGVSLFDTCYDLSGRTSVEVPAVSLRFEGGGSLRLPAKNYLIPVDGAGTYCLAFA  482

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  483  PTNAAVSIIGNVQQQGTRVSFDTAKGAVGFTPNKC  517



>ref|XP_010092769.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB52179.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 6/154 (4%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            VELTG+S+GG  +   +PS      +G GG IVDSGT+VTRL    Y  +RD F++G  D
Sbjct  346  VELTGMSVGGVTI-SFSPS----QGSGEGGYIVDSGTAVTRLRTQIYEPLRDEFKRGTQD  400

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAG  387
            L  ++  +LFDTC+DLS +T V+VPTV   F G     LPA NYLIPVD  G FCFAFA 
Sbjct  401  LPAANGVALFDTCYDLSSRTSVRVPTVSFLFAGGKAWHLPAKNYLIPVDNSGTFCFAFAP  460

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            TTS LSI+GN+QQQG RV +DLA SR+GF+ + C
Sbjct  461  TTSSLSIVGNVQQQGTRVSYDLANSRVGFSPNKC  494



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 108/153 (71%), Gaps = 3/153 (2%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTG S+GG  V  I PSVF +D +G GG IVD G +VTRL   AY ++RDAF +  + LK
Sbjct  344  LTGFSVGGRSV-AIPPSVFAVDESGRGGGIVDCGPAVTRLQTQAYNSLRDAFARLTTHLK  402

Query  557  P-SSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGT  384
              ++  SLFDTC+D S  + VKVPTV LHF  G  + LPA NYLIPVD+ G FCFAFA T
Sbjct  403  SATTSISLFDTCYDFSSLSTVKVPTVALHFGDGKYLDLPAKNYLIPVDSAGTFCFAFAPT  462

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            ++ LSI+GN+QQQG RV FDLA + +GFA + C
Sbjct  463  STPLSIVGNVQQQGTRVSFDLANNLVGFATNKC  495



>ref|NP_001168599.1| uncharacterized protein LOC100382383 [Zea mays]
 gb|ACN28804.1| unknown [Zea mays]
Length=326

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L+GIS+GG  +  I  S F +D T G+GGVIVDSGT+VTRL  AAY A+RDAF +GA 
Sbjct  173  VALSGISVGGQPLS-IPASAFAMDATSGSGGVIVDSGTAVTRLQSAAYAALRDAFVQGAP  231

Query  566  DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFA  390
             L  +S  SLFDTC+DLS +T V+VP V L F  G  + LPA NYLIPVD  G +C AFA
Sbjct  232  SLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLIPVDGAGTYCLAFA  291

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  292  PTNAAVSIIGNVQQQGTRVSFDTARGAVGFTPNKC  326



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  +  ++F +D +G+GGVI+D GT+VTRL   AY ++RDAF K  ++
Sbjct  347  VGLSGFSVGGQKVM-MPDAIFDVDASGSGGVILDCGTAVTRLQTQAYNSLRDAFLKLTTN  405

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA
Sbjct  406  LKKGTSSISLFDTCYDFSSLSSVKVPTVAFHFTGGKSLDLPAKNYLIPVDDNGTFCFAFA  465

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA   +G + + C
Sbjct  466  PTSSSLSIIGNVQQQGTRITYDLANKIIGLSGNKC  500



>ref|XP_009336599.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=488

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTG+S+GG+ +  I  S F++D +GNGG+I+DSGT+VTRL    Y  +RDAF KG  DL 
Sbjct  338  LTGLSVGGSLLP-IPESAFQIDGSGNGGIIIDSGTAVTRLQTDTYNVLRDAFMKGTKDLP  396

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFD C+DLS +  V+VPTV  HF  G  + LPA N+LIPVD++G FCFAFA T 
Sbjct  397  FTKGPALFDACYDLSSRKRVEVPTVSFHFADGKVLPLPAKNFLIPVDSDGTFCFAFAPTP  456

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FDL  S +GF+ + C
Sbjct  457  SSLSIIGNVQQQGTRVGFDLVNSVVGFSLNQC  488



