BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005M21

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN33816.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    438   1e-151   Glycine soja [wild soybean]
emb|CBI18876.3|  unnamed protein product                                441   1e-149   Vitis vinifera
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    443   2e-148   Cucumis melo [Oriental melon]
ref|NP_001183829.1|  uncharacterized protein LOC100502422               434   6e-148   Zea mays [maize]
gb|ACN35033.1|  unknown                                                 434   6e-148   Zea mays [maize]
emb|CAN74077.1|  hypothetical protein VITISV_000978                     440   8e-148   Vitis vinifera
ref|XP_006656509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    433   1e-147   Oryza brachyantha
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    441   1e-147   Cicer arietinum [garbanzo]
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             440   4e-147   Phaseolus vulgaris [French bean]
dbj|BAJ85305.1|  predicted protein                                      423   5e-147   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    439   7e-147   Vitis vinifera
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    439   8e-147   Nelumbo nucifera [Indian lotus]
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    439   9e-147   Glycine max [soybeans]
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         438   2e-146   Jatropha curcas
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    437   2e-146   Setaria italica
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    438   2e-146   Sesamum indicum [beniseed]
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    438   2e-146   Cucumis sativus [cucumbers]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    437   3e-146   Sesamum indicum [beniseed]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    437   4e-146   
gb|EEC81336.1|  hypothetical protein OsI_24516                          434   5e-146   Oryza sativa Indica Group [Indian rice]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             437   8e-146   Citrus clementina [clementine]
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    437   9e-146   Citrus sinensis [apfelsine]
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   2e-145   Tarenaya hassleriana [spider flower]
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    434   4e-145   
ref|NP_001058625.1|  Os06g0725900                                       432   2e-144   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          432   2e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    433   2e-144   Populus euphratica
ref|XP_002301927.1|  Cell division protein ftsH                         432   3e-144   Populus trichocarpa [western balsam poplar]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    432   3e-144   Populus euphratica
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    432   4e-144   Eucalyptus grandis [rose gum]
emb|CDP07308.1|  unnamed protein product                                432   6e-144   Coffea canephora [robusta coffee]
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   7e-144   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX96068.1|  BnaA07g26630D                                          430   8e-144   
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            431   8e-144   Morus notabilis
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       431   9e-144   
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    431   9e-144   Gossypium arboreum [tree cotton]
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-143   Brassica rapa
emb|CDY01840.1|  BnaC06g28800D                                          431   1e-143   
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   3e-143   Elaeis guineensis
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             430   5e-143   Arabidopsis lyrata subsp. lyrata
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    429   5e-143   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             429   8e-143   Eutrema salsugineum [saltwater cress]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             429   1e-142   Capsella rubella
ref|XP_002306970.2|  Cell division protein ftsH                         428   1e-142   Populus trichocarpa [western balsam poplar]
gb|EMS62975.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    421   2e-142   Triticum urartu
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          427   3e-142   Amborella trichopoda
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   4e-142   Camelina sativa [gold-of-pleasure]
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   4e-142   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   4e-142   Camelina sativa [gold-of-pleasure]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             427   6e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             426   1e-141   Prunus persica
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   2e-141   Prunus mume [ume]
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    425   3e-141   Phoenix dactylifera
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    422   1e-140   Brachypodium distachyon [annual false brome]
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   2e-140   Solanum tuberosum [potatoes]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    422   2e-140   Genlisea aurea
ref|NP_001234196.1|  FtsH-like protein precursor                        421   7e-140   
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   7e-140   Nicotiana tomentosiformis
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   1e-139   Nicotiana sylvestris
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    420   2e-139   Nicotiana sylvestris
gb|EMT09942.1|  Cell division protease ftsH-like protein, chlorop...    419   2e-139   
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    420   2e-139   Nicotiana tomentosiformis
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    420   2e-139   Fragaria vesca subsp. vesca
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    419   9e-139   
emb|CAA68141.1|  chloroplast FtsH protease                              418   1e-138   Arabidopsis thaliana [mouse-ear cress]
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    418   1e-138   Nicotiana tabacum [American tobacco]
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    417   3e-138   Gossypium arboreum [tree cotton]
gb|KJB14315.1|  hypothetical protein B456_002G118800                    417   4e-138   Gossypium raimondii
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    416   2e-137   Pyrus x bretschneideri [bai li]
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         414   4e-137   Medicago truncatula
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    414   1e-136   
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                410   2e-135   Erythranthe guttata [common monkey flower]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    408   9e-135   Medicago sativa [alfalfa]
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    401   6e-132   Arabis alpina [alpine rockcress]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             398   1e-131   
dbj|BAH20236.1|  AT5G42270                                              394   1e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             398   8e-131   Capsella rubella
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    397   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    397   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             396   2e-130   
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             396   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    396   3e-130   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             396   4e-130   Eutrema salsugineum [saltwater cress]
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     393   7e-129   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    390   9e-128   Camelina sativa [gold-of-pleasure]
emb|CAA73318.1|  ATPase                                                 383   6e-126   Arabidopsis thaliana [mouse-ear cress]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    379   5e-124   Capsicum annuum
ref|XP_001760664.1|  predicted protein                                  377   2e-123   
gb|AIS72760.1|  ATP-dependent zinc metalloprotease chloroplastic-...    362   3e-123   Rhizophora apiculata
ref|XP_001753657.1|  predicted protein                                  374   2e-122   
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         364   3e-120   Medicago truncatula
gb|KJB14314.1|  hypothetical protein B456_002G118800                    370   3e-120   Gossypium raimondii
ref|XP_002510649.1|  Cell division protease ftsH, putative              367   6e-119   
ref|XP_005650371.1|  membrane AAA-metalloprotease                       324   5e-102   Coccomyxa subellipsoidea C-169
dbj|BAH20250.1|  AT5G42270                                              306   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KIY93255.1|  cell division protease FtsH                             316   9e-101   Monoraphidium neglectum
gb|KJB57987.1|  hypothetical protein B456_009G188700                    317   9e-100   Gossypium raimondii
gb|KIZ03250.1|  cell division protease FtsH                             318   1e-99    Monoraphidium neglectum
ref|XP_007510744.1|  cell division protein FtsH2                        315   1e-98    Bathycoccus prasinos
ref|WP_025929131.1|  hypothetical protein                               299   2e-98    
ref|XP_001690889.1|  membrane AAA-metalloprotease                       314   3e-98    Chlamydomonas reinhardtii
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              314   3e-98    Volvox carteri f. nagariensis
ref|WP_029963924.1|  cell division protein FtsH                         298   1e-96    
ref|WP_025947145.1|  cell division protein FtsH                         298   2e-96    
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit           305   1e-95    Leptolyngbya sp. PCC 7375
ref|WP_023072541.1|  membrane protease catalytic subunit                303   3e-95    Leptolyngbya sp. Heron Island J
ref|WP_025970576.1|  cell division protein FtsH                         297   3e-95    
ref|WP_025954333.1|  cell division protein FtsH                         296   2e-94    
ref|WP_025961749.1|  hypothetical protein                               288   2e-94    
ref|WP_025971093.1|  cell division protein FtsH                         296   4e-94    
ref|WP_044452063.1|  cell division protein FtsH                         292   2e-93    Mastigocladus laminosus
gb|KGF94553.1|  cell division protein FtsH2                             298   2e-93    Prochlorococcus marinus str. MIT 9201
ref|WP_025958220.1|  cell division protein FtsH                         296   3e-93    
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 301   4e-93    Micromonas commoda
ref|WP_032522853.1|  cell division protein FtsH                         298   4e-93    Prochlorococcus marinus
ref|WP_025944375.1|  cell division protein FtsH                         298   6e-93    
gb|KGG03814.1|  Cell division protein FtsH                              296   7e-93    Prochlorococcus marinus str. MIT 9321
ref|WP_025922112.1|  cell division protein FtsH                         297   8e-93    
ref|WP_025935637.1|  MULTISPECIES: cell division protein FtsH           297   8e-93    
gb|ABX08179.1|  cell division protein FtsH2                             296   9e-93    Prochlorococcus marinus str. MIT 9211
ref|WP_025971671.1|  cell division protein FtsH                         297   9e-93    
ref|XP_003057154.1|  predicted protein                                  300   9e-93    Micromonas pusilla CCMP1545
ref|WP_032519670.1|  cell division protein FtsH                         297   1e-92    Prochlorococcus marinus
ref|WP_025969610.1|  cell division protein FtsH                         297   1e-92    
gb|KGG06312.1|  Cell division protein FtsH                              296   1e-92    Prochlorococcus marinus str. MIT 9322
ref|WP_041391000.1|  cell division protein FtsH                         296   1e-92    Prochlorococcus marinus
ref|WP_032515715.1|  cell division protein FtsH                         297   1e-92    Prochlorococcus marinus
ref|WP_025964562.1|  cell division protein FtsH                         296   1e-92    
ref|WP_025951376.1|  cell division protein FtsH                         296   1e-92    
ref|WP_025939914.1|  MULTISPECIES: cell division protein FtsH           296   1e-92    
ref|WP_025924120.1|  MULTISPECIES: cell division protein FtsH           296   1e-92    Prochlorococcus marinus
ref|WP_025959316.1|  cell division protein FtsH                         296   1e-92    
ref|WP_025890345.1|  MULTISPECIES: cell division protein FtsH           296   1e-92    Prochlorococcus sp. HOT208_60m_808M21
ref|WP_025892538.1|  cell division protein FtsH                         296   1e-92    
ref|WP_025967396.1|  cell division protein FtsH                         296   1e-92    
ref|WP_025900256.1|  MULTISPECIES: cell division protein FtsH           296   1e-92    
ref|WP_006911156.1|  cell division protein FtsH                         296   1e-92    Cyanobium sp. PCC 7001
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    299   2e-92    Auxenochlorella protothecoides
ref|WP_025980194.1|  cell division protein FtsH                         296   2e-92    
ref|WP_032517345.1|  cell division protein FtsH                         296   2e-92    Prochlorococcus marinus
gb|KGF88464.1|  cell division protein FtsH2                             295   2e-92    Prochlorococcus marinus str. GP2
ref|WP_025937982.1|  cell division protein FtsH                         296   3e-92    
ref|WP_025956453.1|  MULTISPECIES: cell division protein FtsH           296   3e-92    
gb|AIQ94296.1|  Cell division protein FtsH                              295   3e-92    Prochlorococcus sp. MIT 0604
ref|WP_035992112.1|  cell division protein FtsH                         295   3e-92    Leptolyngbya sp. KIOST-1
ref|WP_002806664.1|  cell division protein FtsH                         295   4e-92    Prochlorococcus marinus
ref|WP_044106285.1|  cell division protein FtsH                         295   4e-92    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_025941250.1|  cell division protein FtsH                         295   4e-92    
ref|WP_025921388.1|  MULTISPECIES: cell division protein FtsH           295   4e-92    
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH                 295   4e-92    Stanieria cyanosphaera
ref|WP_036973151.1|  cell division protein FtsH                         289   4e-92    Prochlorococcus sp. MIT 0703
gb|KGG30054.1|  cell division protein FtsH2                             289   4e-92    Prochlorococcus sp. MIT 0703
ref|WP_011817719.1|  cell division protein FtsH                         295   4e-92    Prochlorococcus marinus
ref|WP_025914082.1|  cell division protein FtsH                         295   4e-92    
ref|WP_025925903.1|  cell division protein FtsH                         295   4e-92    
ref|WP_012007029.1|  cell division protein FtsH                         295   4e-92    Prochlorococcus marinus
ref|WP_025937318.1|  cell division protein FtsH                         295   4e-92    
ref|WP_025933036.1|  cell division protein FtsH                         295   5e-92    
ref|WP_025979191.1|  cell division protein FtsH                         295   5e-92    
ref|WP_042849723.1|  cell division protein FtsH                         295   5e-92    Prochlorococcus sp. MIT 0604
ref|WP_032523992.1|  cell division protein FtsH                         295   5e-92    Prochlorococcus marinus
ref|WP_025965256.1|  cell division protein FtsH                         295   5e-92    Prochlorococcus sp. HOT208_60m_805A16
ref|WP_025981174.1|  cell division protein FtsH                         295   5e-92    
ref|WP_025971407.1|  cell division protein FtsH                         294   6e-92    
ref|WP_025929709.1|  cell division protein FtsH                         295   6e-92    
ref|WP_028953545.1|  cell division protein FtsH                         295   6e-92    Synechococcus sp. CC9616
ref|WP_025925013.1|  MULTISPECIES: cell division protein FtsH           295   7e-92    
ref|WP_017297226.1|  cell division protein FtsH                         295   7e-92    Nodosilinea nodulosa
ref|WP_011862269.1|  cell division protein FtsH                         295   8e-92    Prochlorococcus marinus
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH           294   8e-92    Fischerella thermalis
ref|WP_011375794.1|  cell division protein FtsH                         294   9e-92    Prochlorococcus marinus
ref|WP_032514590.1|  cell division protein FtsH                         294   9e-92    Prochlorococcus marinus
ref|WP_012593655.1|  MULTISPECIES: cell division protein FtsH           294   1e-91    Cyanothece
dbj|GAL91410.1|  cell division protein FtsH                             293   2e-91    Microcystis aeruginosa NIES-44
ref|WP_010871638.1|  cell division protein FtsH                         293   2e-91    Synechocystis
ref|WP_008275101.1|  cell division protein FtsH                         293   2e-91    Cyanothece sp. CCY0110
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...    293   3e-91    Microcystis aeruginosa
ref|WP_002797753.1|  cell division protein FtsH                         293   3e-91    Microcystis aeruginosa
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH           293   3e-91    Microcystis
ref|WP_017320405.1|  cell division protein FtsH                         293   4e-91    cyanobacterium PCC 7702
ref|WP_002801795.1|  cell division protein FtsH                         292   5e-91    Microcystis aeruginosa
ref|WP_038542994.1|  cell division protein FtsH                         292   5e-91    Synechococcus sp. KORDI-100
ref|WP_002793446.1|  cell division protein FtsH                         292   5e-91    Microcystis aeruginosa
ref|WP_017312914.1|  cell division protein FtsH                         292   5e-91    Fischerella sp. PCC 9339
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3          292   6e-91    Microcystis aeruginosa
ref|WP_002742170.1|  cell division protein FtsH                         292   6e-91    Microcystis
ref|WP_025922823.1|  cell division protein FtsH                         292   7e-91    
ref|WP_032527521.1|  cell division protein FtsH                         292   7e-91    Prochlorococcus marinus
ref|WP_002771354.1|  cell division protein FtsH                         292   7e-91    Microcystis aeruginosa
ref|WP_016862523.1|  cell division protein FtsH                         292   8e-91    Fischerella muscicola
ref|WP_019478058.1|  cell division protein FtsH                         292   8e-91    
ref|WP_026723275.1|  cell division protein FtsH                         292   8e-91    Hapalosiphonaceae
ref|WP_019477234.1|  cell division protein FtsH                         292   9e-91    
ref|WP_012264056.1|  cell division protein FtsH                         292   9e-91    Microcystis aeruginosa
ref|WP_036901462.1|  cell division protein FtsH                         291   1e-90    Prochlorococcus sp. MIT 0601
ref|WP_036922150.1|  cell division protein FtsH                         291   1e-90    
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit           291   1e-90    Cyanobacterium aponinum
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH           291   1e-90    Cyanothece
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit           291   2e-90    Cyanobacteria [blue-green bacteria]
ref|WP_016867387.1|  cell division protein FtsH                         291   2e-90    Fischerella muscicola
ref|WP_015109466.1|  ATP-dependent metalloprotease FtsH                 291   2e-90    Cyanobacteria [blue-green bacteria]
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH                 291   2e-90    Xenococcus sp. PCC 7305
ref|WP_017293936.1|  cell division protein FtsH                         290   3e-90    Geminocystis herdmanii
ref|WP_028949001.1|  cell division protein FtsH                         290   3e-90    Synechocystis sp. PCC 6714
ref|WP_007100703.1|  cell division protein FtsH                         290   3e-90    Synechococcus sp. RS9917
ref|WP_019474071.1|  MULTISPECIES: cell division protein FtsH           290   3e-90    
ref|WP_006453661.1|  cell division protein FtsH                         290   4e-90    Synechococcus sp. PCC 7335
ref|WP_035832496.1|  cell division protein FtsH                         290   4e-90    
ref|WP_019476442.1|  cell division protein FtsH                         290   4e-90    
ref|WP_016876546.1|  cell division protein FtsH                         290   4e-90    Chlorogloeopsis fritschii
ref|WP_006102026.1|  cell division protein FtsH                         289   7e-90    Coleofasciculus chthonoplastes
ref|WP_011819579.1|  cell division protein FtsH                         290   7e-90    Prochlorococcus marinus
ref|WP_017303138.1|  cell division protein FtsH                         290   7e-90    Spirulina subsalsa
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3                289   9e-90    Thermosynechococcus sp. NK55a
ref|WP_011826974.1|  cell division protein FtsH                         289   9e-90    Prochlorococcus sp. MIT 1306
ref|WP_013320241.1|  cell division protein FtsH                         289   9e-90    Cyanothece sp. PCC 7822
ref|WP_011055986.1|  cell division protein FtsH                         289   9e-90    Thermosynechococcus
ref|WP_011936606.1|  cell division protein FtsH                         289   9e-90    
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH           289   1e-89    Prochlorococcus
ref|WP_009556886.1|  ATP-dependent metalloprotease FtsH                 289   1e-89    Oscillatoriales cyanobacterium JSC-12
ref|WP_006042287.1|  cell division protein FtsH                         289   1e-89    Synechococcus sp. WH 7805
ref|WP_011932280.1|  cell division protein FtsH                         289   1e-89    Synechococcus sp. WH 7803
ref|WP_026730933.1|  cell division protein FtsH                         289   1e-89    Fischerella sp. PCC 9605
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH           289   1e-89    Synechococcus
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH           288   1e-89    Lyngbya confervoides
ref|WP_039716361.1|  cell division protein FtsH                         288   1e-89    
ref|WP_019506377.1|  cell division protein FtsH                         288   2e-89    Pleurocapsa sp. PCC 7319
ref|WP_027255466.1|  cell division protein FtsH                         288   2e-89    Planktothrix agardhii
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit           288   2e-89    Cyanobacteria [blue-green bacteria]
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit           288   2e-89    
ref|WP_011131865.1|  cell division protein FtsH                         288   2e-89    Prochlorococcus marinus
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH           288   3e-89    Planktothrix
ref|WP_026097926.1|  cell division protein FtsH                         288   3e-89    Geitlerinema sp. PCC 7105
ref|WP_011124410.1|  cell division protein FtsH                         287   3e-89    Prochlorococcus marinus
ref|WP_043694696.1|  cell division protein FtsH                         288   4e-89    Synechococcus sp. KORDI-49
ref|WP_042152619.1|  cell division protein FtsH                         287   4e-89    Planktothrix agardhii
ref|WP_027249137.1|  cell division protein FtsH                         287   4e-89    Planktothrix agardhii
