BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005M03

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009358713.1|  PREDICTED: mediator of RNA polymerase II tra...    273   4e-89   Pyrus x bretschneideri [bai li]
ref|XP_009359543.1|  PREDICTED: mediator of RNA polymerase II tra...    273   6e-89   Pyrus x bretschneideri [bai li]
ref|XP_008346652.1|  PREDICTED: mediator of RNA polymerase II tra...    271   2e-88   
ref|XP_006439221.1|  hypothetical protein CICLE_v10022441mg             271   2e-88   Citrus clementina [clementine]
ref|XP_008390269.1|  PREDICTED: mediator of RNA polymerase II tra...    271   2e-88   Malus domestica [apple tree]
ref|XP_009608618.1|  PREDICTED: mediator of RNA polymerase II tra...    271   3e-88   Nicotiana tomentosiformis
gb|KHG13856.1|  Mediator of RNA polymerase II transcription subun...    270   4e-88   Gossypium arboreum [tree cotton]
ref|XP_002527873.1|  nut2, putative                                     270   6e-88   
ref|XP_002280081.1|  PREDICTED: mediator of RNA polymerase II tra...    270   8e-88   Vitis vinifera
gb|KJB51996.1|  hypothetical protein B456_008G258800                    270   1e-87   Gossypium raimondii
ref|XP_006476288.1|  PREDICTED: mediator of RNA polymerase II tra...    269   2e-87   Citrus sinensis [apfelsine]
ref|XP_007039389.1|  Mediator complex, subunit Med10 isoform 1          268   2e-87   
ref|XP_002299427.1|  RNA polymerase II mediator complex family pr...    268   4e-87   Populus trichocarpa [western balsam poplar]
ref|XP_011022410.1|  PREDICTED: mediator of RNA polymerase II tra...    267   6e-87   Populus euphratica
ref|XP_004245099.1|  PREDICTED: mediator of RNA polymerase II tra...    267   9e-87   Solanum lycopersicum
emb|CBI34587.3|  unnamed protein product                                270   1e-86   Vitis vinifera
ref|XP_006360992.1|  PREDICTED: mediator of RNA polymerase II tra...    267   1e-86   Solanum tuberosum [potatoes]
ref|XP_011026786.1|  PREDICTED: mediator of RNA polymerase II tra...    267   1e-86   Populus euphratica
ref|XP_011462613.1|  PREDICTED: mediator of RNA polymerase II tra...    266   2e-86   Fragaria vesca subsp. vesca
ref|XP_004296727.1|  PREDICTED: mediator of RNA polymerase II tra...    266   2e-86   Fragaria vesca subsp. vesca
ref|XP_009787277.1|  PREDICTED: mediator of RNA polymerase II tra...    265   8e-86   Nicotiana sylvestris
gb|KDP24502.1|  hypothetical protein JCGZ_25066                         264   9e-86   Jatropha curcas
ref|XP_010533544.1|  PREDICTED: mediator of RNA polymerase II tra...    264   1e-85   Tarenaya hassleriana [spider flower]
ref|XP_008234780.1|  PREDICTED: mediator of RNA polymerase II tra...    264   2e-85   Prunus mume [ume]
ref|XP_007218477.1|  hypothetical protein PRUPE_ppa012016mg             264   2e-85   Prunus persica
ref|XP_009608619.1|  PREDICTED: mediator of RNA polymerase II tra...    263   2e-85   Nicotiana tomentosiformis
emb|CDP12227.1|  unnamed protein product                                262   4e-85   Coffea canephora [robusta coffee]
ref|XP_002303692.1|  RNA polymerase II mediator complex family pr...    262   5e-85   Populus trichocarpa [western balsam poplar]
gb|EYU33473.1|  hypothetical protein MIMGU_mgv1a013913mg                263   5e-85   Erythranthe guttata [common monkey flower]
gb|EPS62420.1|  hypothetical protein M569_12371                         262   7e-85   Genlisea aurea
ref|XP_010251657.1|  PREDICTED: mediator of RNA polymerase II tra...    262   8e-85   Nelumbo nucifera [Indian lotus]
ref|XP_009608620.1|  PREDICTED: mediator of RNA polymerase II tra...    262   1e-84   Nicotiana tomentosiformis
ref|XP_008448559.1|  PREDICTED: mediator of RNA polymerase II tra...    261   1e-84   Cucumis melo [Oriental melon]
ref|XP_004146135.1|  PREDICTED: mediator of RNA polymerase II tra...    261   2e-84   Cucumis sativus [cucumbers]
ref|NP_001150529.1|  mediator complex subunit 10 CG5057-PA              260   3e-84   Zea mays [maize]
ref|XP_002460557.1|  hypothetical protein SORBIDRAFT_02g030650          259   9e-84   Sorghum bicolor [broomcorn]
ref|XP_007209640.1|  hypothetical protein PRUPE_ppa011942mg             258   2e-83   Prunus persica
ref|XP_004957432.1|  PREDICTED: mediator of RNA polymerase II tra...    258   3e-83   Setaria italica
gb|KGN55669.1|  Nut2                                                    259   6e-83   Cucumis sativus [cucumbers]
ref|XP_010931382.1|  PREDICTED: mediator of RNA polymerase II tra...    258   6e-83   Elaeis guineensis
ref|XP_008239229.1|  PREDICTED: mediator of RNA polymerase II tra...    257   9e-83   Prunus mume [ume]
emb|CDM85480.1|  unnamed protein product                                257   1e-82   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006415945.1|  hypothetical protein EUTSA_v10008848mg             257   1e-82   Eutrema salsugineum [saltwater cress]
ref|XP_010676908.1|  PREDICTED: mediator of RNA polymerase II tra...    256   2e-82   Beta vulgaris subsp. vulgaris [field beet]
emb|CDM85486.1|  unnamed protein product                                256   2e-82   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009398711.1|  PREDICTED: mediator of RNA polymerase II tra...    256   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660876.1|  PREDICTED: mediator of RNA polymerase II tra...    255   5e-82   Oryza brachyantha
ref|XP_010089858.1|  Mediator of RNA polymerase II transcription ...    254   3e-81   
ref|XP_004488501.1|  PREDICTED: mediator of RNA polymerase II tra...    253   3e-81   Cicer arietinum [garbanzo]