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 102/155 (66%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            VELTGIS+GG ++  I PS F +D  TG GGVIVDSGTSVTRL  AAY  +RD F+    
Sbjct  369  VELTGISVGG-KMLPIPPSAFAIDESTGAGGVIVDSGTSVTRLQEAAYATLRDDFQVQME  427

Query  566  DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFA  390
             L P+     FDTC++LS +  V VP+V  HF  G  + LPA NYLIPV+ EG +C AFA
Sbjct  428  ALPPAERMIPFDTCYNLSSRASVTVPSVAFHFPEGKALLLPAKNYLIPVNDEGTYCLAFA  487

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             +    SIIGN+QQQG RV+FDL   R+GF    C
Sbjct  488  PSPVAFSIIGNVQQQGTRVIFDLVNDRVGFTPDVC  522



>ref|XP_006341626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=486

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG ++  I  SVF++D +G+GG+IVDSGT+VTRL   AY  +RD+F K    
Sbjct  334  VGLTGISVGG-QMLSIPASVFQVDGSGSGGIIVDSGTAVTRLKSTAYNTLRDSFVKYTQH  392

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFAG  387
            L  + +F+LFDTC+DLS  T   VPT+  HF G   + L   NYLIPVD+ GKFC AFA 
Sbjct  393  LPSAGKFALFDTCYDLSSMTRASVPTLAFHFSGGKTLPLHPKNYLIPVDSSGKFCLAFAP  452

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T   LSIIGNIQQQG RV +DLA + +GF+   C
Sbjct  453  TDGSLSIIGNIQQQGTRVSYDLANNLVGFSPDKC  486



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V  +G S+GG +V  I  S F +D +G GGVI+D GT+VTRL   AY ++RDAF K  ++
Sbjct  338  VGFSGFSVGGQQV-SIPSSAFAVDASGTGGVILDCGTAVTRLQTQAYNSLRDAFVKLTAN  396

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFA  390
            LK  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP+D  G FCFAFA
Sbjct  397  LKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIPIDDAGTFCFAFA  456

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DLA   +G +A+ C
Sbjct  457  PTSSSLSIIGNVQQQGTRITYDLANHLIGLSANKC  491



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 14/152 (9%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTG S+GG  V  I+P +F+++ +G GGVI+D GT++TRL   AY A+RDA         
Sbjct  344  LTGFSVGGQAVN-ISPGLFEINESGEGGVIIDCGTAITRLQTQAYNALRDA---------  393

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
                 +LFDTC+DLS K+ VKVPTV  HF  G  + LPA NYLIPVD+ G FCFAFA T+
Sbjct  394  ---GVALFDTCYDLSSKSSVKVPTVSFHFGEGKSLDLPAKNYLIPVDSSGTFCFAFAPTS  450

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S +SIIGN+QQQG RV FDLA +R+G ++  C
Sbjct  451  SSMSIIGNVQQQGTRVSFDLANNRVGLSSHKC  482



>ref|XP_008389306.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
 ref|XP_008367019.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=488

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            +TG+S+GG  +  I  S F++D +GNGG+I+DSGT+VTRL    Y  +RDAF KG  DL 
Sbjct  338  VTGLSVGGXLLP-IPESAFQIDGSGNGGIIIDSGTAVTRLQTDTYNVLRDAFMKGTKDLP  396

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +   +LFD C+DLS +  V+VPTV  HF  G  + LPA N+LIPVD++G FCFAFA T 
Sbjct  397  VTKGAALFDACYDLSSRKSVEVPTVSFHFADGKVLPLPAKNFLIPVDSDGTFCFAFAPTP  456

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSIIGN+QQQG RV FDL  S +GF+ + C
Sbjct  457  SSLSIIGNVQQQGTRVGFDLVNSVVGFSPNQC  488



>ref|XP_004298296.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTGIS+GG  ++ I  + F++D +GNGG+I+DSGT+VTRL    Y A+R AF      
Sbjct  329  VGLTGISVGGDMLK-IPANAFEIDESGNGGIIIDSGTAVTRLQTETYDALRSAFVNMTKG  387

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAG  387
            L+ +S  +LFD C+DLS    V VP +  HF  G ++ LPA NYLIPVD++G FCFAFA 
Sbjct  388  LESTSGVALFDACYDLSKIESVDVPALSFHFEDGKELPLPAKNYLIPVDSQGTFCFAFAP  447