gb|KIE06858.1|  cell division protein FtsH                              287   5e-89    Tolypothrix bouteillei VB521301
ref|WP_036892144.1|  MULTISPECIES: cell division protein FtsH           287   6e-89    Prochlorococcus
ref|WP_015955558.1|  cell division protein FtsH                         287   6e-89    Cyanothece sp. PCC 7424
ref|WP_038331075.1|  cell division protein FtsH                         287   6e-89    filamentous cyanobacterium ESFC-1
emb|CCH67048.1|  Cell division protein FtsH                             283   6e-89    Richelia intracellularis HH01
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH           287   6e-89    Synechococcus
ref|WP_011131165.1|  cell division protein FtsH                         287   6e-89    Prochlorococcus marinus
ref|WP_017715041.1|  cell division protein FtsH                         287   7e-89    Oscillatoria sp. PCC 10802
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH                 287   7e-89    Pleurocapsa minor
ref|WP_024546675.1|  cell division protein FtsH                         287   7e-89    Synechococcus
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit           286   7e-89    Crinalium epipsammum
ref|WP_026786321.1|  cell division protein FtsH                         286   8e-89    Planktothrix rubescens
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH                 286   9e-89    Microcoleus sp. PCC 7113
ref|WP_017291153.1|  cell division protein FtsH                         286   9e-89    Leptolyngbya boryana
gb|KGG16707.1|  Cell division protein FtsH                              286   9e-89    Prochlorococcus sp. MIT 0602
ref|WP_006172329.1|  cell division protein FtsH                         286   1e-88    Synechococcus sp. WH 5701
ref|WP_036916506.1|  MULTISPECIES: cell division protein FtsH           286   1e-88    Prochlorococcus
ref|WP_040054828.1|  cell division protein FtsH                         286   1e-88    
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit           286   1e-88    Leptolyngbya sp. PCC 7376
ref|WP_006623490.1|  cell division protein FtsH                         285   1e-88    
ref|WP_035155002.1|  cell division protein FtsH                         286   2e-88    Calothrix sp. 336/3
ref|WP_017743955.1|  cell division protein FtsH                         286   2e-88    Scytonema hofmannii
ref|WP_006618677.1|  FtsH peptidase                                     286   2e-88    Arthrospira platensis
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH           286   2e-88    Arthrospira
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH                 285   2e-88    Synechocystis sp. PCC 7509
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH                 286   2e-88    Rubidibacter lacunae
ref|WP_036486108.1|  cell division protein FtsH                         286   2e-88    Myxosarcina sp. GI1
emb|CDN17247.1|  Cell division protein FtsH                             285   2e-88    Richelia intracellularis
ref|XP_001419590.1|  predicted protein                                  286   3e-88    Ostreococcus lucimarinus CCE9901
ref|WP_040935720.1|  cell division protein FtsH                         285   3e-88    
ref|WP_037224718.1|  cell division protein FtsH                         285   3e-88    
ref|WP_036001623.1|  cell division protein FtsH                         285   3e-88    [Leptolyngbya] sp. JSC-1
ref|WP_012954347.1|  cell division protein FtsH                         285   3e-88    Candidatus Atelocyanobacterium thalassa
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH                 285   3e-88    Leptolyngbya sp. PCC 6406
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit           285   4e-88    Rivularia sp. PCC 7116
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit           285   4e-88    Geitlerinema sp. PCC 7407
ref|WP_010311939.1|  cell division protein FtsH                         285   4e-88    Synechococcus sp. CB0101
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit           285   4e-88    Oscillatoria nigro-viridis
ref|WP_028082599.1|  cell division protein FtsH                         285   5e-88    Dolichospermum circinale
ref|WP_028090468.1|  cell division protein FtsH                         285   5e-88    Dolichospermum circinale
ref|WP_006278775.1|  cell division protein FtsH                         284   6e-88    Cylindrospermopsis
ref|WP_015162315.1|  ATP-dependent metalloprotease FtsH                 285   6e-88    Chamaesiphon minutus
ref|WP_009341877.1|  cell division protein FtsH                         284   7e-88    
ref|WP_026099187.1|  cell division protein FtsH                         284   8e-88    
ref|WP_006853632.1|  cell division protein FtsH                         284   1e-87    
ref|WP_011127179.1|  cell division protein FtsH                         283   1e-87    
ref|WP_012411183.1|  cell division protein FtsH                         283   1e-87    
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit           283   1e-87    
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)          283   1e-87    
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH                 283   1e-87    
ref|WP_036531425.1|  cell division protein FtsH                         283   1e-87    
ref|WP_038551333.1|  cell division protein FtsH                         283   1e-87    
gb|AII47735.1|  cell division protein FtsH                              283   1e-87    
ref|WP_044492620.1|  cell division protein FtsH                         283   1e-87    
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit                283   1e-87    
ref|WP_011618327.1|  cell division protein FtsH                         283   2e-87    
ref|WP_008230065.1|  Cell division protein FtsH                         283   2e-87    
gb|EHJ10086.1|  Cell division protein FtsH                              282   2e-87    
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                      283   2e-87    
ref|WP_011363329.1|  cell division protein FtsH                         283   2e-87    
ref|WP_012162910.1|  cell division protein FtsH                         283   2e-87    
ref|WP_027841867.1|  cell division protein FtsH                         283   2e-87    
ref|WP_027401619.1|  cell division protein FtsH                         283   2e-87    
ref|WP_019494535.1|  cell division protein FtsH                         283   3e-87    
ref|WP_006633639.1|  cell division protein FtsH                         283   3e-87    
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH           283   3e-87    
ref|WP_010995433.1|  cell division protein FtsH                         282   3e-87    
gb|ADD94882.1|  FtsH peptidase                                          283   3e-87    
ref|WP_029633975.1|  cell division protein FtsH [                       282   3e-87    
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit           282   4e-87    
ref|WP_021836615.1|  Cell division protein FtsH                         282   4e-87    
ref|WP_021830407.1|  Cell division protein FtsH                         282   4e-87    
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit           282   4e-87    
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit           282   5e-87    
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH                 282   5e-87    
ref|WP_010314566.1|  cell division protein FtsH                         282   5e-87    
ref|WP_013189950.1|  cell division protein FtsH                         282   5e-87    
ref|WP_016949229.1|  cell division protein FtsH                         281   6e-87    
ref|WP_039740989.1|  cell division protein FtsH                         281   8e-87    
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit           281   8e-87    
ref|WP_041036156.1|  cell division protein FtsH                         281   8e-87    
ref|WP_007099803.1|  cell division protein FtsH                         281   9e-87    
ref|WP_012627305.1|  cell division protein FtsH                         281   1e-86    
ref|WP_017315070.1|  cell division protein FtsH                         281   1e-86    
ref|WP_011360789.1|  cell division protein FtsH                         281   1e-86    
gb|KIJ85386.1|  cell division protein FtsH                              281   2e-86    
ref|WP_009788844.1|  cell division protein FtsH                         280   2e-86    
ref|WP_011317448.1|  cell division protein FtsH                         280   2e-86    
ref|WP_036906170.1|  cell division protein FtsH                         280   2e-86    
ref|WP_009782358.1|  cell division protein FtsH                         280   3e-86    
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3          280   3e-86    
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH                 280   4e-86    
ref|WP_017653544.1|  cell division protein FtsH                         280   4e-86    
gb|ADF81075.1|  FtsH                                                    267   5e-86    
ref|WP_015197493.1|  membrane protease FtsH catalytic subunit           279   5e-86    
ref|WP_038651066.1|  cell division protein FtsH                         279   6e-86    
ref|WP_011294228.1|  cell division protein FtsH                         279   6e-86    
ref|WP_011823081.1|  cell division protein FtsH                         279   6e-86    
ref|WP_011613138.1|  cell division protein FtsH                         279   8e-86    
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit           279   8e-86    
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit           278   1e-85    
ref|WP_006198086.1|  cell division protein FtsH                         277   5e-85    
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                275   8e-84    
gb|AFK49239.1|  unknown                                                 261   4e-83    
ref|WP_025953358.1|  hypothetical protein                               257   1e-81    
ref|YP_002049185.1|  cell division protein ftsH                         268   1e-81    
gb|ABH09265.1|  cell division protein                                   267   2e-81    
ref|WP_011141915.1|  cell division protein FtsH                         267   3e-81    
ref|WP_015167033.1|  ATP-dependent metalloprotease FtsH                 265   3e-80    
ref|WP_023174221.1|  ATP-dependent metalloprotease FtsH                 263   5e-80    
ref|WP_015165890.1|  ATP-dependent metalloprotease FtsH                 262   2e-79    
ref|XP_005713345.1|  cell division protein FtsH                         263   4e-79    
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435              263   5e-79    
ref|WP_019500986.1|  cell division protein FtsH                         259   2e-78    
gb|ACV52574.1|  FtsH-like protein                                       242   2e-76    
ref|XP_005708438.1|  AAA-type ATPase                                    256   9e-76    
ref|WP_009628744.1|  membrane protease FtsH catalytic subunit           251   5e-75    
ref|WP_017324919.1|  hypothetical protein                               249   2e-74    
ref|WP_011431525.1|  cell division protein FtsH                         246   5e-73    
ref|WP_011432278.1|  cell division protein FtsH                         245   1e-72    
ref|XP_005538209.1|  cell division protein FtsH                         244   1e-71    
ref|WP_010468934.1|  cell division protein FtsH                         241   3e-71    
gb|KJB14313.1|  hypothetical protein B456_002G118800                    234   4e-69    
ref|XP_005708136.1|  AAA-type ATPase                                    235   4e-68    
ref|XP_002287516.1|  metalloprotease                                    226   7e-66    
ref|XP_002177215.1|  predicted protein                                  220   5e-63    
gb|EJK55379.1|  hypothetical protein THAOC_24887                        218   2e-62    
ref|XP_002291485.1|  chloroplast ftsH                                   214   2e-61    
gb|EWM30233.1|  atp-dependent metalloprotease                           210   5e-59    
emb|CBN76650.1|  FtsH protease                                          206   1e-57    
ref|WP_022344010.1|  aTP-dependent metallopeptidase HflB subfamil...    203   2e-57    
gb|AHJ28404.1|  Cell division protein FtsH                              203   2e-57    
ref|WP_018875886.1|  MULTISPECIES: ATP-dependent metalloprotease        204   3e-57    
ref|WP_018867786.1|  MULTISPECIES: ATP-dependent metalloprotease        204   3e-57    
ref|WP_006199059.1|  cell division protein FtsH                         203   4e-57    
ref|WP_018937957.1|  MULTISPECIES: ATP-dependent metalloprotease        203   7e-57    
ref|WP_018146241.1|  MULTISPECIES: ATP-dependent metalloprotease        203   7e-57    
ref|WP_044452899.1|  cell division protein FtsH                         197   9e-57    
ref|WP_027717445.1|  cell division protein FtsH                         202   9e-57    
ref|WP_019593923.1|  ATP-dependent metalloprotease                      202   1e-56    
ref|WP_013119121.1|  cell division protein FtsH                         202   1e-56    
ref|WP_041274355.1|  cell division protein FtsH                         201   2e-56    
gb|ABO48676.1|  membrane protease FtsH catalytic subunit                201   2e-56    
ref|WP_018948798.1|  ATP-dependent metalloprotease                      201   2e-56    
ref|WP_015119379.1|  membrane protease FtsH catalytic subunit           201   3e-56    
ref|WP_018862431.1|  MULTISPECIES: ATP-dependent metalloprotease        201   3e-56    
ref|WP_041424761.1|  cell division protein FtsH                         201   3e-56    
dbj|BAP57909.1|  ATP-dependent metalloprotease FtsH                     201   3e-56    
ref|WP_031459350.1|  cell division protein FtsH                         201   4e-56    
ref|WP_018141827.1|  MULTISPECIES: ATP-dependent metalloprotease        201   4e-56    
ref|WP_038051416.1|  ATP-dependent metalloprotease                      201   5e-56    
gb|ACZ41968.1|  ATP-dependent metalloprotease FtsH                      200   5e-56    
ref|WP_008412160.1|  ATP-dependent zinc metalloprotease FtsH            199   6e-56    
ref|WP_040355337.1|  ATP-dependent metalloprotease                      199   9e-56    
gb|EEV88713.1|  ATP-dependent metallopeptidase HflB                     199   1e-55    
ref|WP_039253834.1|  cell division protein FtsH                         199   1e-55    
ref|WP_022451567.1|  aTP-dependent metallopeptidase HflB subfamil...    199   1e-55    
ref|WP_036002156.1|  cell division protein FtsH                         193   2e-55    
ref|WP_031388311.1|  cell division protein FtsH                         198   2e-55    
ref|WP_028457503.1|  cell division protein FtsH                         199   2e-55    
ref|WP_009459923.1|  MULTISPECIES: cell division protein FtsH           198   2e-55    
ref|WP_018864965.1|  ATP-dependent metalloprotease                      199   2e-55    
gb|EDS77193.1|  putative Cell division protease FtsH homolog            199   2e-55    
ref|WP_019623587.1|  MULTISPECIES: ATP-dependent metalloprotease        199   3e-55    
ref|WP_021202559.1|  ATP-dependent metalloprotease                      192   3e-55    
ref|WP_043989340.1|  cell division protein FtsH                         199   3e-55    
ref|WP_016869882.1|  cell division protein FtsH                         198   3e-55    
ref|WP_017322954.1|  cell division protein FtsH                         198   3e-55    
ref|WP_024326958.1|  ATP-dependent metalloprotease                      199   3e-55    
ref|WP_002682906.1|  ATP-dependent metalloprotease                      198   3e-55    
ref|WP_039738012.1|  cell division protein FtsH                         198   3e-55    
ref|WP_015124159.1|  membrane protease FtsH catalytic subunit           198   3e-55    
ref|WP_035150451.1|  cell division protein FtsH                         198   3e-55    
ref|WP_019584275.1|  ATP-dependent metalloprotease                      198   3e-55    
ref|WP_039280930.1|  cell division protein FtsH                         198   3e-55    
ref|WP_016858941.1|  cell division protein FtsH                         198   4e-55    
emb|CCH67560.1|  Cell division protein FtsH                             193   4e-55    
gb|KHD08639.1|  ATP-dependent metalloprotease                           198   4e-55    
ref|WP_008931990.1|  ATP-dependent metalloprotease                      197   5e-55    
ref|WP_013191839.1|  cell division protein FtsH                         197   6e-55    
emb|CEO89112.1|  cell-division protein and general stress protein...    194   6e-55    
ref|WP_015153530.1|  membrane protease FtsH catalytic subunit           197   6e-55    
ref|WP_026732891.1|  cell division protein FtsH                         197   6e-55    
ref|WP_027356271.1|  cell division protein FtsH                         197   7e-55    
ref|WP_026719681.1|  cell division protein FtsH                         197   7e-55    
gb|ETA79344.1|  cell division protein FtsH                              197   7e-55    
ref|WP_015170903.1|  membrane protease FtsH catalytic subunit           197   7e-55    
ref|WP_017941358.1|  MULTISPECIES: ATP-dependent metalloprotease        197   8e-55    
ref|WP_019024747.1|  MULTISPECIES: ATP-dependent metalloprotease        197   8e-55    
ref|WP_017925965.1|  ATP-dependent metalloprotease                      197   8e-55    
ref|WP_012408087.1|  cell division protein FtsH                         197   8e-55    
ref|WP_018138282.1|  MULTISPECIES: ATP-dependent metalloprotease        197   8e-55    
ref|WP_012982116.1|  ATP-dependent metalloprotease                      197   9e-55    
ref|WP_011565143.1|  cell division protein FtsH                         197   9e-55    
ref|WP_007573233.1|  cell division protein FtsH                         197   1e-54    
ref|WP_027845285.1|  cell division protein FtsH                         197   1e-54    
ref|WP_029633486.1|  cell division protein FtsH [                       196   1e-54    
gb|AHB35104.1|  putative plastid division protein                       196   1e-54    
ref|YP_009027610.1|  putative plastid division protein                  196   1e-54    
ref|WP_018940736.1|  ATP-dependent metalloprotease                      197   1e-54    
ref|WP_015216796.1|  membrane protease FtsH catalytic subunit           196   1e-54    
ref|WP_016951384.1|  cell division protein FtsH                         196   2e-54    
ref|WP_011564781.1|  cell division protein FtsH                         196   2e-54    
ref|WP_025280931.1|  MULTISPECIES: ATP-dependent metalloprotease        196   2e-54    
ref|WP_011056581.1|  cell division protein FtsH                         196   2e-54    
gb|ABC70534.1|  ATPase                                                  185   2e-54    
ref|WP_009302174.1|  ATP-dependent metalloprotease                      196   2e-54    
ref|WP_020990697.1|  ATP-dependent metallopeptidase HflB                196   3e-54    
ref|WP_017312271.1|  cell division protein FtsH                         196   3e-54    
ref|WP_010997786.1|  cell division protein FtsH                         195   3e-54    
ref|WP_040389162.1|  ATP-dependent metalloprotease                      196   3e-54    
ref|WP_012257906.1|  MULTISPECIES: cell division protein FtsH           196   3e-54    
ref|WP_012629618.1|  cell division protein FtsH                         195   3e-54    
gb|EHM53778.1|  cell division protease FtsH                             195   3e-54    
ref|WP_039716067.1|  cell division protein FtsH                         195   4e-54    
ref|WP_015740013.1|  cell division protein FtsH                         195   4e-54    
ref|WP_023174351.1|  ATP-dependent metalloprotease FtsH                 195   4e-54    
ref|WP_017651155.1|  cell division protein FtsH                         195   4e-54    
ref|WP_018234080.1|  ATP-dependent metalloprotease                      195   4e-54    
ref|WP_019641895.1|  ATP-dependent metalloprotease                      195   4e-54    
ref|YP_001293616.1|  cell division protein                              195   5e-54    
ref|WP_006456705.1|  cell division protein FtsH                         195   5e-54    
ref|WP_006508907.1|  ATP-dependent metalloprotease FtsH                 195   5e-54    
ref|WP_016876491.1|  cell division protein FtsH                         194   5e-54    
ref|WP_034106139.1|  cell division protein FtsH                         194   6e-54    
ref|WP_012408423.1|  cell division protein FtsH                         195   6e-54    
ref|WP_040908051.1|  cell division protein FtsH                         194   6e-54    
ref|WP_015112002.1|  membrane protease FtsH catalytic subunit           194   6e-54    
ref|WP_006523235.1|  cell division protein FtsH                         194   7e-54    
ref|WP_015941389.1|  cell division protein FtsH                         194   7e-54    
ref|WP_037216619.1|  cell division protein FtsH                         194   8e-54    
gb|AFW93266.1|  ATP-dependent metallopeptidase                          194   8e-54    
ref|WP_041739648.1|  cell division protein FtsH                         194   8e-54    
ref|WP_018934759.1|  ATP-dependent metalloprotease                      194   8e-54    
emb|CDN10469.1|  Cell division protein FtsH                             194   8e-54    
gb|AFZ02140.1|  membrane protease FtsH catalytic subunit                194   9e-54    
emb|CCP10974.1|  cell division protease FtsH                            186   9e-54    
ref|WP_013840279.1|  cell division protein FtsH                         194   9e-54    
ref|WP_022658404.1|  ATP-dependent metalloprotease                      194   9e-54    
ref|WP_036533052.1|  cell division protein FtsH                         194   9e-54    
ref|WP_021954053.1|  aTP-dependent metalloprotease FtsH                 194   1e-53    
ref|WP_011319922.1|  cell division protein FtsH                         194   1e-53    
ref|WP_009555904.1|  membrane protease FtsH catalytic subunit           194   1e-53    
dbj|GAC08157.1|  ATP-dependent zinc metalloprotease FtsH                192   1e-53    
ref|WP_000629598.1|  hypothetical protein                               184   1e-53    
ref|WP_041282707.1|  cell division protein FtsH                         194   1e-53    
ref|WP_009847543.1|  ATP-dependent Zn protease                          186   1e-53    
dbj|GAC07952.1|  ATP-dependent zinc metalloprotease FtsH                192   1e-53    
ref|WP_028575310.1|  cell division protein FtsH                         194   1e-53    
ref|YP_007947857.1|  cell division protein                              194   1e-53    
gb|AEG13855.1|  ATP-dependent metalloprotease FtsH                      194   1e-53    
ref|WP_012162627.1|  cell division protein FtsH                         194   1e-53    
ref|WP_041457570.1|  cell division protein FtsH                         194   1e-53    
ref|WP_013809431.1|  cell division protein FtsH                         193   1e-53    
ref|YP_537009.1|  cell division protein                                 194   1e-53    
ref|WP_003540641.1|  cell division protein FtsH                         193   1e-53    
ref|WP_026082835.1|  cell division protein FtsH                         194   1e-53    
ref|WP_015188757.1|  membrane protease FtsH catalytic subunit           193   1e-53    
gb|AIA21561.1|  putative plastid division protein                       193   1e-53    
ref|WP_015132046.1|  membrane protease FtsH catalytic subunit           193   2e-53    
ref|WP_017654114.1|  cell division protein FtsH                         193   2e-53    
ref|WP_041570995.1|  cell division protein FtsH                         193   2e-53    
gb|ELT56972.1|  ATP-dependent metallopeptidase HflB                     187   2e-53    