tpg|DAA62423.1|  TPA: mediator complex subunit 10 CG5057-PA isofo...    252   5e-81   
ref|XP_004504338.1|  PREDICTED: mediator of RNA polymerase II tra...    251   1e-80   Cicer arietinum [garbanzo]
ref|NP_001150327.1|  mediator complex subunit 10 CG5057-PA              250   3e-80   Zea mays [maize]
ref|XP_009103104.1|  PREDICTED: mediator of RNA polymerase II tra...    250   4e-80   Brassica rapa
gb|EMS63705.1|  Mediator of RNA polymerase II transcription subun...    249   6e-80   Triticum urartu
ref|NP_001063737.1|  Os09g0528300                                       249   9e-80   
gb|KCW82860.1|  hypothetical protein EUGRSUZ_C04229                     248   2e-79   Eucalyptus grandis [rose gum]
ref|XP_010050022.1|  PREDICTED: mediator of RNA polymerase II tra...    248   2e-79   Eucalyptus grandis [rose gum]
ref|XP_008788520.1|  PREDICTED: mediator of RNA polymerase II tra...    249   2e-79   Phoenix dactylifera
dbj|BAK04300.1|  predicted protein                                      248   2e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011070384.1|  PREDICTED: mediator of RNA polymerase II tra...    248   4e-79   Sesamum indicum [beniseed]
ref|NP_564254.1|  Mediator complex, subunit Med10                       247   7e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788119.1|  PREDICTED: mediator of RNA polymerase II tra...    247   1e-78   Phoenix dactylifera
emb|CDY20567.1|  BnaC07g12340D                                          248   2e-78   Brassica napus [oilseed rape]
ref|NP_973916.1|  Mediator complex, subunit Med10                       243   3e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KJB51998.1|  hypothetical protein B456_008G258800                    241   5e-77   Gossypium raimondii
ref|NP_001241316.1|  uncharacterized protein LOC100806084               242   7e-77   Glycine max [soybeans]
gb|EMT06746.1|  Mediator of RNA polymerase II transcription subun...    243   1e-76   
ref|XP_007039391.1|  Mediator complex, subunit Med10 isoform 3          241   1e-76   
ref|XP_010922762.1|  PREDICTED: mediator of RNA polymerase II tra...    241   2e-76   Elaeis guineensis
ref|XP_006586008.1|  PREDICTED: mediator of RNA polymerase II tra...    239   3e-76   Glycine max [soybeans]
ref|XP_007153845.1|  hypothetical protein PHAVU_003G069600g             240   4e-76   Phaseolus vulgaris [French bean]
ref|XP_010499011.1|  PREDICTED: mediator of RNA polymerase II tra...    240   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006586003.1|  PREDICTED: mediator of RNA polymerase II tra...    240   4e-76   Glycine max [soybeans]
emb|CDY40258.1|  BnaA07g09420D                                          249   2e-75   Brassica napus [oilseed rape]
ref|XP_006849160.1|  hypothetical protein AMTR_s00027p00143800          237   3e-75   Amborella trichopoda
ref|XP_007039392.1|  Mediator complex, subunit Med10 isoform 4          236   6e-75   
ref|XP_002868569.1|  hypothetical protein ARALYDRAFT_493793             235   2e-74   
ref|XP_007039390.1|  Mediator complex, subunit Med10 isoform 2          235   2e-74   
gb|AGV54170.1|  mediator of RNA polymerase II transcription subunit     235   3e-74   Phaseolus vulgaris [French bean]
gb|KDP25204.1|  hypothetical protein JCGZ_20360                         234   4e-74   Jatropha curcas
gb|KDO76724.1|  hypothetical protein CISIN_1g028220mg                   234   2e-73   Citrus sinensis [apfelsine]
ref|NP_199006.1|  Mediator complex, subunit Med10                       232   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010238414.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    231   9e-73   Brachypodium distachyon [annual false brome]
dbj|BAJ94367.1|  predicted protein                                      231   1e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004170927.1|  PREDICTED: mediator of RNA polymerase II tra...    230   2e-72   
ref|XP_011022415.1|  PREDICTED: mediator of RNA polymerase II tra...    229   4e-72   Populus euphratica
gb|AFK42425.1|  unknown                                                 229   1e-71   Lotus japonicus
ref|XP_003629699.1|  Mediator of RNA polymerase II transcription ...    224   1e-70   
ref|XP_003629698.1|  Mediator of RNA polymerase II transcription ...    224   3e-70   Medicago truncatula
gb|AFK33660.1|  unknown                                                 223   1e-69   Medicago truncatula
ref|XP_004504337.1|  PREDICTED: mediator of RNA polymerase II tra...    220   3e-68   
ref|XP_010477833.1|  PREDICTED: mediator of RNA polymerase II tra...    215   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002893389.1|  T24P13.4                                           216   3e-65   
gb|AAF87025.1|AC006535_3  T24P13.4                                      215   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305653.1|  hypothetical protein CARUB_v10010356mg             209   6e-64   Capsella rubella
ref|XP_009115391.1|  PREDICTED: mediator of RNA polymerase II tra...    196   5e-59   Brassica rapa
gb|EMT18148.1|  Mediator of RNA polymerase II transcription subun...    191   2e-57   
ref|XP_009766948.1|  PREDICTED: mediator of RNA polymerase II tra...    192   2e-57   Nicotiana sylvestris
emb|CDY16179.1|  BnaA09g29130D                                          191   3e-57   Brassica napus [oilseed rape]
gb|KDO76725.1|  hypothetical protein CISIN_1g028220mg                   186   8e-56   Citrus sinensis [apfelsine]
ref|XP_008788120.1|  PREDICTED: mediator of RNA polymerase II tra...    187   1e-55   
emb|CAN83497.1|  hypothetical protein VITISV_026967                     185   1e-54   Vitis vinifera