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T+  LSIIGN+QQQG RV FD+A S +GF+A  C
Sbjct  448  TSGALSIIGNVQQQGTRVSFDIANSVVGFSADQC  481



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 98/154 (64%), Gaps = 42/154 (27%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+GG RV  I+PS+FK+D  GNGGVI+DSG                        
Sbjct  335  IELLGISVGGTRVPKISPSLFKMDQDGNGGVIIDSG------------------------  370

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGT  384
                              +T VKVPT+VLHFRGAD+SLPA NYLIPVD+ G FCFAFAGT
Sbjct  371  ------------------QTSVKVPTLVLHFRGADLSLPATNYLIPVDSSGTFCFAFAGT  412

Query  383  TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  282
             +GLSIIGNIQQQGFRV +DLAGSR+GF+  GCA
Sbjct  413  MNGLSIIGNIQQQGFRVAYDLAGSRVGFSPRGCA  446



>ref|XP_001784204.1| predicted protein [Physcomitrella patens]
 gb|EDQ51002.1| predicted protein, partial [Physcomitrella patens]
Length=367

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 102/154 (66%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V++TGIS+GG  +  I  SVF+LD  GNGG I DSGT++TRL   AY A+RDAFR     
Sbjct  215  VQITGISVGGNLLTNIPASVFQLDSHGNGGTIFDSGTTITRLEARAYTAVRDAFRAATMH  274

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +++F +FDTC+D +G   + VPTV  HF+G  D+ LP +NY++PV     FCFAFA 
Sbjct  275  LTSAADFKIFDTCYDFTGMNSISVPTVTFHFQGDVDMRLPPSNYIVPVSNNNIFCFAFAA  334

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            +  G S+IGN+QQQ FRV++D    ++G     C
Sbjct  335  SM-GPSVIGNVQQQSFRVIYDNVHKQIGLLPDQC  367



>ref|XP_010105777.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXC06062.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V + G+ +GG  +  I  S F++D  GNGG+IVDSGT+VTRL    Y A+RDAF KG   
Sbjct  341  VGMEGLGVGG-ELLPIPTSFFQVDANGNGGIIVDSGTAVTRLQTDVYNALRDAFVKGTRH  399

Query  563  LKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFA  390
            L+ +    +LFDTC+DLS +T V+VPTV  HF G   +SLPA N+LIP+D+ G FCFAFA
Sbjct  400  LQSTDGGVALFDTCYDLSSQTRVEVPTVSFHFAGGKFLSLPAENFLIPIDSNGTFCFAFA  459

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG RV FDL  S +GF  + C
Sbjct  460  PTSSPLSIIGNVQQQGTRVGFDLVNSLIGFTPNDC  494



>gb|KJB41527.1| hypothetical protein B456_007G108800, partial [Gossypium raimondii]
Length=460

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +EL GIS+G   VRGI PS+FK+DP GNGGVI+DSG SVTRLTR AY+AMRD FR  AS+
Sbjct  326  IELLGISVGRTCVRGIMPSLFKMDPAGNGGVIIDSGMSVTRLTRPAYIAMRDVFRIRASN  385

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYL  432
            LK    FSLFDTCFDLS KT VKVPTVVLHFRGADVSLP  NYL
Sbjct  386  LKRVPNFSLFDTCFDLSDKTSVKVPTVVLHFRGADVSLPVTNYL  429



>ref|XP_010695864.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L GIS+GG  +  +  + F++D  G+GGVI+D+GT+VTRL    Y  +RD FRKG + L 
Sbjct  334  LIGISVGGTELT-VPTTAFQIDKDGSGGVIIDTGTAVTRLETRVYELLRDEFRKGTTHLP  392

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTT  381
             + E ++FDTC+DL GK  V+VPT+  HF G   ++LPA NY+IPVDTEG FC AFA TT
Sbjct  393  TTDEVAIFDTCYDLRGKESVEVPTLEFHFAGGKTLALPAKNYVIPVDTEGTFCLAFAPTT  452

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            + +SIIGN+QQ+G RV F+L  S + F  + C
Sbjct  453  ASMSIIGNVQQEGIRVGFNLVYSLVTFEPNQC  484