>gb|KHN33816.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Glycine 
soja]
Length=325

 Score =   438 bits (1126),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  105  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  164

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  165  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  224

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT 
Sbjct  225  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATH  284

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  285  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  325



>emb|CBI18876.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   441 bits (1134),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  318  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  377

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  378  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  437

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA Q
Sbjct  438  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQ  497

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  498  IMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  538



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   443 bits (1140),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/221 (98%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  495  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  554

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  555  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  614

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQ
Sbjct  615  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQ  674

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  675  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|NP_001183829.1| uncharacterized protein LOC100502422 [Zea mays]
 gb|ACR38427.1| unknown [Zea mays]
Length=475

 Score =   434 bits (1116),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  255  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  314

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  315  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  374

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA Q
Sbjct  375  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQ  434

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  435  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  475



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score =   434 bits (1115),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  243  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  302

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  303  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  362

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA Q
Sbjct  363  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQ  422

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  423  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  463



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   440 bits (1132),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  443  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  502

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  503  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  562

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA Q
Sbjct  563  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQ  622

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  623  IMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  663



>ref|XP_006656509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Oryza brachyantha]
Length=475

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  255  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  314

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  315  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  374

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQ
Sbjct  375  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQ  434

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  435  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  475



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   441 bits (1135),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 215/221 (97%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  493  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  552

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  553  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  612

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQM+TQKDYSMATADVVDAEVRELVE+AYSRATQ
Sbjct  613  MVERFGFSKKIGQVAIGGPGGNPFLGQQMATQKDYSMATADVVDAEVRELVEKAYSRATQ  672

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            II THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  673  IINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   440 bits (1131),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 215/221 (97%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  489  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  548

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  549  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  608

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAT 
Sbjct  609  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATN  668

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  669  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  709



>dbj|BAJ85305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   423 bits (1088),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  29   SDALERIIAGPEKKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  88

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQ
Sbjct  89   TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQ  148

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQ
Sbjct  149  MVERFGFSKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQ  208

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            II THIDILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  209  IINTHIDILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  249



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   439 bits (1129),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  486  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  545

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  546  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  605

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA Q
Sbjct  606  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQ  665