tpg|DAA40596.1|  TPA: hypothetical protein ZEAMMB73_822884              181   2e-54   
ref|XP_009606753.1|  PREDICTED: mediator of RNA polymerase II tra...    183   3e-54   Nicotiana tomentosiformis
gb|EMS49589.1|  Mediator of RNA polymerase II transcription subun...    171   1e-49   Triticum urartu
ref|XP_010460282.1|  PREDICTED: mediator of RNA polymerase II tra...    168   2e-49   
emb|CDX85042.1|  BnaC05g20130D                                          170   3e-49   
gb|ABK23782.1|  unknown                                                 169   8e-49   Picea sitchensis
ref|XP_006367261.1|  PREDICTED: mediator of RNA polymerase II tra...    162   1e-46   Solanum tuberosum [potatoes]
ref|XP_006380132.1|  hypothetical protein POPTR_0008s22200g             162   2e-46   
ref|XP_006367259.1|  PREDICTED: mediator of RNA polymerase II tra...    160   4e-46   Solanum tuberosum [potatoes]
tpg|DAA40595.1|  TPA: hypothetical protein ZEAMMB73_822884              159   1e-45   
ref|XP_001765923.1|  predicted protein                                  159   5e-45   
gb|AGV54175.1|  mediator of RNA polymerase II transcription subunit     149   2e-40   Phaseolus vulgaris [French bean]
gb|EAZ03627.1|  hypothetical protein OsI_25763                          146   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_004493708.1|  PREDICTED: mediator of RNA polymerase II tra...    131   9e-35   
ref|XP_002986650.1|  hypothetical protein SELMODRAFT_235078             131   3e-34   
ref|XP_006387573.1|  hypothetical protein POPTR_0829s00210g             122   2e-31   
gb|KJB51999.1|  hypothetical protein B456_008G258800                    120   1e-30   Gossypium raimondii
tpg|DAA40593.1|  TPA: hypothetical protein ZEAMMB73_822884            96.3    2e-21   
gb|EFX81997.1|  hypothetical protein DAPPUDRAFT_302806                90.9    3e-19   Daphnia pulex
ref|XP_794222.1|  PREDICTED: mediator of RNA polymerase II transc...  89.4    1e-18   Strongylocentrotus purpuratus [purple urchin]
ref|XP_005102641.1|  PREDICTED: mediator of RNA polymerase II tra...  88.6    2e-18   Aplysia californica
gb|EHJ63693.1|  putative mediator complex, subunit                    87.8    4e-18   
ref|XP_004932922.1|  PREDICTED: mediator of RNA polymerase II tra...  87.4    5e-18   
ref|XP_004932921.1|  PREDICTED: mediator of RNA polymerase II tra...  87.0    7e-18   Bombyx mori [silk moth]
gb|ENN74363.1|  hypothetical protein YQE_09044                        86.7    1e-17   Dendroctonus ponderosae
ref|XP_001845336.1|  RNA polymerase II mediator complex subunit 10    86.3    2e-17   Culex quinquefasciatus
ref|XP_001648875.1|  AAEL014501-PA                                    86.3    2e-17   Aedes aegypti
ref|XP_011412649.1|  PREDICTED: mediator of RNA polymerase II tra...  86.3    2e-17   
ref|XP_316314.2|  AGAP006248-PA                                       85.1    4e-17   Anopheles gambiae str. PEST
ref|XP_005681589.1|  PREDICTED: mediator of RNA polymerase II tra...  85.1    5e-17   
gb|ETN67202.1|  RNA polymerase II mediator complex subunit 10         84.7    6e-17   Anopheles darlingi [American malaria mosquito]
ref|XP_002424879.1|  nut2, putative                                   84.3    1e-16   Pediculus humanus corporis [human body lice]
ref|XP_002594058.1|  hypothetical protein BRAFLDRAFT_118806           83.6    2e-16   Branchiostoma floridae
ref|XP_969834.1|  PREDICTED: mediator of RNA polymerase II transc...  83.2    2e-16   Tribolium castaneum [rust-red flour beetle]
ref|XP_007898728.1|  PREDICTED: mediator of RNA polymerase II tra...  82.8    2e-16   Callorhinchus milii [Australian ghost shark]
gb|ENN74364.1|  hypothetical protein YQE_09045                        82.8    3e-16   Dendroctonus ponderosae
ref|XP_004512812.1|  PREDICTED: uncharacterized protein LOC101488839  82.4    3e-16   
ref|XP_003462300.1|  PREDICTED: mediator of RNA polymerase II tra...  82.4    4e-16   Cavia porcellus [guinea pig]
gb|ENN78401.1|  hypothetical protein YQE_05201                        82.4    4e-16   Dendroctonus ponderosae
ref|XP_005645629.1|  hypothetical protein COCSUDRAFT_8935             80.9    6e-16   Coccomyxa subellipsoidea C-169
ref|XP_007520627.1|  PREDICTED: mediator of RNA polymerase II tra...  82.0    6e-16   Erinaceus europaeus [common hedgehog]
ref|XP_010968666.1|  PREDICTED: mediator of RNA polymerase II tra...  81.6    8e-16   Camelus bactrianus [camel]
ref|XP_001600793.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    8e-16   Nasonia vitripennis
ref|XP_006198447.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    1e-15   Vicugna pacos
ref|XP_008832792.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    1e-15   Nannospalax galili
dbj|BAE33733.1|  unnamed protein product                              81.3    1e-15   Mus musculus [mouse]
ref|NP_613062.1|  mediator of RNA polymerase II transcription sub...  81.3    1e-15   Mus musculus [mouse]
ref|XP_005356754.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    1e-15   Microtus ochrogaster [prairie voles]
ref|XP_001639313.1|  predicted protein                                81.3    1e-15   Nematostella vectensis
ref|XP_004274551.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    1e-15   Orcinus orca [Orca]
ref|XP_006875023.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    1e-15   Chrysochloris asiatica
ref|XP_004894714.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    1e-15   
ref|XP_001363617.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    1e-15   Monodelphis domestica