>ref|XP_002468182.1| hypothetical protein SORBIDRAFT_01g041210 [Sorghum bicolor]
 gb|EER95180.1| hypothetical protein SORBIDRAFT_01g041210 [Sorghum bicolor]
Length=490

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V LTGIS+GG RV G+     +LDP TG GGVIVDSGT+VTRL R AY A RDAFR  A 
Sbjct  333  VRLTGISVGGVRVPGVTERDLQLDPYTGRGGVIVDSGTAVTRLARPAYTAFRDAFRAVAV  392

Query  566  DLKPSS---EFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCF  399
            DL   S       FDTC+ + G+   KVPTV +HF G+ +V L   NYLIPVD+ G  CF
Sbjct  393  DLGQVSIGGPSGFFDTCYTVGGRGMKKVPTVSMHFAGSVEVKLQPKNYLIPVDSMGTVCF  452

Query  398  AFAGT-TSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            AFA T    +SIIGNIQQQGFR+V+D+ G R+GFA + C
Sbjct  453  AFAATGDHSVSIIGNIQQQGFRIVYDIGG-RVGFAPNSC  490



>ref|XP_009356391.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=491

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V LTG+S+GG  +  I  S F++D +GNGG+I+DSGT+VTRL    Y  +RDAF KG  D
Sbjct  339  VGLTGLSVGG-ELLPIPESAFQIDESGNGGIIIDSGTAVTRLQTDTYNVLRDAFMKGTKD  397

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAG  387
            L  +   +L D C+DLS K  V+VPT+  HF  G  + LPA N+LIPVD++G FCFAFA 
Sbjct  398  LPFTKGAALCDACYDLSSKRSVEVPTLSFHFADGKVLPLPAKNFLIPVDSDGTFCFAFAP  457

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T S LSIIGN+QQQG RV FDL  S +GF+ + C
Sbjct  458  TPSALSIIGNVQQQGARVGFDLVNSVVGFSRNQC  491



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 108/156 (69%), Gaps = 4/156 (3%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLD-PTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L+G S+GG +V  I  SVF++D  TG+GGVI+D GT+VTRL   AY ++RDAF K A 
Sbjct  345  VGLSGFSVGGEKVE-IPSSVFEVDDATGDGGVILDCGTAVTRLQTEAYNSLRDAFVKLAK  403

Query  566  DLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            D K  +S  SLFDTC+D S  + V VP V   F G   + LPA NYLIP+D  G FCFAF
Sbjct  404  DFKNATSSISLFDTCYDFSSMSSVNVPAVAFQFTGGKSIDLPAKNYLIPIDDAGTFCFAF  463

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            A T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  464  APTSSELSIIGNVQQQGTRITYDLANNLIGLSANQC  499



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  +  ++F +D +G+GGVI+D GT+VTRL   AY ++RDAF K   +
Sbjct  347  VGLSGFSVGGEKVV-LPDAIFDVDASGSGGVILDCGTAVTRLQTQAYNSLRDAFLKLTVN  405

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  SS  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA
Sbjct  406  LKKGSSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIPVDDSGTFCFAFA  465

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DL+ + +G + + C
Sbjct  466  PTSSSLSIIGNVQQQGTRITYDLSKNVIGLSGNKC  500



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L+G S+GG +V  +  ++F +D +G+GGVI+D GT+VTRL   AY ++RDAF K   +
Sbjct  347  VGLSGFSVGGEKVV-LPDAIFDVDASGSGGVILDCGTAVTRLQTQAYNSLRDAFLKLTVN  405

Query  563  LKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  390
            LK  SS  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIPVD  G FCFAFA
Sbjct  406  LKKGSSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIPVDDSGTFCFAFA  465

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG R+ +DL+ + +G + + C
Sbjct  466  PTSSSLSIIGNVQQQGTRITYDLSKNVIGLSGNKC  500



>tpg|DAA53545.1| TPA: hypothetical protein ZEAMMB73_483039 [Zea mays]
Length=506

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L+GIS+GG  +  I  S F +D T G+GGVIVDSGT+VTRL  AAY A+RDAF +GA 
Sbjct  353  VALSGISVGGQPL-SIPASAFAMDATSGSGGVIVDSGTAVTRLQSAAYAALRDAFVQGAP  411