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  666  IMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  706



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   439 bits (1130),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 213/221 (96%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  500  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  559

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  560  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQ  619

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSK+IGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQ
Sbjct  620  MVERFGFSKRIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARATQ  679

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  680  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  720



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   439 bits (1128),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  476  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  535

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  536  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  595

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT 
Sbjct  596  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATH  655

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  656  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  696



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   438 bits (1127),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  495  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  554

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  555  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  614

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA  
Sbjct  615  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKH  674

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  675  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  715



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   437 bits (1125),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/221 (96%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  465  SDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  524

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  525  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  584

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQ
Sbjct  585  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQ  644

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  645  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  685



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   438 bits (1126),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  483  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  542

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  543  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  602

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQ
Sbjct  603  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYTRATQ  662

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  663  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  703



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   438 bits (1127),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/221 (97%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  495  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  554

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  555  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  614

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRA Q
Sbjct  615  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRAKQ  674

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTH DILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  675  IITTHNDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   437 bits (1125),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 213/221 (96%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  483  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  542

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  543  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  602

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAY+RA Q
Sbjct  603  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYTRAKQ  662

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  663  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  703



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   437 bits (1124),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 213/221 (96%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  474  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  533

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  534  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  593

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT 
Sbjct  594  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATH  653

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            II+THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  654  IISTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  694



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   434 bits (1117),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  410  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  469

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  470  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  529

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQ
Sbjct  530  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQ  589

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  590  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  630



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   437 bits (1124),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  503  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  562

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQ
Sbjct  563  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQ  622

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA Q
Sbjct  623  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQ  682

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  683  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   437 bits (1123),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 214/221 (97%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  503  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  562

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQ
Sbjct  563  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQ  622

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA Q
Sbjct  623  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQ  682

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  683  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   436 bits (1120),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  495  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  554

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQM+VALGGR+AEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  555  TFFAPSEERLESGLYSRSYLENQMSVALGGRIAEEVIFGEDNVTTGASNDFMQVSRVARQ  614

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA Q
Sbjct  615  MVERFGFSKKIGQVAIGGSGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKQ  674

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV+
Sbjct  675  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVS  715



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   434 bits (1116),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  468  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  527

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  528  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  587

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA Q
Sbjct  588  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQ  647

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  648  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  688



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   432 bits (1112),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EK++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  466  SDALERIIAGPEKKNAVVSEEKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  525

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  526  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  585

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQ
Sbjct  586  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQ  645

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  646  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   432 bits (1112),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 220/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EK++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  466  SDALERIIAGPEKKNAVVSEEKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  525

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  526  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  585

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQ
Sbjct  586  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQ  645

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  646  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   433 bits (1113),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  485  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  544

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQ
Sbjct  545  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQ  604

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA Q
Sbjct  605  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQ  664

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  665  IMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   432 bits (1112),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  484  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  543

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  544  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  603

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA Q
Sbjct  604  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQ  663

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  664  IITTHIDILHKLAQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   432 bits (1112),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  484  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  543

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  544  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  603

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA Q
Sbjct  604  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQ  663

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  664  IITTHIDILHKLAQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   432 bits (1111),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  493  SDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  552

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  553  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  612

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAYSRA Q
Sbjct  613  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYSRAKQ  672

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTH+DILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  673  IMTTHVDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  713



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   432 bits (1110),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  486  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  545

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  546  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  605

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA Q
Sbjct  606  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRAKQ  665

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILHKLAQLLIEKETVDGEEF+SLFIDGKAEL+VA
Sbjct  666  IMTTHIDILHKLAQLLIEKETVDGEEFLSLFIDGKAELYVA  706



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   431 bits (1109),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  486  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  545

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  546  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  605

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRA Q
Sbjct  606  MVERFGFSKKIGQVAIGGSGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAKQ  665

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTH DILHKLAQLLIEKETVDG+EFMSLFIDGKAEL+VA
Sbjct  666  IITTHSDILHKLAQLLIEKETVDGDEFMSLFIDGKAELYVA  706



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   430 bits (1106),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  455  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  514

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  515  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQ  574

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT 
Sbjct  575  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATD  634

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  635  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  675



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   431 bits (1109),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  490  SDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  549

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  550  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  609

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA Q
Sbjct  610  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKQ  669

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILHKLA LLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  670  ILTTHIDILHKLALLLIEKETVDGEEFMSLFIDGKAELYVS  710



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   431 bits (1108),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 209/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  482  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  541

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  542  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  601

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE AY+RA Q
Sbjct  602  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVETAYTRAKQ  661

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGK EL+V+
Sbjct  662  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKTELYVS  702



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   431 bits (1108),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 209/221 (95%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  479  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  538

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYL+NQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQ
Sbjct  539  TFFAPSEERLESGLYSRSYLQNQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQ  598

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AYSRA Q
Sbjct  599  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYSRAKQ  658

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  659  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   431 bits (1107),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  483  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  542

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  543  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQ  602

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT 
Sbjct  603  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATD  662

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  663  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  703



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   431 bits (1107),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  482  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  541

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  542  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQ  601

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT 
Sbjct  602  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATD  661

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  662  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  702



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   431 bits (1107),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  503  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  562

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG DNVTTGASNDFMQVSRVARQ
Sbjct  563  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGNDNVTTGASNDFMQVSRVARQ  622

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA Q
Sbjct  623  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQ  682

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+T +IDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  683  IMTDNIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  723



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   430 bits (1105),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 204/221 (92%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  500  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  559

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  560  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  619

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  620  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  679

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  680  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  720



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   429 bits (1104),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  495  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  554

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+ VTTGASNDFMQVSRVARQ
Sbjct  555  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEEKVTTGASNDFMQVSRVARQ  614

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSK+IGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVERAY+RA Q
Sbjct  615  MVERLGFSKRIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVERAYARAKQ  674

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  675  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   429 bits (1104),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  502  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  561

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  562  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  621

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  622  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  681

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  682  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  722



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   429 bits (1102),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 204/221 (92%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  498  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  557

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  558  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  617

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  618  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  677

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  678  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  718



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   428 bits (1101),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/221 (94%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  485  SDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  544

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQ
Sbjct  545  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQ  604

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA Q
Sbjct  605  MVERFGFSKKIGQVAIGGSGGNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQ  664

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  665  IMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>gb|EMS62975.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Triticum 
urartu]
Length=494

 Score =   421 bits (1082),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  274  SDALERIIAGPEKKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  333

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQ
Sbjct  334  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQ  393

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQ
Sbjct  394  MVERFGFSKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQ  453

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            II THIDILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  454  IINTHIDILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  494



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   427 bits (1099),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  493  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  552

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  553  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKENVTTGASNDFMQVSRVARQ  612

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELV+ AYSRA  
Sbjct  613  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVDEAYSRAKH  672

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITT IDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  673  IITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   427 bits (1099),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  502  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  561

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  562  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  621

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  622  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  681

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  682  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  722



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   427 bits (1099),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  503  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  562

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  563  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  622

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  623  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  682

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  683  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  723



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   427 bits (1099),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  504  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  563

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  564  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  623

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  624  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  683

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  684  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  724



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   427 bits (1097),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 219/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  496  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  555

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  556  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  615

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  616  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  675

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  676  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  716



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   426 bits (1095),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/221 (94%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  499  SDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  558

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQ
Sbjct  559  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQ  618

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQ
Sbjct  619  MVERFGFSKKIGQVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQ  678

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  679  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   426 bits (1095),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/221 (94%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  499  SDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  558

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQ
Sbjct  559  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQ  618

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQ
Sbjct  619  MVERFGFSKKIGQVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQ  678

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  679  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   425 bits (1093),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/221 (94%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EK+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  504  SDALERIIAGPEKKNAVVSEEKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  563

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  564  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQ  623

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA Q
Sbjct  624  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRALQ  683

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I++ +IDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  684  IMSDNIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  724



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++K++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  461  SDALERIIAGPEKKNAVVSEQKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  520

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  521  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQ  580

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE++YSRATQ
Sbjct  581  MVERFGFSKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKSYSRATQ  640

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            II THIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  641  IINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  681



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  488  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  547

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  548  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  607

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQ
Sbjct  608  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQ  667

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELF++
Sbjct  668  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFIS  708



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  477  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  536

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEE IFG D VTTGASNDFMQVSRVARQ
Sbjct  537  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEAIFGVDKVTTGASNDFMQVSRVARQ  596

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATAD+VDAEVRELV+RAY+RA Q
Sbjct  597  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDRAYARAKQ  656

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            IITT+IDILH+LAQLLIEKETVDGEEFMSLFIDGKA++
Sbjct  657  IITTNIDILHRLAQLLIEKETVDGEEFMSLFIDGKAQM  694



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   421 bits (1083),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  488  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  547

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  548  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  607

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQ
Sbjct  608  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQ  667

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  668  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  708



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   421 bits (1083),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  487  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  546

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  547  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  606

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+
Sbjct  607  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATE  666

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  667  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   421 bits (1081),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  487  SDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  546

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  547  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  606

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RATQ
Sbjct  607  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATQ  666

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  667  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/221 (95%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  490  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  549

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  550  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  609

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQ
Sbjct  610  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQ  669

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  670  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  710



>gb|EMT09942.1| Cell division protease ftsH-like protein, chloroplastic [Aegilops 
tauschii]
Length=665

 Score =   419 bits (1076),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/222 (92%), Positives = 215/222 (97%), Gaps = 1/222 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  444  SDALERIIAGPEKKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  503

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQ
Sbjct  504  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQ  563

Query  392  MVERFGFSKKIGQIAIGGP-GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAT  216
            MVERFGFSKKIGQ+AIG   GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRAT
Sbjct  564  MVERFGFSKKIGQVAIGSSGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRAT  623

Query  215  QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            QII THIDILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  624  QIINTHIDILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  665



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/221 (95%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  495  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  554

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  555  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  614

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQ
Sbjct  615  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQ  674

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  675  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  715



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  491  ADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  550

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+ NVTTGASNDFMQVSRVARQ
Sbjct  551  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQANVTTGASNDFMQVSRVARQ  610

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+G  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  611  MVERFGFSKKIGQVAVGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  670

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLA LLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  671  IITTHIDILHKLANLLIEKESVDGEEFMSLFIDGKAELYVS  711



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   419 bits (1076),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 204/221 (92%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  498  SDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  557

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQ
Sbjct  558  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQ  617

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA  
Sbjct  618  MVERFGFSKKIGQVAIGASGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKD  677

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TTHIDILH LAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  678  IVTTHIDILHTLAQLLMEKETVDGEEFMSLFIDGKAELYVA  718



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   418 bits (1075),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  496  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  555

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  556  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  615

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  616  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  675

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG  111
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG
Sbjct  676  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG  709



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   418 bits (1075),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/221 (95%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  487  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  546

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALG RVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  547  TFFAPSEERLESGLYSRSYLENQMAVALGERVAEEVIFGQDNVTTGASNDFMQVSRVARQ  606

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+
Sbjct  607  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATE  666

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  667  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/221 (94%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  479  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  538

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQ
Sbjct  539  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQ  598

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA Q
Sbjct  599  MVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQ  658

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  659  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   417 bits (1071),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 208/221 (94%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  479  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  538

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQ
Sbjct  539  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQ  598

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA Q
Sbjct  599  MVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQ  658

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  659  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   416 bits (1068),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/220 (92%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGG 
Sbjct  501  ADALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGF  560

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQ
Sbjct  561  TFFAPSEERLESGLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQ  620

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQIA+G  GGNPFLGQQMS+QKDYSMATAD+VD EVRELVE AYSRATQ
Sbjct  621  MVERFGFSKKIGQIAVGASGGNPFLGQQMSSQKDYSMATADIVDGEVRELVETAYSRATQ  680

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  681  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYV  720



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  486  ADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  545

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  546  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQ  605

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQ
Sbjct  606  MVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQ  665

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            II THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  666  IINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   414 bits (1063),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGG 
Sbjct  501  ADALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGF  560

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQ
Sbjct  561  TFFAPSEERLESGLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQ  620

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQIA+G  GGNPFLGQ MS+QKDYSMATAD+VD EVRELVE AYSRATQ
Sbjct  621  MVERFGFSKKIGQIAVGASGGNPFLGQMMSSQKDYSMATADIVDGEVRELVETAYSRATQ  680

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  681  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYV  720



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   410 bits (1053),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++KKKLVAYHEAGHALVGALMPEYD VAKISIIPRGQAGGL
Sbjct  485  SDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDAVAKISIIPRGQAGGL  544

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFG+DNVTTGAS+DFMQVSRVARQ
Sbjct  545  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGQDNVTTGASSDFMQVSRVARQ  604

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GG+PFLGQQMS+QKDYSMATADVVDAEVRELV+ AYSRA Q
Sbjct  605  MVERFGFSKKIGQVAIGGGGGDPFLGQQMSSQKDYSMATADVVDAEVRELVDTAYSRAKQ  664

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTH+DILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  665  IITTHVDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  705



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   408 bits (1048),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 215/221 (97%), Gaps = 1/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  487  ADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  546

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEV FG+DNVTTGASNDFMQVSRVARQ
Sbjct  547  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEV-FGQDNVTTGASNDFMQVSRVARQ  605

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQ
Sbjct  606  MVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQ  665

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            II THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  666  IINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   401 bits (1030),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  485  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  544

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  545  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  604

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY+RATQ
Sbjct  605  MVERFGFSKKIGQVAVGGAGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYARATQ  664

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  665  IITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  705



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 207/220 (94%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+E+KKLVAYHEAGHALVGALMPEYDPVAKISIIPRG AGGL
Sbjct  408  SDALERIIAGPEKKNAVVSEERKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGGAGGL  467

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFG +NVTTGASNDF QVSRVARQ
Sbjct  468  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGPENVTTGASNDFQQVSRVARQ  527

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFS KIGQ+A+GG GGNPFLGQQ+S Q DYSMATADVVDAEVRELVE AY+RA  
Sbjct  528  MVERFGFSNKIGQVALGGSGGNPFLGQQLSQQSDYSMATADVVDAEVRELVESAYARAKH  587