ref|XP_010984281.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    1e-15   Camelus dromedarius [camel]
ref|XP_004678110.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    1e-15   Condylura cristata
ref|XP_004625247.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    1e-15   
ref|XP_011242829.1|  PREDICTED: mediator of RNA polymerase II tra...  81.3    2e-15   Mus musculus [mouse]
ref|NP_001247782.1|  mediator of RNA polymerase II transcription ...  80.9    2e-15   Macaca mulatta [rhesus macaque]
ref|XP_006081530.1|  PREDICTED: mediator of RNA polymerase II tra...  80.9    2e-15   Myotis lucifugus
ref|XP_004380332.1|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Trichechus manatus latirostris
ref|XP_003134205.1|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Sus scrofa [pigs]
ref|NP_115662.2|  mediator of RNA polymerase II transcription sub...  80.5    2e-15   Homo sapiens [man]
gb|KFW71686.1|  Mediator of RNA polymerase II transcription subun...  80.5    2e-15   Pygoscelis adeliae
ref|XP_009328746.1|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Pygoscelis adeliae
ref|XP_004597953.1|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Ochotona princeps [southern American pika]
ref|XP_009867898.1|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Apaloderma vittatum
ref|XP_003800937.1|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Otolemur garnettii
ref|XP_010194202.1|  PREDICTED: mediator of RNA polymerase II tra...  80.1    2e-15   Colius striatus
gb|KFV94189.1|  Mediator of RNA polymerase II transcription subun...  80.1    2e-15   Eurypyga helias
ref|XP_010152321.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  80.5    2e-15   Eurypyga helias
ref|XP_006171581.1|  PREDICTED: mediator of RNA polymerase II tra...  80.1    2e-15   Tupaia chinensis
ref|XP_005873843.1|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Myotis brandtii
ref|XP_008543284.1|  PREDICTED: mediator of RNA polymerase II tra...  80.1    2e-15   Microplitis demolitor
ref|XP_001601868.2|  PREDICTED: mediator of RNA polymerase II tra...  80.5    2e-15   Nasonia vitripennis
ref|NP_001004914.1|  mediator of RNA polymerase II transcription ...  80.1    3e-15   Xenopus tropicalis [western clawed frog]
ref|XP_007435877.1|  PREDICTED: mediator of RNA polymerase II tra...  80.1    3e-15   Python bivittatus
ref|NP_001085232.1|  mediator of RNA polymerase II transcription ...  79.7    3e-15   Xenopus laevis [clawed frog]
ref|XP_001621967.1|  hypothetical protein NEMVEDRAFT_v1g176376        80.1    3e-15   Nematostella vectensis
ref|XP_008948061.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    4e-15   Merops nubicus
ref|XP_004698165.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    4e-15   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005959297.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    4e-15   Pantholops hodgsonii [Tibetan antelope]
ref|XP_002412765.1|  nut2, putative                                   79.7    4e-15   Ixodes scapularis [blacklegged tick]
ref|XP_006001826.1|  PREDICTED: mediator of RNA polymerase II tra...  79.7    4e-15   Latimeria chalumnae
ref|NP_001232567.1|  putative MGC89063 protein variant 2              79.3    4e-15   Taeniopygia guttata
ref|XP_009078838.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    4e-15   Acanthisitta chloris
ref|XP_011141422.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    4e-15   Harpegnathos saltator
gb|KFQ70639.1|  Mediator of RNA polymerase II transcription subun...  79.3    4e-15   Phaethon lepturus
gb|EFZ10240.1|  hypothetical protein SINV_14848                       79.3    5e-15   
ref|XP_006025079.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    5e-15   Alligator sinensis
ref|XP_011171735.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    5e-15   Solenopsis invicta [imported red fire ant]
ref|XP_008489554.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    5e-15   Calypte anna
ref|XP_010569720.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    5e-15   Haliaeetus leucocephalus
ref|XP_010295441.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    5e-15   Phaethon lepturus
ref|XP_009568584.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    5e-15   Cuculus canorus
ref|XP_005188303.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    5e-15   Musca domestica
gb|KFQ66578.1|  Mediator of RNA polymerase II transcription subun...  78.6    6e-15   Pelecanus crispus
ref|XP_003737748.1|  PREDICTED: mediator of RNA polymerase II tra...  79.3    6e-15   Galendromus occidentalis
ref|XP_001511205.2|  PREDICTED: mediator of RNA polymerase II tra...  79.7    6e-15   
ref|XP_005427987.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    6e-15   Geospiza fortis
ref|XP_003408084.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    7e-15   Loxodonta africana [African bush elephant]
ref|XP_009489761.1|  PREDICTED: mediator of RNA polymerase II tra...  78.2    7e-15   Pelecanus crispus
gb|KFO14882.1|  Mediator of RNA polymerase II transcription subun...  78.6    8e-15   Balearica regulorum gibbericeps
ref|XP_010308856.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    8e-15   Balearica regulorum gibbericeps
ref|XP_006635939.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    8e-15   Lepisosteus oculatus
gb|KFM58995.1|  Mediator of RNA polymerase II transcription subun...  78.6    8e-15   Stegodyphus mimosarum
ref|XP_011285416.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    8e-15   