Query  566  DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFA  390
             L  +S  SLFDTC+DLS +T V+VP V L F  G  + LPA NYLIPVD  G +C AFA
Sbjct  412  SLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLIPVDGAGTYCLAFA  471

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  472  PTNAAVSIIGNVQQQGTRVSFDTARGAVGFTPNKC  506



>emb|CDY51131.1| BnaA07g37140D [Brassica napus]
Length=436

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -1

Query  689  SVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSG  510
            S F++D +G GG+I+DSGT+VTRL    Y ++RDAF KG +DL+ ++  ++FDTC++L+ 
Sbjct  301  SSFEVDESGCGGIIIDSGTAVTRLQTGIYNSLRDAFVKGTTDLEKAAGVAMFDTCYNLAA  360

Query  509  KTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRV  333
            KT ++VPTV  HF G ++ +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV
Sbjct  361  KTTIEVPTVAFHFPGGNMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIIGNVQQQGTRV  420

Query  332  VFDLAGSRLGFAASGC  285
             FDLA S +GF+ + C
Sbjct  421  GFDLANSLIGFSTNKC  436



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            + +T IS+GGA +  I P VF++D T G+GG I+DSGT VTRL  +AY A+RDAF  G  
Sbjct  344  LSVTAISVGGALLDSIPPEVFRIDETSGHGGFIIDSGTVVTRLVTSAYDAVRDAFVAGTG  403

Query  566  DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFA  390
             L  +   S+FDTC+DLSG   V VPTV  HF  GA + LPA NYLIP+DT G FCFAFA
Sbjct  404  QLPRTDAVSIFDTCYDLSGLQFVSVPTVGFHFSNGASLILPAKNYLIPMDTVGTFCFAFA  463

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
               S +SI+GN QQQ  RV FD A S +GFA   C
Sbjct  464  PAASSVSIMGNTQQQHIRVSFDSANSLVGFAFDQC  498



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLD-PTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L+G S+GG +V  I  SVF++D  TG+GGVI+D GT+VTRL   AY ++RDAF K A 
Sbjct  345  VGLSGFSVGGEKVE-IPSSVFEVDDATGDGGVILDCGTAVTRLQTEAYNSLRDAFVKLAK  403

Query  566  DLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            D K  +S  SLFDTC+D S  + V VP V   F G   + LPA NYLIP+D  G FCFAF
Sbjct  404  DFKNATSSISLFDTCYDFSSMSSVNVPAVAFQFTGGKSIDLPAKNYLIPIDDAGTFCFAF  463

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            A T+S LSIIGN+QQQG R+ +DL  + +G +A+ C
Sbjct  464  APTSSELSIIGNVQQQGTRITYDLENNLIGLSANQC  499



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 112/159 (70%), Gaps = 6/159 (4%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V + G S+GGARVRG++    +LDP TG GGVI+DSGTSVTRL R  Y A+RDAFR  A+
Sbjct  359  VRVAGFSVGGARVRGVSERDLRLDPATGRGGVILDSGTSVTRLARPVYAAVRDAFRAAAA  418

Query  566  D---LKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFC  402
                L+PS   FSLFDTC+DL  +  VKVPT+ +H  G A V+LP  NYLIPVDT G FC
Sbjct  419  AAGGLRPSPGGFSLFDTCYDLGRRRVVKVPTLSVHLAGGAAVALPPENYLIPVDTRGTFC  478

Query  401  FAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            FA AGT  G+SI+GNIQQQGFRVVFD    R+G     C
Sbjct  479  FALAGTDGGVSILGNIQQQGFRVVFDGDAQRVGLVPKSC  517



>ref|XP_010044282.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Eucalyptus grandis]
Length=495

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  +R +    F+LDP G GG+IVDSGT+VTRL    Y AMRDAF +G   L 
Sbjct  345  LTGISVGGDPLR-LPEGAFQLDPHGGGGIIVDSGTAVTRLRAEVYGAMRDAFARGTRGLP  403