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            +ITTH++ILHKLA LLIEKETVDGEEF+SLF+DG AEL++
Sbjct  588  LITTHVEILHKLANLLIEKETVDGEEFLSLFVDGNAELYL  627



>dbj|BAH20236.1| AT5G42270 [Arabidopsis thaliana]
Length=510

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  290  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  349

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  350  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  409

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +
Sbjct  410  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKE  469

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  470  IITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  510



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   398 bits (1022),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  489  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  548

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  549  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  608

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+
Sbjct  609  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATE  668

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  669  IITTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  709



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  487  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  546

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  547  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  606

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+
Sbjct  607  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATE  666

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  667  IVTTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  707



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  488  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  547

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  548  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  607

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+
Sbjct  608  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATE  667

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  668  IVTTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  708



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  481  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  540

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  541  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  600

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +
Sbjct  601  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKE  660

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  661  IITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  701



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  484  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  543

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  544  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  603

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +
Sbjct  604  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKE  663

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  664  IITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  704



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  485  ADALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  544

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  545  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  604

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQIAIGG GGNPFLGQQM++ KDYSMATADVVD EVRELVE AY RAT+
Sbjct  605  MVERFGFSKKIGQIAIGGGGGNPFLGQQMASSKDYSMATADVVDGEVRELVETAYKRATE  664

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+ THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  665  IVNTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  705



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   396 bits (1017),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 217/221 (98%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISI+PRGQAGGL
Sbjct  486  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISILPRGQAGGL  545

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  546  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  605

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY+RA +
Sbjct  606  MVERFGFSKKIGQVAVGGAGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYARAKE  665

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  666  IVTTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  706



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   393 bits (1009),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  478  ADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  537

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  538  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQ  597

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQ MS+QKDYSMATAD+VDAEVRELVERAY RAT 
Sbjct  598  MVERFGFSKKIGQVAIGGGGGNPFLGQSMSSQKDYSMATADIVDAEVRELVERAYERATT  657

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITT IDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  658  IITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  698



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   390 bits (1002),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS++KK+LVAYHEAGHALVGALMPEYD VAKISIIPRGQAGGL
Sbjct  490  SDALERIIAGPEKKNAVVSEDKKRLVAYHEAGHALVGALMPEYDAVAKISIIPRGQAGGL  549

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQ
Sbjct  550  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQ  609

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR+LVE+AY+RAT+
Sbjct  610  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRKLVEKAYARATE  669

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            I+TT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  670  IVTTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  710



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHAL G   PEY+PVAKISIIPRGQAGGL
Sbjct  428  SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALGGCSYPEYNPVAKISIIPRGQAGGL  487

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMA +LGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  488  TFFAPSEERLESGLYSRSYLENQMACSLGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  547

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+
Sbjct  548  MIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATE  607

Query  212  IITTHIDILHKLAQLLIEKETVDGEE  135
            IITTHIDILHKLAQLLIEKETV GE+
Sbjct  608  IITTHIDILHKLAQLLIEKETVAGED  633



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   379 bits (973),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  464  SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  523

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ
Sbjct  524  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  583

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVD+EVRELVE+AY RA Q
Sbjct  584  MVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDSEVRELVEKAYERAKQ  643

Query  212  IITTHIDILHKLAQLLIEK  156
            IITTHIDILHKLAQLLIEK
Sbjct  644  IITTHIDILHKLAQLLIEK  662



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/220 (85%), Positives = 206/220 (94%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS+EK+KLVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGL
Sbjct  414  ADALERIIAGPEKKNAVVSEEKRKLVAYHEAGHALVGALMPEYDPVAKISIVPRGGAGGL  473

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQ
Sbjct  474  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEELIYGAENVTTGASNDFMQVSRVARQ  533

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  
Sbjct  534  MVERFGFSKKIGQLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKT  593

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            I+ THIDILHKLA LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  594  IMETHIDILHKLAALLLEKETVDGEEFLNLFIDGQAELYV  633



>gb|AIS72760.1| ATP-dependent zinc metalloprotease chloroplastic-like protein, 
partial [Rhizophora apiculata]
Length=236

 Score =   362 bits (930),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  54   SDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  113

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQ
Sbjct  114  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQ  173

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AY+RA Q
Sbjct  174  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYTRAKQ  233

Query  212  IIT  204
            I+T
Sbjct  234  IVT  236



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 205/220 (93%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKKNAVVS+EK+ LVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGL
Sbjct  427  ADALERIIAGPEKKNAVVSEEKRTLVAYHEAGHALVGALMPEYDPVAKISIVPRGGAGGL  486

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQ
Sbjct  487  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEELIYGTENVTTGASNDFMQVSRVARQ  546

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  
Sbjct  547  MVERFGFSKKIGQLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKT  606

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            I+ THIDILHKLA LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  607  IMETHIDILHKLAALLLEKETVDGEEFLNLFIDGQAELYV  646



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   364 bits (934),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -3

Query  665  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  486
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  308  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  367

Query  485  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  306
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  368  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  427

Query  305  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  126
            S+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  428  SSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMS  487

Query  125  LFIDGKAELFVA  90
            LFIDGKAEL+V+
Sbjct  488  LFIDGKAELYVS  499



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   370 bits (949),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 191/221 (86%), Positives = 200/221 (90%), Gaps = 17/221 (8%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYH                 AKISIIPRGQAGGL
Sbjct  479  SDALERIIAGPEKKNAVVSDEKKKLVAYH-----------------AKISIIPRGQAGGL  521

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQ
Sbjct  522  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQ  581

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA Q
Sbjct  582  MVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQ  641

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  642  IITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  682



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 192/221 (87%), Gaps = 27/221 (12%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVSDEKKKLVAYH                           AGGL
Sbjct  499  SDALERIIAGPEKKNAVVSDEKKKLVAYH---------------------------AGGL  531

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQ
Sbjct  532  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQ  591

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA Q
Sbjct  592  MVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQ  651

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            IITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  652  IITTHIDILHKLAQLLVEKETVDGEEFMSLFIDGKAELYVS  692



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   324 bits (831),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERI+A PEKK AV+++ KK+LVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGL
Sbjct  500  SDALERIVAGPEKKGAVMTEAKKRLVAYHEAGHALVGALMPEYDPVAKISIVPRGSAGGL  559

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGR+AEE+IFGEDNVTTGASNDFMQV+R A+ 
Sbjct  560  TFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEIIFGEDNVTTGASNDFMQVARTAKM  619

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV + GFSKK+GQ+A  G GG  FLGQ M    D S  T+D +DAEV++LV+RAY RA  
Sbjct  620  MVTQMGFSKKLGQVAWSGGGGPSFLGQSMGQPADCSGQTSDEIDAEVKQLVDRAYRRAKD  679

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            ++ ++I +LHK A++L+E+E +DG+EF+ L ++ +AE ++
Sbjct  680  LMQSNITVLHKTAEVLLEREQIDGDEFLRLILESQAENYL  719



>dbj|BAH20250.1| AT5G42270 [Arabidopsis thaliana]
Length=215

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDALERIIA PEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL
Sbjct  48   SDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  107

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQ
Sbjct  108  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQ  167

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVR  249
            MVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR
Sbjct  168  MVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVR  215



>gb|KIY93255.1| cell division protease FtsH [Monoraphidium neglectum]
Length=548

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 182/220 (83%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKK AV+SD+KKKLVAYHEAGHALVGALMP+YDPV KISI+PRG AGGL
Sbjct  315  ADALERIIAGPEKKGAVMSDKKKKLVAYHEAGHALVGALMPDYDPVTKISIVPRGAAGGL  374

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR 
Sbjct  375  TFFAPSEERLESGLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARL  434

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV + GFSK +GQ+A    GGN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  
Sbjct  435  MVTQLGFSKVLGQVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKALVERAYRRAKD  494

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            +I ++IDILHK A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  495  LIQSNIDILHKTAAVLLEKENIDGDEFQQIVLESQAQQYL  534



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 169/192 (88%), Gaps = 11/192 (6%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVA-----------YHEAGHALVGALMPEYDPVAKI  606
            +DALERIIA PEKKN VVS  ++  +            + EAGHALVGAL+PEYDPVAKI
Sbjct  498  TDALERIIAGPEKKNVVVSVRRRNWLPIMVFDFLYALKFTEAGHALVGALIPEYDPVAKI  557

Query  605  SIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASN  426
            SIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVAL GR+AEEVIFGE+NVTTGASN
Sbjct  558  SIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALSGRIAEEVIFGEENVTTGASN  617

Query  425  DFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRE  246
            DFMQVSRVAR MVERFGFSKKIG++AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVR+
Sbjct  618  DFMQVSRVARHMVERFGFSKKIGRVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRD  677

Query  245  LVERAYSRATQI  210
            LVE AYSRA QI
Sbjct  678  LVETAYSRAKQI  689



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 182/220 (83%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKK AV+SD+KKKLVAYHEAGHALVGALMP+YDPV KISI+PRG AGGL
Sbjct  501  ADALERIIAGPEKKGAVMSDKKKKLVAYHEAGHALVGALMPDYDPVTKISIVPRGAAGGL  560

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR 
Sbjct  561  TFFAPSEERLESGLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARL  620

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV + GFSK +GQ+A    GGN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  
Sbjct  621  MVTQLGFSKALGQVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKSLVERAYRRAKD  680

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            +I ++IDILHK A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  681  LIQSNIDILHKTAAVLLEKENIDGDEFQQIVLESQAQQYL  720



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERI+A   K+ AV+S++KK+LVAYHEAGHA+VGALMPEYDPVAKISI+PRG AGGL
Sbjct  487  ADALERIVAGAAKEGAVMSEKKKRLVAYHEAGHAIVGALMPEYDPVAKISIVPRGAAGGL  546

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSRSYLENQMAVA+GGRVAEE+IFG ++VTTGAS DF QVS+ ARQ
Sbjct  547  TFFAPSEERLESGLYSRSYLENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQVSQTARQ  606

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+E  GFSKKIGQIA+   GG  FLG +M    DY  ATAD+VD+EV+ELV +AY RA  
Sbjct  607  MIETMGFSKKIGQIALKTGGGQSFLGGEMGRSADYGPATADLVDSEVKELVTKAYRRAKD  666

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            +++ +ID+LHK+A +L+EKE +DG+EF  +  + K+EL++
Sbjct  667  LVSINIDVLHKVADVLMEKENIDGDEFEKIMFNAKSELYL  706



>ref|WP_025929131.1| hypothetical protein, partial [Prochlorococcus sp. scB243_496A2]
Length=242

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  22   DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  81

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  82   FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  141

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  142  ITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  201

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  202  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  239



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 182/220 (83%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKK AV+SD+K++LVAYHEAGHALVGALMPEYDPV KISI+PRG AGGL
Sbjct  494  ADALERIIAGPEKKGAVMSDKKRRLVAYHEAGHALVGALMPEYDPVTKISIVPRGAAGGL  553

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR 
Sbjct  554  TFFAPSEERLESGLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARL  613

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV + G SKK+GQ+A    GG  FLG   +   D+S +TAD +D+EV+ELVERAY RA  
Sbjct  614  MVTQLGLSKKLGQVAWSNQGGASFLGASAAQPADFSQSTADEIDSEVKELVERAYRRAKD  673

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            ++  +IDILHK+A +LIEKE +DG+EF  + +  +A+ + 
Sbjct  674  LVEQNIDILHKVAAVLIEKENIDGDEFQQIVLASQAQQYT  713



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   314 bits (804),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 183/220 (83%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERIIA PEKK AV+S++K++LVAYHEAGHALVGALMPEYDPV KISI+PRG AGGL
Sbjct  489  ADALERIIAGPEKKGAVMSEKKRRLVAYHEAGHALVGALMPEYDPVTKISIVPRGAAGGL  548

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR 
Sbjct  549  TFFAPSEERLESGLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARL  608

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV + G SKK+GQ+A    GG  FLG   +   D+S ATAD +D EV+ELVERAY RA  
Sbjct  609  MVTQLGLSKKLGQVAWSSSGGAQFLGASAAQPADFSQATADEIDNEVKELVERAYRRAKD  668

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            ++ ++IDILHK+A +LIEKE +DG+EF  + +  +A+ ++
Sbjct  669  LVVSNIDILHKVAAVLIEKENIDGDEFQQIVLASQAQQYL  708



>ref|WP_029963924.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_526K3]
Length=337

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  117  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  176

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  177  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  236

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  237  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  296

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  297  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  334



>ref|WP_025947145.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_528N8]
Length=347

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  127  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  186

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  187  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  246

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  247  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKV  306

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  307  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  344



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKSLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEERLESGLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEERLESGLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q
Sbjct  513  MVTRFGMSEKLGPVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRSLVDVAYSRAKQ  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L +LA +L++KETVD +E   L ID    +
Sbjct  573  VLVENRKVLDQLADMLVDKETVDSDELQRLLIDNNVSM  610



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKSLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEERLESGLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEERLESGLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S+K+G +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q
Sbjct  513  MITRFGMSEKLGPVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRGLVDVAYSRAKQ  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L +LA++L++KETVD +E   L ID    +
Sbjct  573  VLVENRKVLDQLAEMLVDKETVDSDELQRLLIDNNVSM  610



>ref|WP_025970576.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521M10]
Length=396

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  176  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  235

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  236  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  295

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  296  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  355

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  356  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  393



>ref|WP_025954333.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=445

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  225  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  284

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  285  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  344

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  345  ITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  404

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  405  LTDNRTVLDEMAQMLIERETIDTEDIQELL--NRSEVKVA  442



>ref|WP_025961749.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_521C8]
Length=213

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 174/211 (82%), Gaps = 2/211 (1%)
 Frame = -3

Query  722  PEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERL  543
            PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+
Sbjct  2    PEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERM  61

Query  542  ESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKK  363
            ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+K
Sbjct  62   ESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEK  121

Query  362  IGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILH  183
            IG +A+G   G  FLG+ MST +D+S  TA  +D EV ELV+ AY RAT+++T +  +L 
Sbjct  122  IGPVALGQSQGGMFLGRDMSTTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLD  181

Query  182  KLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  182  EMAQMLIERETIDTEDIQDLL--NRSEVKVA  210