ref|XP_011050147.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    8e-15   Acromyrmex echinatior
ref|XP_624779.1|  PREDICTED: mediator of RNA polymerase II transc...  78.6    8e-15   Apis mellifera [bee]
ref|XP_004935190.1|  PREDICTED: mediator of RNA polymerase II tra...  79.0    9e-15   
ref|XP_004270303.1|  PREDICTED: mediator of RNA polymerase II tra...  78.6    1e-14   
ref|XP_003397402.1|  PREDICTED: mediator of RNA polymerase II tra...  78.2    1e-14   Bombus terrestris [large earth bumblebee]
ref|XP_011501311.1|  PREDICTED: mediator of RNA polymerase II tra...  78.2    1e-14   Ceratosolen solmsi marchali
ref|XP_002112039.1|  hypothetical protein TRIADDRAFT_24417            78.2    1e-14   Trichoplax adhaerens
ref|NP_001271609.1|  mediator of RNA polymerase II transcription ...  78.2    1e-14   Macaca fascicularis [crab eating macaque]
gb|KFH71415.1|  hypothetical protein MVEG_01714                       79.3    2e-14   Mortierella verticillata NRRL 6337
ref|XP_003223649.1|  PREDICTED: mediator of RNA polymerase II tra...  77.8    2e-14   Anolis carolinensis [Carolina anole]
ref|XP_011189186.1|  PREDICTED: mediator of RNA polymerase II tra...  77.4    2e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_419024.4|  PREDICTED: mediator of RNA polymerase II transc...  78.6    3e-14   
sp|Q0VIA1.1|MED10_DANRE  RecName: Full=Mediator of RNA polymerase...  77.0    3e-14   Danio rerio [leopard danio]
ref|XP_003707557.1|  PREDICTED: mediator of RNA polymerase II tra...  77.0    3e-14   Megachile rotundata
ref|XP_004525900.1|  PREDICTED: mediator of RNA polymerase II tra...  77.0    3e-14   Ceratitis capitata [medfly]
ref|XP_007453559.1|  PREDICTED: mediator of RNA polymerase II tra...  76.6    4e-14   Lipotes vexillifer [baiji]
gb|KHJ40733.1|  hypothetical protein D918_09175                       78.2    4e-14   Trichuris suis
ref|NP_001017699.1|  mediator of RNA polymerase II transcription ...  76.6    4e-14   Danio rerio [leopard danio]
ref|XP_009058257.1|  hypothetical protein LOTGIDRAFT_233490           76.6    4e-14   Lottia gigantea
gb|KFD52471.1|  hypothetical protein M513_06668                       78.2    5e-14   Trichuris suis
ref|XP_005294660.2|  PREDICTED: mediator of RNA polymerase II tra...  78.6    5e-14   Chrysemys picta bellii
ref|XP_002732894.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    5e-14   Saccoglossus kowalevskii
ref|NP_001188215.1|  mediator of RNA polymerase II transcription ...  76.3    6e-14   Ictalurus punctatus
gb|KIH45973.1|  mediator of RNA polymerase II transcription subun...  76.6    6e-14   Ancylostoma duodenale
emb|CDW52045.1|  UPF0203 and Med10 domain containing protein          77.8    7e-14   Trichuris trichiura
gb|KIH63536.1|  mediator of RNA polymerase II transcription subun...  75.5    8e-14   Ancylostoma duodenale
ref|XP_007563794.1|  PREDICTED: mediator of RNA polymerase II tra...  75.9    8e-14   Poecilia formosa
ref|XP_003690347.1|  PREDICTED: mediator of RNA polymerase II tra...  75.9    8e-14   Apis florea [dwarf honeybee]
ref|XP_004315303.1|  PREDICTED: mediator of RNA polymerase II tra...  75.5    1e-13   
ref|XP_005809155.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    1e-13   Xiphophorus maculatus
emb|CDJ97162.1|  Mediator complex domain containing protein           75.5    1e-13   Haemonchus contortus [red stomach worm]
ref|XP_010733995.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    2e-13   Larimichthys crocea [croceine croaker]
ref|XP_008302435.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    2e-13   Stegastes partitus
ref|XP_003443822.1|  PREDICTED: mediator of RNA polymerase II tra...  74.7    2e-13   Oreochromis niloticus
ref|XP_011310696.1|  PREDICTED: mediator of RNA polymerase II tra...  74.7    2e-13   Fopius arisanus
ref|XP_007231771.1|  PREDICTED: mediator of RNA polymerase II tra...  74.7    2e-13   Astyanax mexicanus [blind cave fish]
ref|XP_008487303.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    2e-13   
ref|XP_004017144.1|  PREDICTED: mediator of RNA polymerase II tra...  74.7    2e-13   
ref|XP_002024961.1|  GL17837                                          74.3    2e-13   Drosophila persimilis
ref|XP_010871525.1|  PREDICTED: mediator of RNA polymerase II tra...  74.3    2e-13   
ref|XP_001951882.1|  PREDICTED: mediator of RNA polymerase II tra...  76.3    3e-13   Acyrthosiphon pisum
ref|NP_001291005.1|  mediator complex subunit 10                      74.7    3e-13   Esox lucius
ref|XP_009024289.1|  hypothetical protein HELRODRAFT_85402            74.3    3e-13   Helobdella robusta
ref|XP_001957222.1|  GF24162                                          74.3    3e-13   Drosophila ananassae
gb|ACQ57947.1|  Mediator of RNA polymerase II transcription subun...  74.3    3e-13   Anoplopoma fimbria
gb|ACO08870.1|  RNA polymerase II mediator complex subunit 10         73.9    4e-13   Osmerus mordax
gb|ACM09055.1|  Mediator of RNA polymerase II transcription subun...  73.9    4e-13   Salmo salar
ref|XP_008182011.1|  PREDICTED: mediator of RNA polymerase II tra...  75.1    4e-13   Acyrthosiphon pisum
ref|XP_004074478.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    4e-13   Oryzias latipes [Japanese rice fish]
ref|XP_008329460.1|  PREDICTED: mediator of RNA polymerase II tra...  73.9    4e-13   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003969055.1|  PREDICTED: mediator of RNA polymerase II tra...  73.6    5e-13   Takifugu rubripes [tiger puffer]
emb|CAF99495.1|  unnamed protein product                              73.6    5e-13   Tetraodon nigroviridis