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             +  F+LFDTC+DLS K  V+VPTV L F  G  V +   NY+IPV + G FCFAFA T+
Sbjct  404  AAEGFALFDTCYDLSSKGSVEVPTVGLRFGDGRXVGVAGQNYMIPVHSNGTFCFAFAPTS  463

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSI+GN+QQQG RV FDL  S +GF  + C
Sbjct  464  SALSILGNVQQQGTRVGFDLKRSLIGFVPNKC  495



>ref|XP_003520035.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L GIS+GG  +  I  S+F++D  G GG+I+DSGT+VTRL    Y A+RDAF KGA  + 
Sbjct  334  LKGISVGGEAL-PIPESIFEVDAIGGGGIIIDSGTAVTRLRSEVYDALRDAFVKGAKGIP  392

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  SLFDTC+DLS +  V+VPTV  HF  G ++ LPA NYLIPVD+ G FCFAFA TT
Sbjct  393  KANGVSLFDTCYDLSSRESVQVPTVSFHFPEGRELPLPARNYLIPVDSVGTFCFAFAPTT  452

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S LSI+GN+QQQG RV FD+A S +GF+A  C
Sbjct  453  SSLSIMGNVQQQGTRVGFDIANSLVGFSADSC  484



>ref|XP_002965292.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
 gb|EFJ34130.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
Length=423

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKG-A  570
            VE+ GI +GG  V  I      LD  TGNGGVI+DSGT+VTRL  +AY  MRDAFR G  
Sbjct  268  VEMVGIKVGGTSVN-IPAGSLSLDSSTGNGGVILDSGTAVTRLVTSAYNPMRDAFRAGMP  326

Query  569  SDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            SD K +S FSLFDTC+DLSG++ + +P V   F G A ++LPA N ++PVD  G +C AF
Sbjct  327  SDAKMTSGFSLFDTCYDLSGRSSIMLPAVSFVFNGGATMALPAQNIMVPVDNSGTYCLAF  386

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            A  +   SIIGNIQQQ FR+ FD  G+R+G  A+ C
Sbjct  387  APNSENFSIIGNIQQQSFRMSFDSTGNRVGIGANQC  422



>ref|XP_002457394.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
 gb|EES02514.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
Length=509

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 106/155 (68%), Gaps = 3/155 (2%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGAS  567
            V L+GIS+GG +   I  S F +D T G+GGVIVDSGT+VTRL  +AY A+RDAF +G  
Sbjct  356  VALSGISVGG-QALSIPSSAFAMDATSGSGGVIVDSGTAVTRLQSSAYAALRDAFVRGTP  414

Query  566  DLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFA  390
             L  +S  SLFDTC+DLS +T V+VP V L F  G  + LPA NYLIPVD  G +C AFA
Sbjct  415  SLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLIPVDGAGTYCLAFA  474

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  475  PTNAAVSIIGNVQQQGTRVSFDTAKGVVGFTPNKC  509



>ref|XP_002986620.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
 gb|EFJ12477.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
Length=423

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKG-A  570
            VE+ GI +GG  V  I      LD  TGNGGVI+DSGT+VTRL  +AY  MRDAFR G  
Sbjct  268  VEMVGIKVGGTSV-SIPAGSLSLDSSTGNGGVILDSGTAVTRLVTSAYNPMRDAFRAGMP  326

Query  569  SDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAF  393
            SD K +S FSLFDTC+DLSG++ + +P V   F G A ++LPA N ++PVD  G +C AF
Sbjct  327  SDAKMTSGFSLFDTCYDLSGRSSIMLPAVSFVFNGGATMALPAQNIMVPVDNSGTYCLAF  386

Query  392  AGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            A  +   SIIGNIQQQ FR+ FD  G+R+G  A+ C
Sbjct  387  APNSENFSIIGNIQQQSFRMSFDSTGNRVGIGANQC  422



>emb|CDP20730.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 109/155 (70%), Gaps = 4/155 (3%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            +++ GI++GG  +  I  SVF++D  G GGVIVDSGT+VTRL   AY A+RDAF+K ASD
Sbjct  342  LDMVGINVGGETL-SIPASVFQVDGNGRGGVIVDSGTAVTRLNTQAYNALRDAFKKYASD  400