>ref|WP_025971093.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521N5]
Length=471

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  251  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  310

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  311  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  370

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  371  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  430

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  431  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  468



>ref|WP_044452063.1| cell division protein FtsH, partial [Mastigocladus laminosus]
 gb|KIY10627.1| cell division protein FtsH, partial [Mastigocladus laminosus 
UU774]
Length=405

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  184  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  243

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  244  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  303

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +
Sbjct  304  MVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKK  363

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA++L+EKETVD EE   L 
Sbjct  364  VLTENRHVLDQLAEMLVEKETVDAEELQDLL  394



>gb|KGF94553.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9201]
Length=580

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  360  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  419

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  420  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  479

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  480  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  539

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T + ++L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  540  LTDNRNVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  577



>ref|WP_025958220.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L15]
Length=538

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  318  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  377

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  378  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  437

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  438  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  497

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  498  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  535



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 179/220 (81%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERI+A   K+ AV+S++KK+LVAYHEAGHA+VGALMPEYDPV KISI+PRG AGGL
Sbjct  485  ADALERIVAGAAKEGAVMSEKKKRLVAYHEAGHAIVGALMPEYDPVTKISIVPRGAAGGL  544

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSR+YLENQMAVA+GGRVAEE+IFG +NVTTGAS DF QVSR AR 
Sbjct  545  TFFAPSEERLESGLYSRTYLENQMAVAMGGRVAEELIFGAENVTTGASGDFQQVSRTARM  604

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+E+ GFS+KIGQIA+   GG  FLG       DYS ATAD+VD+EV+ LVE AY RA  
Sbjct  605  MIEQMGFSEKIGQIALKTGGGQTFLGNDAGRGADYSQATADIVDSEVQALVEVAYRRAKD  664

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            ++  +I  LH +A++L++KE +DG+EF  + +  KA+L++
Sbjct  665  LVQENIQCLHDVAEVLLDKENIDGDEFEQIMLKAKAKLYL  704



>ref|WP_032522853.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T + ++L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRNVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025944375.1| cell division protein FtsH [Prochlorococcus sp. scB241_529C4]
Length=617

 Score =   298 bits (762),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGG03814.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG10073.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9401]
Length=580

 Score =   296 bits (758),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  360  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  419

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  420  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  479

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  480  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  539

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  540  LSDNRSVLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  577



>ref|WP_025922112.1| cell division protein FtsH [Prochlorococcus sp. scB241_529D18]
Length=617

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025935637.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|ABX08179.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9211]
Length=602

 Score =   296 bits (759),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+SD +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  381  SDAIERVMAGPEKKDRVMSDRRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGL  440

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  441  TFFTPSEERMESGLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQ  500

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+
Sbjct  501  MVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATK  560

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++T +  +L +LA++L+EKETV+ E+   L I  + E+
Sbjct  561  VLTNNRQVLDQLAEMLVEKETVNSEDLQDLLIQSQVEV  598



>ref|WP_025971671.1| cell division protein FtsH [Prochlorococcus sp. scB241_527L22]
Length=617

 Score =   297 bits (760),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   300 bits (767),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 177/220 (80%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALERI+A   K+ AV+S++KK+LVAYHEAGHA+VGALMPEYDPV KISI+PRG AGGL
Sbjct  496  ADALERIVAGAAKEGAVMSEKKKRLVAYHEAGHAIVGALMPEYDPVTKISIVPRGNAGGL  555

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLESGLYSR+YLENQMAVA+GGR+AEE+IFG +NVTTGAS DF QVS  AR 
Sbjct  556  TFFAPSEERLESGLYSRTYLENQMAVAMGGRIAEELIFGAENVTTGASGDFQQVSNTARM  615

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVE+ GFS+KIGQIA+   GG  FLG       DYS  TA++VD EV+ LVE AY RA  
Sbjct  616  MVEQMGFSEKIGQIALKTGGGQSFLGNDAGRAADYSQTTANIVDDEVKILVETAYRRAKD  675

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            ++  +ID LH +A++L+EKE +DG+EF  + +  +A+L++
Sbjct  676  LVQENIDCLHAVAEVLLEKENIDGDEFEEIMLKARAKLYL  715



>ref|WP_032519670.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG08326.1| Cell division protein FtsH [Prochlorococcus marinus str. SB]
Length=617

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025969610.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520E22]
Length=617

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKQLVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGG06312.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9322]
Length=600

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  380  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  439

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  440  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  499

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  500  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  559

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  560  LSDNRSVLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  597



>ref|WP_041391000.1| cell division protein FtsH [Prochlorococcus marinus]
Length=615

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+SD +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  394  SDAIERVMAGPEKKDRVMSDRRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  454  TFFTPSEERMESGLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+
Sbjct  514  MVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATK  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++T +  +L +LA++L+EKETV+ E+   L I  + E+
Sbjct  574  VLTNNRQVLDQLAEMLVEKETVNSEDLQDLLIQSQVEV  611



>ref|WP_032515715.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG01911.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9314]
Length=617

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025964562.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P15]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025951376.1| cell division protein FtsH [Prochlorococcus sp. scB243_495N4]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025939914.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025924120.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025959316.1| cell division protein FtsH [Prochlorococcus sp. scB241_527I9]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025890345.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025892538.1| cell division protein FtsH [Prochlorococcus sp. scB241_527N11]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025967396.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P3]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGLFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025900256.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQELL--NRSEVKVA  614



>ref|WP_006911156.1| cell division protein FtsH [Cyanobium sp. PCC 7001]
 gb|EDY39239.1| ATP-dependent metalloprotease FtsH [Cyanobium sp. PCC 7001]
Length=614

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA+ER++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  393  NDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+I+G+D VTTGASND  QV+RVARQ
Sbjct  453  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIIYGDDEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LVE AY RAT+
Sbjct  513  MVTRFGMSEKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSQLVEEAYRRATE  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++T +  +L +LA LL+EKETVD EE   L I
Sbjct  573  VLTNNRAVLDQLADLLVEKETVDAEELQELLI  604



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 177/220 (80%), Gaps = 0/220 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DALER++A PEKK AVVS+ K++LVAYHE GHALVGALMPEYD V+KISI+PRG AGGL
Sbjct  489  ADALERLVAGPEKKGAVVSESKRRLVAYHEGGHALVGALMPEYDAVSKISIVPRGNAGGL  548

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFFAPSEERLE+GLYSRSYLENQM+VALGGRVAEE+I G DNVTTGAS DF QV+RVAR 
Sbjct  549  TFFAPSEERLENGLYSRSYLENQMSVALGGRVAEELILGPDNVTTGASGDFQQVTRVARM  608

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MVE+ GFS  +GQ+A    GG  FLG QM+   + S  T D++D EV+ LV+RAY RA  
Sbjct  609  MVEQMGFSDSLGQVAWSQSGGGSFLGAQMAQPANCSGETQDIIDKEVKSLVDRAYRRAKD  668

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  93
            +I  +I +LH+ A++L+EKE +DGEE  +L ++ ++E ++
Sbjct  669  LIQNNISVLHRTAEILLEKEQMDGEELQALLLEAQSEQYL  708



>ref|WP_025980194.1| cell division protein FtsH [Prochlorococcus sp. scB243_498F21]
Length=617

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032517345.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRSVLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  614



>gb|KGF88464.1| cell division protein FtsH2 [Prochlorococcus marinus str. GP2]
Length=580

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  360  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  419

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  420  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  479

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT++
Sbjct  480  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKV  539

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            +T +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  540  LTDNRTVLDEMAQMLIERETIDTEDIQDLL  569



>ref|WP_025937982.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519A13]
Length=617

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQELL--NRSEVTVA  614



>ref|WP_025956453.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQM+VALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMSVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|AIQ94296.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=603

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  383  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  442

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  443  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  502

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  503  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  562

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  563  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  600



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+RLESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  452  TWFTPSEDRLESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   GN FLG+ ++ ++D+S  TA  +DAEVR LV++AY+RA Q
Sbjct  512  MVTRFGMSDKLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDAEVRGLVDQAYARAKQ  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA++L++KETVD EE   L 
Sbjct  572  VLTNNRHVLDQLAKMLVDKETVDSEELQHLL  602



>ref|WP_002806664.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|EEE40173.1| ATP-dependent metallopeptidase HflB subfamily protein [Prochlorococcus 
marinus str. MIT 9202]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_044106285.1| cell division protein FtsH [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17558.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=616

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA V+D EVR+LV  AY RA  
Sbjct  515  MVSRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAVIDEEVRQLVNNAYIRAKD  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL KLA++L+EKETVD EE  S+ 
Sbjct  575  VLVNNRHILDKLAEMLVEKETVDAEELQSIL  605



>ref|WP_025941250.1| cell division protein FtsH [Prochlorococcus sp. scB245a_518O7]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSQLVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025921388.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVTRVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LV++AY RA +
Sbjct  515  MVTRFGMSDRLGPVALGRQSGNVFLGRDIASDRDFSDETAAAIDEEVRNLVDQAYRRAKE  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL KLA +L+EKETVD EEF  L  +   ++
Sbjct  575  VLVGNRHILDKLADMLVEKETVDSEEFQDLLANNDVKM  612



>ref|WP_036973151.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=402

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGL
Sbjct  181  SDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGL  240

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  241  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  300

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+
Sbjct  301  MVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATK  360

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA LL+EKETVD ++   L I
Sbjct  361  VLIENRSVLDELADLLVEKETVDAQDLQELLI  392



>gb|KGG30054.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0703]
Length=397

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGL
Sbjct  176  SDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGL  235

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  236  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  295

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+
Sbjct  296  MVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATK  355

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA LL+EKETVD ++   L I
Sbjct  356  VLIENRSVLDELADLLVEKETVDAQDLQELLI  387



>ref|WP_011817719.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM69535.1| cell division protein FtsH2 [Prochlorococcus marinus str. AS9601]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025914082.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520K10]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025925903.1| cell division protein FtsH [Prochlorococcus sp. scB241_528J8]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_012007029.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABV49865.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9215]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025937318.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519O21]
Length=617

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025933036.1| cell division protein FtsH [Prochlorococcus sp. scB243_498A3]
Length=617

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025979191.1| cell division protein FtsH [Prochlorococcus sp. scB243_497E17]
Length=617

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_042849723.1| cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=617

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032523992.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            +T +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL  606



>ref|WP_025965256.1| cell division protein FtsH [Prochlorococcus sp. scB243_496M6]
Length=617

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDIAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025981174.1| cell division protein FtsH [Prochlorococcus sp. scB245a_521B10]
Length=617

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETINTEDIQDLL--NRSEVKVA  614



>ref|WP_025971407.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L16]
Length=598

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  378  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  437

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  438  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  497

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  498  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  557

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  558  LTDNRTVLDEMAQMLIERETINTEDIQDLL--NRSEVKVA  595



>ref|WP_025929709.1| cell division protein FtsH [Prochlorococcus sp. scB241_528O2]
Length=617

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDEEVSELVDMAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  IL ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTILDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_028953545.1| cell division protein FtsH [Synechococcus sp. CC9616]
Length=615

 Score =   295 bits (754),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ERI+  PEKK+AV+S+ KK+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGL
Sbjct  394  SDAIERIMVGPEKKDAVISERKKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+I+GED VTTGASND  QV++VARQ
Sbjct  454  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLQQVAQVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RATQ
Sbjct  514  MITRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVYDLVDVAYKRATQ  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA LL+EKETVD EE   L I
Sbjct  574  VLVDNRSVLDELADLLVEKETVDAEELQELLI  605



>ref|WP_025925013.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETINTEDIQDLL--NRSEVKVA  614



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+RLESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  452  TWFTPSEDRLESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   GN FLG+ ++ ++D+S  TA  +D+EVR LV++AY+RA Q
Sbjct  512  MVTRFGMSDKLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDSEVRGLVDQAYTRAKQ  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA +L++KETVD EE   L 
Sbjct  572  VLTNNRHVLDQLANMLVDKETVDSEELQQLL  602



>ref|WP_011862269.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABO16871.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9301]
Length=617

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+S++KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISEKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA Q
Sbjct  513  MVTRFGMSDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKQ  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LAQ+L+EKETVD EE   L 
Sbjct  573  VLTDNRHVLDQLAQMLVEKETVDAEELQELL  603



>ref|WP_011375794.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABB49290.1| membrane protease FtsH catalytic subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGG00943.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9311]
Length=617

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDIAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++ +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL  606



>ref|WP_032514590.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF89182.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF89938.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF95373.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9123]
Length=617

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ M++ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMTSSRDFSEDTAATIDEEVSELVDIAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++ +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  577  LSDNRTVLDEMAQMLIERETIDTEDIQDLL  606



>ref|WP_012593655.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACK64378.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 gb|ACU99241.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Length=616

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV++AY RA  
Sbjct  515  MVSRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRQLVDQAYKRAKD  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL KLAQ+L+EKETVD +E   +    + ++
Sbjct  575  VLVNNRHILDKLAQMLVEKETVDADELQEILTSNEVKM  612



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  576  VLVNNRTILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_010871638.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 ref|NP_440330.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 sp|P72991.1|FTSH3_SYNY3 RecName: Full=ATP-dependent zinc metalloprotease FtsH 3 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA17010.1| cell division protein; FtsH [Synechocystis sp. PCC 6803]
 dbj|BAK49182.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 dbj|BAL28181.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31351.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34520.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50723.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 gb|AGF50699.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
Length=616

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++AY RA Q
Sbjct  515  MVTRFGMSDRLGPVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKQ  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LA++L+EKETVD EE  +L  +  A+L
Sbjct  575  VLVENRGILDQLAEILVEKETVDSEELQTLLANNNAKL  612



>ref|WP_008275101.1| cell division protein FtsH [Cyanothece sp. CCY0110]
 gb|EAZ91781.1| cell division protein; FtsH [Cyanothece sp. CCY0110]
Length=617

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AYSRA  
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSNETASTIDNEVRQLVDTAYSRAKD  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++ ++  IL +LA +L+EKETVD +E   + 
Sbjct  576  VLESNRHILDRLADMLVEKETVDSDELQEIL  606