gb|ACM09244.1|  Mediator of RNA polymerase II transcription subun...  73.6    6e-13   Salmo salar
gb|ACM08909.1|  Mediator of RNA polymerase II transcription subun...  73.2    7e-13   Salmo salar
ref|XP_849860.2|  PREDICTED: mediator of RNA polymerase II transc...  72.8    7e-13   Canis lupus familiaris [dogs]
ref|NP_648849.3|  mediator complex subunit 10, isoform B              73.2    7e-13   Drosophila melanogaster
ref|XP_008552382.1|  PREDICTED: mediator of RNA polymerase II tra...  72.8    8e-13   Microplitis demolitor
gb|ETN84836.1|  hypothetical protein NECAME_06640                     74.3    1e-12   Necator americanus
ref|XP_001973198.1|  GG15965                                          74.3    1e-12   
gb|ELU05881.1|  hypothetical protein CAPTEDRAFT_225426                72.4    1e-12   Capitella teleta
ref|XP_009858943.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    1e-12   Ciona intestinalis [sea vase]
ref|XP_002095754.1|  GE19533                                          74.3    1e-12   
ref|XP_002086399.1|  GE23117                                          74.3    1e-12   
ref|XP_003381082.1|  mediator of RNA polymerase II transcription ...  74.3    1e-12   Trichinella spiralis
ref|XP_001983366.1|  GH15858                                          72.0    2e-12   Drosophila grimshawi
gb|ETE62868.1|  Mediator of RNA polymerase II transcription subun...  71.6    2e-12   Ophiophagus hannah
ref|XP_002046184.1|  GJ12760                                          71.6    2e-12   Drosophila virilis
gb|KGB38934.1|  Mediator of RNA polymerase II transcription subun...  72.0    2e-12   Schistosoma haematobium
emb|CDQ80437.1|  unnamed protein product                              70.9    3e-12   Oncorhynchus mykiss
gb|AAP06408.1|  SJCHGC01009 protein                                   72.0    3e-12   Schistosoma japonicum
ref|XP_005029392.1|  PREDICTED: mediator of RNA polymerase II tra...  71.2    3e-12   
emb|CCD82369.1|  hypothetical protein Smp_025340                      72.0    3e-12   
ref|XP_003367725.1|  mediator of RNA polymerase II transcription ...  72.4    4e-12   
ref|XP_002006967.1|  GI12641                                          70.5    6e-12   
ref|XP_003145125.1|  hypothetical protein LOAG_09550                  70.5    1e-11   
ref|XP_006882964.1|  PREDICTED: mediator of RNA polymerase II tra...  70.1    1e-11   
gb|KFP40156.1|  Mediator of RNA polymerase II transcription subun...  68.9    1e-11   
ref|XP_010114904.1|  PREDICTED: mediator of RNA polymerase II tra...  68.9    1e-11   
gb|KDR16737.1|  Mediator of RNA polymerase II transcription subun...  69.7    1e-11   
ref|XP_003287426.1|  hypothetical protein DICPUDRAFT_151521           70.5    2e-11   
gb|EDL87620.1|  similar to DNA segment, Chr 13, Wayne State Unive...  68.2    2e-11   
ref|XP_005604461.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  69.7    2e-11   
gb|KFO38462.1|  Mediator of RNA polymerase II transcription subun...  69.3    2e-11   
ref|XP_001902787.1|  SD24044p                                         69.7    2e-11   
emb|CDP91692.1|  Protein BM-MDT-10, isoform a                         69.7    2e-11   
ref|XP_010604223.1|  PREDICTED: mediator of RNA polymerase II tra...  67.8    4e-11   
ref|XP_004666141.1|  PREDICTED: mediator of RNA polymerase II tra...  67.8    4e-11   
ref|XP_007451718.1|  PREDICTED: mediator of RNA polymerase II tra...  67.8    4e-11   
ref|XP_009940822.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    5e-11   
ref|XP_006195326.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    6e-11   
ref|XP_003759658.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    6e-11   
ref|XP_005102640.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    9e-11   
gb|EHH54143.1|  Mediator complex subunit 10                           66.2    1e-10   
ref|XP_008706982.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    1e-10   
dbj|GAM21938.1|  hypothetical protein SAMD00019534_051130             67.4    1e-10   
gb|EDL37023.1|  DNA segment, Chr 13, Wayne State University 50, e...  65.9    1e-10   
gb|ERG87834.1|  mediator of rna polymerase ii transcription subun...  68.6    1e-10   
ref|XP_003383806.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    1e-10   
ref|XP_005335249.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    1e-10   
ref|XP_002927789.1|  PREDICTED: mediator of RNA polymerase II tra...  66.2    1e-10   
ref|XP_008517121.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    1e-10   
ref|XP_011408963.1|  PREDICTED: mediator of RNA polymerase II tra...  66.2    2e-10   
ref|XP_006127355.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    2e-10   
emb|CDJ02263.1|  Mediator of RNA polymerase II transcription          66.6    2e-10   
gb|EUB61582.1|  Mediator of RNA polymerase II transcription subunit   66.6    2e-10   
ref|XP_004604300.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    2e-10   
ref|XP_005434542.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    2e-10   
ref|XP_005239796.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    2e-10   
ref|XP_009637011.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    2e-10   
ref|XP_006675478.1|  hypothetical protein BATDEDRAFT_22126            65.5    3e-10   
ref|XP_009928719.1|  PREDICTED: mediator of RNA polymerase II tra...  65.5    3e-10   
ref|XP_006001827.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    3e-10   
ref|XP_005896991.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    3e-10   
ref|XP_009176929.1|  hypothetical protein T265_11866                  66.2    3e-10   