Query  563  LKPSSEFSLFDTCFDLSG-KTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFA  390
            L  SS FSLFDTC+D S     V+VPTV   F  G  + L  +NYL+PVD  GKFC AFA
Sbjct  401  LPSSSGFSLFDTCYDFSSVGGSVRVPTVSFLFASGKRLLLKPSNYLVPVDGRGKFCLAFA  460

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             T+S LSIIGN+QQQG RV FDLA  + GF+ + C
Sbjct  461  PTSS-LSIIGNVQQQGTRVSFDLANRQFGFSPNKC  494



>ref|XP_004241622.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=495

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            L GIS+    ++ +  S+F++D  G GG+IVDSGT+VTRL  +AY A+RD F K A +L 
Sbjct  345  LEGISVDDEMLQ-VPASIFQVDDNGRGGIIVDSGTAVTRLQSSAYSALRDTFVKYAQNLP  403

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTT  381
             + EF LFDTCFDLS  + V VPT+ LHF G   + L A N ++PVD+ GK+C AFA T 
Sbjct  404  SAGEFELFDTCFDLSSMSTVNVPTMALHFSGGQTLPLQAQNTVVPVDSSGKYCLAFAPTD  463

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
              +SIIGN+QQQG RV +DL+ + +GF+   C
Sbjct  464  ESMSIIGNVQQQGIRVSYDLSNNLVGFSLDKC  495



>ref|XP_006354732.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=491

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 104/154 (68%), Gaps = 2/154 (1%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V L GIS+GG  ++ +  S+F++D  G GG+IVDSGT+VTRL  +AY A+RD F K A +
Sbjct  339  VGLEGISVGGEMLQ-VPLSIFQIDDNGRGGIIVDSGTAVTRLQSSAYNALRDTFVKYAQN  397

Query  563  LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAG  387
            L  + EF LFDTCFDLS  +   VPTV  HF G   + L A N ++P+D+ GK+C AFA 
Sbjct  398  LPSAGEFELFDTCFDLSSMSTANVPTVAFHFSGGRTLPLHAQNTVVPIDSSGKYCLAFAP  457

Query  386  TTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            T   +SIIGN+QQQG RV +DL  + +GF+   C
Sbjct  458  TDESMSIIGNVQQQGTRVSYDLTNNLVGFSLDKC  491



>ref|XP_009103072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=487

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -1

Query  737  LTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK  558
            LTGIS+GG  ++ I  S F++D +G GG+I+DSGT+VTRL    Y ++RDAF KG +DL+
Sbjct  337  LTGISVGGEMLQ-IPSSSFEVDESGGGGIIIDSGTAVTRLQTGIYNSLRDAFVKGTTDLE  395

Query  557  PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFAGTT  381
             ++  ++FDTC++L+ KT ++VPTV  HF G ++ +LPA NY+IPVD+ G FC AFA T 
Sbjct  396  KAAGVAMFDTCYNLAAKTTIEVPTVAFHFPGGNMLALPAKNYMIPVDSVGTFCLAFAPTA  455

Query  380  SGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
            S L+IIGN+QQQG RV FDLA S +GF+ + C
Sbjct  456  SSLAIIGNVQQQGTRVGFDLANSLIGFSTNKC  487



>emb|CDO98452.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = -1

Query  743  VELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD  564
            V+L GIS+ G ++  I PSVF++   G GGV+VDSGT VTRL   AY ++RD F K A +
Sbjct  286  VDLVGISVAGEKL-PIQPSVFQVGSDGTGGVMVDSGTVVTRLVTRAYESLRDTFAKHAKN  344

Query  563  LKPSSEFSLFDTCFDLSG-KTEVKVPTVVLHFRGADV-SLPAANYLIPVDTEGKFCFAFA  390
            L P+S +SLFDTC+DLS    EV+VPTV  HF G    SL   N LIPVD+ GKFCFAFA
Sbjct  345  LHPTSGYSLFDTCYDLSSIPDEVEVPTVSFHFSGGKTWSLKPKNCLIPVDSRGKFCFAFA  404

Query  389  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  285
             + S +SIIGNIQQQ  R+ +DLA   +G +   C
Sbjct  405  PSDS-ISIIGNIQQQETRISYDLAKKLIGVSPDQC  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210