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  576  VLVNNRAILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  576  VLVNNRAILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  576  VLVNNRAILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV R+G S+K+G +A+G   GN FLG+ +  ++D+S  TA  +D EVR+LV+ AY RA Q
Sbjct  513  MVTRYGMSEKLGPVALGRQQGNMFLGRDIMAERDFSEETAAAIDEEVRKLVDAAYKRAKQ  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  IL +LAQLL+EKETVD EE   L 
Sbjct  573  VLTENRHILDQLAQLLMEKETVDAEELQELL  603



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  576  VLVNNRVILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_038542994.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
 gb|AII42342.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
Length=615

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ERI+  PEKK+AV+S+ KK+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGL
Sbjct  394  SDAIERIMVGPEKKDAVISERKKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+I+GED VTTGASND  QV++VARQ
Sbjct  454  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLQQVAQVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RAT+
Sbjct  514  MITRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVYDLVDVAYKRATK  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFID  114
            ++  +  +L +LA LL+EKETVD EE   L I+
Sbjct  574  VLVDNRLVLDELADLLVEKETVDAEELQELLIN  606



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  576  VLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +
Sbjct  513  MVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKK  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA++L+EKETVD EE   L 
Sbjct  573  VLTENRHVLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  576  VLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  576  VLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_025922823.1| cell division protein FtsH [Prochlorococcus sp. scB243_495D8]
Length=617

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 180/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+S +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISAKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTDNRIVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032527521.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF96190.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9302]
Length=617

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT++
Sbjct  517  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDEEVSDLVDIAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LSDNRTVLDEMAEMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  576  VLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   292 bits (747),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +
Sbjct  513  MVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKK  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA++L+EKETVD EE   L 
Sbjct  573  VLTENRHVLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_019478058.1| cell division protein FtsH [Prochlorococcus sp. W8]
Length=618

 Score =   292 bits (747),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  398  DAIERVMAGPEKKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLT  457

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  458  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  517

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT++
Sbjct  518  ITKFGMSDKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKV  577

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  578  LTDNRGMLDEMAEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score =   292 bits (747),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA +
Sbjct  513  MVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKK  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA++L+EKETVD EE   L 
Sbjct  573  VLTDNRHVLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_019477234.1| cell division protein FtsH [Prochlorococcus sp. W7]
Length=618

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  398  DAIERVMAGPEKKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLT  457

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  458  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  517

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT++
Sbjct  518  ITKFGMSDKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKV  577

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  578  LTENRGMLDEMAEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKE  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  576  VLVNNRVILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_036901462.1| cell division protein FtsH [Prochlorococcus sp. MIT 0601]
 gb|KGG13140.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0601]
Length=615

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 183/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLT
Sbjct  395  DAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLT  454

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQM
Sbjct  455  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLTQVAQVARQM  514

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            V RFG S+K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT++
Sbjct  515  VTRFGMSEKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDFAYKRATKV  574

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +  +  +L +LA++L+EKETVD E+  +L I  K+E+ +A
Sbjct  575  LIDNRKVLDELAEMLVEKETVDSEQLQNLLI--KSEVKIA  612



>ref|WP_036922150.1| cell division protein FtsH [Prochlorococcus marinus]
Length=618

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  398  DAIERVMAGPEKKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLT  457

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  458  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  517

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT++
Sbjct  518  ITKFGMSDKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKV  577

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  578  LTENRGMLDEMAEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S ++K+LVAYHEAGHALVGALMP+YDP+ KISIIPRG+AGGL
Sbjct  394  NDAIDRVLAGPEKKNRVMSQKRKELVAYHEAGHALVGALMPDYDPIQKISIIPRGRAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE++FGE+ VTTGASND  QV+RVARQ
Sbjct  454  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIVFGEEEVTTGASNDLQQVARVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S+++G +A+G   GN FLG+ +++ +D+S +TA ++D EV++LV+ AY RA  
Sbjct  514  MITRFGMSERLGPVALGRQNGNVFLGRDIASDRDFSDSTAAMIDEEVKKLVDVAYQRAKD  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  + ++L  LAQ+L+EKETVD EE   L  +   +L
Sbjct  574  VLQNNREVLDTLAQMLVEKETVDSEELQELLNNNDVKL  611



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  396  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  456  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY RA  
Sbjct  516  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSNETASTIDEEVRQLVDTAYKRAKD  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++ ++  IL +LA +L+EKETVD +E   + 
Sbjct  576  VLESNRHILDRLADMLVEKETVDSDELQEIL  606



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+E+GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFTPSEDRMETGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVRELVE AY RA +
Sbjct  511  MVTRFGMSDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAAIDDEVRELVEVAYRRAKE  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++ ++  IL +LAQ+LI+KETVD EE   L 
Sbjct  571  VLVSNRHILDQLAQMLIDKETVDAEELQELL  601



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   GN FLG+ + +++D+S  TA  +D EV +LV+ AY+RA Q
Sbjct  513  MVTRFGMSDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVHQLVDSAYARAKQ  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  IL +LA++L+EKETVD EE   L 
Sbjct  573  VLTDNRHILDQLAEMLVEKETVDAEELQELL  603



>ref|WP_015109466.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile]
 gb|AFY29018.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile PCC 6307]
Length=614

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA+ER++A PEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  393  NDAIERVMAGPEKKDRVMSERRKRLVAYHESGHALVGALMPDYDPVQKISIIPRGQAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQ
Sbjct  453  TFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV  AY RAT+
Sbjct  513  MVTRFGMSDRLGPVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSQLVADAYRRATE  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA+LL+EKETVD EE   L I
Sbjct  573  VLLANRAVLDELAELLVEKETVDAEELQELLI  604



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D E+R LV++AY RA +
Sbjct  515  MVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETASAIDEEIRNLVDQAYRRAKE  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL +LA++L++KETVD +E   L 
Sbjct  575  VLVENRSILDRLAEMLVDKETVDSDELQDLL  605



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  394  NDAIDRVLAGPEKKNRVMSQKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  454  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN F+G+ +++ +D+S +TA  +D EV++LV++AY RA Q
Sbjct  514  MITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDSTASAIDDEVKKLVDQAYQRAKQ  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  +L KLA +L+EKETVD +E   + 
Sbjct  574  VLVENRAVLDKLANMLVEKETVDADELQDIL  604



>ref|WP_028949001.1| cell division protein FtsH [Synechocystis sp. PCC 6714]
 gb|AIE73467.1| Cell division protein FtsH [Synechocystis sp. PCC 6714]
Length=616

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN ++S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRMMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++AY RA +
Sbjct  515  MVTRFGMSDRLGPVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKR  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LA++L+EKETVD EE  +L     A+L
Sbjct  575  VLVENRGILDQLAEMLVEKETVDSEELQTLLASNNAKL  612



>ref|WP_007100703.1| cell division protein FtsH [Synechococcus sp. RS9917]
 gb|EAQ68631.1| cell division protein [Synechococcus sp. RS9917]
Length=616

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  395  SDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  455  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV  AY RATQ
Sbjct  515  MVTRFGMSDKLGPVALGRAQGGMFLGRDIAAERDFSEDTAATIDEEVSDLVSVAYKRATQ  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++T +  +L +LA++L+++ETVD E+   L +
Sbjct  575  VLTQNRSVLDELAEMLVDQETVDAEDLQELLM  606



>ref|WP_019474071.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+S+ KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISERKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S+KIG +A+G   G  FLG+ +++++D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSEKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDVEVSELVDVAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTENRGMLDEMAQMLIERETIDTEDIQDLI--NRSEVKVA  614



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSEKRKVLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEERLESGLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+  ARQ
Sbjct  452  TWFTPSEERLESGLYSRSYLQNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVANTARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S  +G +A+G   GNPFLG+ +++++D+S  TA  +DAEVR LV++AY+R  Q
Sbjct  512  MVTRFGMSDILGPVALGRQQGNPFLGRDIASERDFSEKTAASIDAEVRALVDQAYARCKQ  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LA +L++KETVD EE  +L  +  A++
Sbjct  572  VLVENRHILDQLADMLVDKETVDSEELQTLLANSNAKM  609



>ref|WP_035832496.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
 gb|KEF41405.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
Length=614

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA+ER++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  393  NDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQ
Sbjct  453  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV  AY RAT 
Sbjct  513  MVTRFGMSDRLGPVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSALVAEAYRRATD  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA+LL+EKETVD EE   L I
Sbjct  573  VLVANRSVLDELAELLVEKETVDAEELQELLI  604



>ref|WP_019476442.1| cell division protein FtsH [Prochlorococcus sp. W4]
Length=617

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+S+ KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLT
Sbjct  397  DAIERVMAGPEKKDRVISERKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLT  456

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  457  FFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  516

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S+KIG +A+G   G  FLG+ +++++D+S  TA  +D EV ELV+ AY RAT++
Sbjct  517  ITKFGMSEKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDVEVSELVDIAYKRATKV  576

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  577  LTENRGMLDEMAQMLIERETIDTEDIQDLI--NRSEVKVA  614



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+ +G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q
Sbjct  513  MVTRFGMSETLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYKRAKQ  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA++L+EKETVD EE   L 
Sbjct  573  VLTDNRHVLDQLAEMLVEKETVDAEELQELL  603



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKRLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY+RA  
Sbjct  511  MITRFGMSDRLGPVALGRQNGNMFLGRDIASDRDFSNTTAATIDEEVRKLVDEAYNRAKD  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL KL+ +LIEKETVD EE   L  +   ++
Sbjct  571  VLVGNKHILDKLSAMLIEKETVDAEELQELLAENDVKM  608



>ref|WP_011819579.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM71467.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9515]
Length=619

 Score =   290 bits (741),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 178/220 (81%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD+KK+LVAYHEAGHALVGA MP+YD VAK+SIIPRGQAGGLT
Sbjct  399  DAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGACMPDYDAVAKVSIIPRGQAGGLT  458

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  459  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  518

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  519  ITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKV  578

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            +T +  +L ++A +LIE+ET+D E+   L    ++E+ VA
Sbjct  579  LTDNRSVLDEMAMMLIERETIDTEDIQDLL--NRSEVKVA  616



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score =   290 bits (741),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR+LV++AYSRA  
Sbjct  515  MVTRFGMSDRLGPVALGRQQGNVFLGREIASDRDFSDETAAAIDEEVRKLVDQAYSRAKD  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            +++++  IL  LA +L+EKETVD EE  ++ 
Sbjct  575  VLSSNRHILDALADMLVEKETVDAEELQNIL  605



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+SD +KKLVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSDRRKKLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F P+E++++SGLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQ
Sbjct  451  TWFTPNEDQMDSGLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +
Sbjct  511  MVTRFGMSDRLGPVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKE  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  +L ++AQ+LIEKET+D EE  S+ 
Sbjct  571  VLVNNRHVLDQIAQVLIEKETIDAEELQSIL  601



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGL
Sbjct  394  SDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  454  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+
Sbjct  514  MVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATK  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA LL+EKETVD ++   L I
Sbjct  574  VLIENRSVLDELADLLVEKETVDAQDLQDLLI  605



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKSRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +
Sbjct  515  MVTRFGMSDRLGPVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKE  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL KLA +LIEKETVD EE   + 
Sbjct  575  VLVNNRHILDKLADMLIEKETVDAEELQDVL  605



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+SD +KKLVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSDRRKKLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F P+E++++SGLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQ
Sbjct  451  TWFTPNEDQMDSGLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +
Sbjct  511  MVTRFGMSDRLGPVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKE  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  +L ++AQ+LIEKET+D EE  S+ 
Sbjct  571  VLVNNRHVLDQIAQVLIEKETIDAEELQSIL  601



>ref|WP_011936606.1| cell division protein FtsH [Synechococcus sp. RCC307]
 emb|CAK29096.1| Cell division protein FtsH [Synechococcus sp. RCC307]
Length=618

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA+ER++A PEKK+ V+S+++K+LVAYHE+GHALVGALMP+YDPV KISIIPRGQAGGL
Sbjct  397  NDAIERVMAGPEKKDRVMSEKRKRLVAYHESGHALVGALMPDYDPVQKISIIPRGQAGGL  456

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQ
Sbjct  457  TFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEELVYGEDEVTTGASNDLQQVARVARQ  516

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV+ AY+RA Q
Sbjct  517  MVTRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDKEVSSLVDAAYTRAVQ  576

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            +++ +  +L +LA++L+E ETVD E+   L I   A++
Sbjct  577  VLSDNRALLDELAEMLVEMETVDAEQLQELLISRDAKV  614



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGL
Sbjct  394  SDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  454  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+
Sbjct  514  MVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATK  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA LL+EKETVD ++   L I
Sbjct  574  VLIENRSVLDELADLLVEKETVDAQDLQELLI  605



>ref|WP_009556886.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68121.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
Length=624

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  403  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  462

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQ
Sbjct  463  TWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEELVFGEEEVTTGASNDLQQVARVARQ  522

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR LV++AY RA  
Sbjct  523  MVTRFGMSDRLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVRNLVDQAYRRAKA  582

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L KLAQ+L+EKETVD EE   L 
Sbjct  583  VLTQNRAVLDKLAQMLVEKETVDAEELQDLL  613



>ref|WP_006042287.1| cell division protein FtsH [Synechococcus sp. WH 7805]
 gb|EAR19163.1| cell division protein FtsH2 [Synechococcus sp. WH 7805]
Length=616

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGL
Sbjct  395  SDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  455  TFFTPSEERMESGLYSRTYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RAT+
Sbjct  515  MVTRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSDLVDVAYKRATK  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++ ++  +L ++A++L+E+ETVD EE   L I
Sbjct  575  VLVSNRSVLDEIAEMLVEQETVDAEELQELLI  606



>ref|WP_011932280.1| cell division protein FtsH [Synechococcus sp. WH 7803]
 emb|CAK22781.1| Cell division protein FtsH [Synechococcus sp. WH 7803]
Length=617

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGL
Sbjct  396  SDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGL  455

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  456  TFFTPSEERMESGLYSRTYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  515

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV ELV+ AY RAT+
Sbjct  516  MVTRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSELVDVAYKRATK  575

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA++L+E+ETVD E+   L I
Sbjct  576  VLVGNRSVLDELAEMLVEQETVDAEQLQELLI  607