gb|EFA86244.1|  putative mediator complex subunit 10                  65.9    4e-10   
ref|XP_009498982.1|  PREDICTED: mediator of RNA polymerase II tra...  64.3    4e-10   
gb|KFU85695.1|  Mediator of RNA polymerase II transcription subun...  64.7    4e-10   
ref|XP_007067402.1|  PREDICTED: mediator of RNA polymerase II tra...  64.7    4e-10   
emb|CDS33518.1|  Mediator of RNA polymerase II transcription          65.9    4e-10   
ref|XP_009276992.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    4e-10   
ref|XP_010006665.1|  PREDICTED: mediator of RNA polymerase II tra...  64.7    4e-10   
emb|CDH55146.1|  predicted protein                                    65.5    4e-10   
ref|XP_005513368.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    4e-10   
ref|XP_635833.1|  hypothetical protein DDB_G0290209                   66.6    4e-10   
ref|XP_003342237.2|  PREDICTED: mediator of RNA polymerase II tra...  64.7    4e-10   
ref|XP_002839723.1|  hypothetical protein                             65.5    5e-10   
ref|XP_007096375.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    6e-10   
ref|XP_009974490.1|  PREDICTED: mediator of RNA polymerase II tra...  64.7    6e-10   
ref|XP_006127356.1|  PREDICTED: mediator of RNA polymerase II tra...  63.5    7e-10   
ref|XP_009663478.1|  PREDICTED: mediator of RNA polymerase II tra...  64.3    7e-10   
ref|XP_008635473.1|  PREDICTED: mediator of RNA polymerase II tra...  64.7    8e-10   
ref|XP_008921071.1|  PREDICTED: mediator of RNA polymerase II tra...  63.5    9e-10   
ref|XP_006517338.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    9e-10   
ref|XP_004845207.1|  PREDICTED: mediator of RNA polymerase II tra...  63.9    1e-09   
emb|CDS14086.1|  hypothetical protein LRAMOSA06257                    63.9    2e-09   
gb|KDD75001.1|  hypothetical protein H632_c932p0                      62.8    2e-09   
ref|XP_002946506.1|  hypothetical protein VOLCADRAFT_120267           62.8    5e-09   
gb|KDQ24390.1|  hypothetical protein PLEOSDRAFT_1046852               62.0    7e-09   
gb|EYC39823.1|  hypothetical protein Y032_0639g986                    60.5    8e-09   
ref|XP_002631446.1|  C. briggsae CBR-MDT-10 protein                   62.0    9e-09   
ref|XP_011378322.1|  PREDICTED: mediator of RNA polymerase II tra...  61.2    1e-08   
ref|XP_004655747.1|  PREDICTED: mediator of RNA polymerase II tra...  60.8    1e-08   
ref|XP_004364730.1|  hypothetical protein CAOG_01862                  62.0    1e-08   
gb|ESW98536.1|  Mediator of RNA polymerase II transcription subun...  61.2    1e-08   
ref|XP_010789639.1|  PREDICTED: mediator of RNA polymerase II tra...  60.1    2e-08   
ref|NP_495650.1|  Protein MDT-10                                      61.2    2e-08   
gb|EYC39824.1|  hypothetical protein Y032_0639g986                    59.7    2e-08   
gb|EYC39825.1|  hypothetical protein Y032_0639g986                    59.7    2e-08   
gb|ESA16742.1|  hypothetical protein GLOINDRAFT_22517                 60.8    2e-08   
ref|XP_008053076.1|  PREDICTED: mediator of RNA polymerase II tra...  63.2    3e-08   
gb|EXX61022.1|  Nut2p                                                 60.5    3e-08   
gb|ACM09594.1|  Mediator of RNA polymerase II transcription subun...  59.3    3e-08   
gb|KDN40546.1|  hypothetical protein RSAG8_08018                      60.5    4e-08   
ref|XP_007375550.1|  mediator of RNA polymerase II transcription ...  59.7    5e-08   
ref|XP_504022.1|  YALI0E16456p                                        59.7    5e-08   
gb|KIM84047.1|  hypothetical protein PILCRDRAFT_97098                 59.7    5e-08   
dbj|GAN04769.1|  mediator of RNA polymerase II transcription subu...  59.3    6e-08   
gb|EPB92340.1|  hypothetical protein HMPREF1544_00909                 59.3    6e-08   
gb|EUC63838.1|  transcription factor subunit Med10 of mediator co...  59.7    8e-08   
gb|KHJ91970.1|  hypothetical protein OESDEN_08150                     59.3    1e-07   
ref|XP_007713373.1|  hypothetical protein COCCADRAFT_37714            58.5    1e-07   
emb|CEP14746.1|  hypothetical protein                                 58.5    1e-07   
gb|KIW06185.1|  hypothetical protein PV09_02667                       58.2    1e-07   
ref|XP_011107705.1|  hypothetical protein H072_1714                   59.3    1e-07   
ref|XP_011119949.1|  hypothetical protein AOL_s00054g331              59.3    1e-07   
ref|XP_007864503.1|  hypothetical protein GLOTRDRAFT_74149            58.5    2e-07   
gb|EMG49532.1|  hypothetical protein G210_5672                        58.2    2e-07   
ref|XP_001930579.1|  mediator of RNA polymerase II transcription ...  57.8    2e-07   
ref|XP_007268068.1|  hypothetical protein FOMMEDRAFT_65242            57.8    2e-07   
emb|CEL52755.1|  Mediator of RNA polymerase II transcription subu...  58.5    2e-07   
ref|XP_003301498.1|  hypothetical protein PTT_13018                   58.2    2e-07   
emb|CEP62396.1|  LALA0S05e04698g1_1                                   57.8    2e-07   
ref|XP_003669574.1|  hypothetical protein NDAI_0D00170                58.2    3e-07   
ref|XP_002496492.1|  ZYRO0D01386p                                     57.8    3e-07   
ref|XP_008022103.1|  hypothetical protein SETTUDRAFT_175313           57.4    3e-07   
ref|XP_007705280.1|  hypothetical protein COCSADRAFT_128289           57.0    4e-07   
ref|XP_007684085.1|  hypothetical protein COCMIDRAFT_33257            57.0    4e-07   
gb|EMD90481.1|  hypothetical protein COCHEDRAFT_1179325               57.0    4e-07   