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSERRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  452  TWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA  
Sbjct  512  MVTRFGMSDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYARAKT  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  +L +LA +L+EKETVD EE   L 
Sbjct  572  VLTDNRHVLDQLADMLVEKETVDAEELQELL  602



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+ VARQ
Sbjct  455  TWFTPSEDRMDSGLYSRAYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVANVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE AY RA  
Sbjct  515  MITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDETAAVIDEEVRGLVEEAYKRAKD  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L KLA +L+EKETVD EE  +L ++   ++
Sbjct  575  VLVGNRSVLDKLAAMLVEKETVDAEELQTLLMESDVQM  612



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSERRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEERLESGLYSR+YL+NQMAVALGGR+AEE+++G + VTTGASND  QV+RVARQ
Sbjct  452  TWFTPSEERLESGLYSRAYLQNQMAVALGGRIAEEIVYGNEEVTTGASNDLQQVARVARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA ++DAEVR LV++AY RA Q
Sbjct  512  MITRFGMSGELGPVALGRQQGNMFLGRDITAERDFSEETAAIIDAEVRSLVDQAYDRAKQ  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL KLA +L+EKETVD EE   L 
Sbjct  572  VLVENRAILDKLAGMLVEKETVDSEELQELL  602



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+++GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFTPSEDRMDTGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  
Sbjct  511  MITRFGMSDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKS  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  IL +LAQ+L+EKETVD +E   L 
Sbjct  571  VLTNNRAILDRLAQMLVEKETVDADELQELL  601



>ref|WP_019506377.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=616

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVMAGPEKKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+I+GE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRLAEEIIYGEEEVTTGASNDLQQVTRVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN F+G+ +++ +D+S  TA  +D EVR  V++AYSRA +
Sbjct  515  MVTRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSNETAAAIDEEVRNYVDQAYSRAKK  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  + +IL +LA++LIEKETV+ +E   +  +   ++
Sbjct  575  VLLDNRNILDRLAEMLIEKETVEADELQDILANNDVKM  612



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q
Sbjct  511  MITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQ  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  571  VLVENRHVLNQLANILIDKETVDADELQELLANNEVKM  608



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+++GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFTPSEDRMDTGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  
Sbjct  511  MITRFGMSDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKS  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++T +  IL +LAQ+L+EKETVD +E   L 
Sbjct  571  VLTDNRAILDRLAQMLVEKETVDADELQELL  601



>ref|WP_015224048.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 gb|AFZ48735.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=615

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  394  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQ
Sbjct  454  TWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGQEEVTTGASNDLQQVARVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN F+G+ +++ +D+S  TA  +D EV +LVERAY RA  
Sbjct  514  MITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDTTAATIDEEVSQLVERAYQRAKD  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL KLA++L+EKETV+ +E   + 
Sbjct  574  VLVQNRPILDKLAEMLVEKETVEADELQEIL  604



>ref|WP_011131865.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE18685.1| cell division protein FtsH2 [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 gb|KGF86466.1| Cell division protein FtsH [Prochlorococcus marinus str. EQPAC1]
Length=618

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 176/220 (80%), Gaps = 2/220 (1%)
 Frame = -3

Query  749  DALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLT  570
            DA+ER++A PEKK+ V+SD KK+LVAYHEAGHALVGA MP+YD VAK+SIIPRGQAGGLT
Sbjct  398  DAIERVMAGPEKKDRVISDRKKELVAYHEAGHALVGACMPDYDAVAKVSIIPRGQAGGLT  457

Query  569  FFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQM  390
            FF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM
Sbjct  458  FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQM  517

Query  389  VERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  210
            + +FG S KIG +A+G   G  FLG+ MS  +D+S  TA  +D EV ELV+ AY RAT++
Sbjct  518  ITKFGMSDKIGPVALGQSQGGMFLGRDMSATRDFSEDTAATIDVEVSELVDTAYKRATKV  577

Query  209  ITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  90
            ++ +  +L ++A +LIE+ET+D E+   L    ++E+ VA
Sbjct  578  LSDNRSVLDEMASMLIERETIDTEDIQDLL--NRSEVKVA  615



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q
Sbjct  511  MITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQ  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  571  VLVENRHVLNQLANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_026097926.1| cell division protein FtsH [Geitlerinema sp. PCC 7105]
Length=614

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGAAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER++SGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEERMDSGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+++G +A+G   GN FLG+ ++ ++D+S  TA  +D EV +LV+ AY+RA Q
Sbjct  513  MVTRFGMSERLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDEEVSKLVDEAYTRAKQ  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            +++ +  +L +L+++L+EKETVD EE   L  +   ++
Sbjct  573  VLSENRSVLDRLSEMLVEKETVDAEELQDLLANSDVKM  610



>ref|WP_011124410.1| cell division protein FtsH [Prochlorococcus marinus]
 ref|NP_874649.1| Cell division protein FtsH [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|AAP99301.1| Cell division protein FtsH [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|KGG11427.1| Cell division protein FtsH [Prochlorococcus marinus str. LG]
 gb|KGG18617.1| Cell division protein FtsH [Prochlorococcus marinus str. SS2]
 gb|KGG22890.1| Cell division protein FtsH [Prochlorococcus marinus str. SS35]
 gb|KGG32766.1| Cell division protein FtsH [Prochlorococcus marinus str. SS51]
 gb|KGG37052.1| Cell division protein FtsH [Prochlorococcus sp. SS52]
Length=599

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+++K+LVAYHEAGHALVGA+MP+YDPV KISIIPRGQAGGL
Sbjct  378  SDAIERVMAGPEKKDRVMSNKRKELVAYHEAGHALVGAVMPDYDPVQKISIIPRGQAGGL  437

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  438  TFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQ  497

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV+ AY RAT+
Sbjct  498  MVTRFGMSEKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDDEVSCLVDIAYKRATK  557

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
             +  +  +L +LA++LIEKETVD E+   L I  K ++
Sbjct  558  ALLENRSVLDELAEMLIEKETVDSEDLQQLLIKRKVKV  595



>ref|WP_043694696.1| cell division protein FtsH [Synechococcus sp. KORDI-49]
 gb|AII46861.1| cell division protein FtsH [Synechococcus sp. KORDI-49]
Length=615

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ERI+  PEKK+AV+S+ KK LVAYHEAGHA+VGALMP+YDPV KISIIPRG AGGL
Sbjct  394  SDAIERIMVGPEKKDAVISERKKWLVAYHEAGHAIVGALMPDYDPVQKISIIPRGNAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV+  ARQ
Sbjct  454  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVASTARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RAT+
Sbjct  514  MITRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVSDLVDVAYKRATK  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA+LL+E+ETVD EE   L I
Sbjct  574  VLVDNRPVLDELAELLVEQETVDAEELQELLI  605



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q
Sbjct  511  MITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQ  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  571  VLVENRHVLNQLADVLIDKETVDADELQELLANNEVKM  608



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q
Sbjct  511  MITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQ  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  571  VLVENRHVLNQLADVLIDKETVDADELQELLANNEVKM  608



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  393  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  452

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+++GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  453  TWFTPSEDRMDTGLYSRAYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQ  512

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LVE AY RA +
Sbjct  513  MVTRFGMSDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVETAYRRAKE  572

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL KLA++L+EKETVD EE   + 
Sbjct  573  VLENNRHILDKLAEMLVEKETVDAEELQDVL  603



>ref|WP_036892144.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=616

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++A PEKK+ V+S+++K+LVAYHEAGHALVGA+MP+YDPV KISIIPRGQAGGL
Sbjct  395  SDAIERVMAGPEKKDRVMSNKRKELVAYHEAGHALVGAVMPDYDPVQKISIIPRGQAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  455  TFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV+ AY RAT+
Sbjct  515  MVTRFGMSEKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDDEVSCLVDIAYKRATK  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
             +  +  +L +LA++LIEKETVD E+   L I  K ++
Sbjct  575  ALLENRSVLDELAEMLIEKETVDSEDLQQLLIKRKVKV  612



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKSRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+ESGL+SRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  455  TWFTPSEDRMESGLFSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +
Sbjct  515  MVTRFGMSDRLGPVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKE  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL +LA +LIEKETVD EE   +  +   ++
Sbjct  575  VLMNNRPILDQLASMLIEKETVDAEELQDILANNDVKM  612



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  397  NDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  456

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER++SGLYSR+YL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  457  TWFTPSEERMDSGLYSRAYLQNQMAVALGGRVAEELIFGEEEVTTGASNDLQQVARVARQ  516

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN F+G+ +++ +D+S  TA  +D EVR+LV++AY R  +
Sbjct  517  MVTRFGMSDRLGPVALGRQNGNMFMGRDIASDRDFSDETASAIDEEVRKLVDQAYERTVE  576

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL KLA++L+E ETVD EE  +L  +   ++
Sbjct  577  VLKGNRQILDKLAEMLVEAETVDSEELQNLLAESDVKM  614



>emb|CCH67048.1| Cell division protein FtsH [Richelia intracellularis HH01]
Length=465

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+ +K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  244  NDAIDRVLAGPEKKDRVMSERRKLLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  303

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F P+E+R++SGLYSRSYLENQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQ
Sbjct  304  TWFTPNEDRMDSGLYSRSYLENQMAVALGGRLAEEIIFGDEEVTTGASNDLQQVARVARQ  363

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q
Sbjct  364  MVTRFGMSDRLGPVALGRQQGNMFLGRDIMSERDFSEETAATIDEEVRQLVDAAYIRAKQ  423

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL++LA +L+EKETVD EE   + 
Sbjct  424  VLEENRHILNQLADILVEKETVDAEELQDIL  454



>ref|WP_011243527.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 dbj|BAD79405.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56329.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD56622.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=613

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSEKRKVLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER+ESGLYSR+YL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQ
Sbjct  452  TWFTPSEERMESGLYSRTYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR+LV+ AY RA +
Sbjct  512  MVTRFGMSDRLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDDEVRQLVDVAYDRAKK  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLF  120
            ++  +  IL +LA++L+EKETVD EE   L 
Sbjct  572  VLIENRSILDQLAKMLVEKETVDAEELQDLL  602



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            SDA+ER++  PEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGL
Sbjct  394  SDAIERVMVGPEKKDRVMSERRKRLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGL  453

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            TFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQ
Sbjct  454  TFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQ  513

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+
Sbjct  514  MVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATK  573

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFI  117
            ++  +  +L +LA LL+EKET+D ++   L I
Sbjct  574  VLIENRSVLDELADLLVEKETLDAQDLQELLI  605



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  452  TWFTPSEDRMDSGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S+++G +A+G   GN FLG+ +  ++D+S  TA V+D EV  LVE+AY RA +
Sbjct  512  MVMRFGMSERLGPVALGRQQGNMFLGRDIMAERDFSEETASVIDEEVSTLVEQAYRRAKE  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++ ++  +L  LA +L+EKETVD EE   L  +   ++
Sbjct  572  VLVSNRHVLDTLADMLVEKETVDSEELQDLLANSDVKM  609



>ref|WP_015143924.1| ATP-dependent metalloprotease FtsH [Pleurocapsa minor]
 gb|AFY77621.1| ATP-dependent metalloprotease FtsH [Pleurocapsa sp. PCC 7327]
Length=618

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  397  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  456

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER+E+GLYSR+YL+NQMAVALGGR+AEE++FGE+ VTTGA+ND  QV+RVARQ
Sbjct  457  TWFTPSEERMEAGLYSRAYLQNQMAVALGGRIAEEIVFGEEEVTTGAANDLQQVARVARQ  516

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   G  FLG+ +++ +D+S  TA  +D EVR LVE+AY RA  
Sbjct  517  MITRFGMSDRLGPVALGRQNGGVFLGRDIASDRDFSDETAATIDEEVRLLVEQAYRRAKD  576

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L +LAQ+L+EKETVD EE  +L  +   ++
Sbjct  577  VLVNNRHVLDQLAQILVEKETVDAEELQALLANNDVKM  614



>ref|WP_024546675.1| cell division protein FtsH [Synechococcus sp. NKBG15041c]
Length=620

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  395  NDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  454

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R++SGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+ VARQ
Sbjct  455  TWFTPSEDRMDSGLYSRAYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVANVARQ  514

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ RFG S ++G +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE AY RA  
Sbjct  515  MITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDETAAVIDEEVRGLVEEAYKRAKD  574

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L KLA +L+EKETVD EE  ++ ++   ++
Sbjct  575  VLVNNRAVLDKLAAMLVEKETVDAEELQTVLMENDVKM  612



>ref|WP_015204207.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 gb|AFZ14101.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=613

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 175/218 (80%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGL
Sbjct  392  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGL  451

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+RL+SGLYSRSYL+NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQ
Sbjct  452  TWFTPSEDRLDSGLYSRSYLQNQMAVALGGRIAEEIIFGDEEVTTGASNDLQQVARVARQ  511

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EV  LVE+AY RA +
Sbjct  512  MVMRFGMSDRLGPVALGRQQGNMFLGRDINAERDFSDETAATIDDEVHNLVEQAYKRAKE  571

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L KLA +LIEKETVD EE   L  +   ++
Sbjct  572  VLVNNKHVLDKLAVMLIEKETVDSEELQELLANNDVKM  609



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVG+LMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGSLMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            M+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q
Sbjct  511  MITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQ  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  571  VLVENRHVLNQLANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score =   286 bits (733),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 176/218 (81%), Gaps = 0/218 (0%)
 Frame = -3

Query  752  SDALERIIAXPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGL  573
            +DA++R++A PEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGL
Sbjct  391  NDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGL  450

Query  572  TFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQ  393
            T+F PSE+R+++GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQ
Sbjct  451  TWFTPSEDRMDTGLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQ  510

Query  392  MVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQ  213
            MV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV+ AY RA  
Sbjct  511  MVTRFGMSDRLGPVALGRQNGNMFLGREIASDRDFSDTTAATIDEEVRRLVDEAYERAKN  570

Query  212  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  99
            ++  +  IL KLA +LIEKETVD +E   L  +   ++
Sbjct  571  VLLGNKHILDKLAGMLIEKETVDSDELQELLANNDVKI  608



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050