ref|XP_003683117.1|  hypothetical protein TDEL_0H00470                57.0    5e-07   
ref|XP_004209439.1|  PREDICTED: mediator of RNA polymerase II tra...  56.6    5e-07   
emb|CDH12902.1|  probable Mediator of RNA polymerase II transcrip...  57.0    5e-07   
ref|XP_002549154.1|  hypothetical protein CTRG_03451                  57.0    6e-07   
emb|CDF88620.1|  BN860_14488g1_1                                      57.0    6e-07   
gb|EUN31105.1|  hypothetical protein COCVIDRAFT_23266                 56.6    6e-07   
ref|XP_003686304.1|  hypothetical protein TPHA_0G00320                57.0    6e-07   
ref|XP_003677682.1|  hypothetical protein NCAS_0H00210                56.6    7e-07   
ref|XP_003645133.1|  hypothetical protein Ecym_2603                   56.6    7e-07   
ref|NP_984601.2|  AEL260Cp                                            56.6    8e-07   
gb|AGO12106.1|  AaceriAEL260Cp                                        56.2    8e-07   
ref|XP_007830647.1|  hypothetical protein PFICI_03875                 56.6    8e-07   
ref|XP_010460283.1|  PREDICTED: mediator of RNA polymerase II tra...  55.1    8e-07   
ref|XP_003102485.1|  CRE-MDT-10 protein                               57.0    8e-07   
gb|KDQ65127.1|  hypothetical protein JAAARDRAFT_116447                56.6    9e-07   
gb|EJU05979.1|  hypothetical protein DACRYDRAFT_97632                 58.2    1e-06   
gb|EKG17022.1|  Mediator complex subunit Med10                        55.8    1e-06   
gb|KIL68120.1|  hypothetical protein M378DRAFT_72105                  55.8    1e-06   
gb|KIP10593.1|  hypothetical protein PHLGIDRAFT_65317                 55.8    2e-06   
emb|CEG69370.1|  hypothetical protein RMATCC62417_05457               55.1    2e-06   
gb|EPS95903.1|  hypothetical protein FOMPIDRAFT_1025594               55.5    2e-06   
gb|EGT43040.1|  CBN-MDT-10 protein                                    55.5    2e-06   
ref|XP_004200370.1|  Piso0_002956                                     55.1    2e-06   
gb|EST07851.1|  hypothetical protein PSEUBRA_SCAF2g02939              55.8    2e-06   
gb|KIW06187.1|  hypothetical protein, variant 2                       54.7    2e-06   
ref|XP_007391610.1|  hypothetical protein PHACADRAFT_249193           55.1    3e-06   
ref|XP_006743006.1|  PREDICTED: mediator of RNA polymerase II tra...  53.5    3e-06   
ref|XP_007364484.1|  hypothetical protein DICSQDRAFT_179782           55.5    4e-06   
emb|CEJ02480.1|  hypothetical protein RMCBS344292_16483               54.3    4e-06   
emb|CCK70269.1|  hypothetical protein KNAG_0D05310                    54.7    4e-06   
dbj|GAC76876.1|  transcription factor, subunit of SRB subcomplex ...  55.8    4e-06   
ref|XP_001551360.1|  hypothetical protein BC1G_10186                  54.7    4e-06   
emb|CCO37282.1|  Mediator of RNA polymerase II transcription subu...  55.1    4e-06   
gb|ETS63123.1|  mediator of rna polymerase ii transcription subun...  55.8    5e-06   
ref|NP_015494.1|  Nut2p                                               54.3    5e-06   
dbj|GAK63763.1|  mediator of RNA polymerase II transcription subu...  55.5    5e-06   
gb|EJT41286.1|  NUT2-like protein                                     54.3    5e-06   
ref|XP_007296725.1|  transcription factor subunit Med10               53.9    6e-06   
emb|CCF53045.1|  uncharacterized protein UHOR_02827                   54.7    6e-06   
gb|EHM99685.1|  Nut2p                                                 53.9    6e-06   
ref|XP_007315242.1|  hypothetical protein SERLADRAFT_460069           54.3    6e-06   
ref|XP_457418.1|  DEHA2B10692p                                        53.9    7e-06   
ref|XP_011275790.1|  Mediator of RNA polymerase II transcription ...  53.5    7e-06   
gb|KIH42732.1|  hypothetical protein ANCDUO_27279                     52.0    7e-06   
ref|XP_006689443.1|  hypothetical protein CANTEDRAFT_111350           53.5    7e-06   
ref|XP_001643539.1|  hypothetical protein Kpol_1008p19                53.5    8e-06   
gb|KHN86460.1|  Uncharacterized protein T09A5.7                       54.3    8e-06   
gb|ESZ98053.1|  S-adenosylmethionine-dependent methyltransferase-...  55.8    8e-06   
ref|XP_001212209.1|  predicted protein                                53.5    9e-06   
ref|XP_007301440.1|  hypothetical protein STEHIDRAFT_137898           53.9    9e-06   
ref|XP_001527919.1|  hypothetical protein LELG_00439                  53.1    1e-05   
ref|XP_003844155.1|  similar to RNA polymerase II mediator comple...  53.1    1e-05   
ref|XP_003712875.1|  hypothetical protein MGG_05314                   53.9    1e-05   
ref|XP_007388524.1|  hypothetical protein PUNSTDRAFT_31296            53.1    1e-05   
ref|XP_001486029.1|  hypothetical protein PGUG_01700                  53.1    1e-05   
ref|XP_006762532.1|  PREDICTED: mediator of RNA polymerase II tra...  52.4    1e-05   
ref|XP_447619.1|  hypothetical protein                                53.9    1e-05   
emb|CDR37597.1|  CYFA0S01e12970g1_1                                   52.8    1e-05   
ref|XP_001591671.1|  hypothetical protein SS1G_07117                  53.1    1e-05   
gb|KIK68821.1|  hypothetical protein GYMLUDRAFT_153017                53.1    1e-05   
ref|XP_004182539.1|  hypothetical protein TBLA_0J00200                52.8    2e-05   
ref|XP_007857319.1|  mediator of rna polymerase ii transcription ...  52.8    2e-05   
ref|XP_002417763.1|  RNA polymerase II basal transcription comple...  52.8    2e-05   
emb|CCG83714.1|  protein of unknown function                          52.4    2e-05   
dbj|GAC92674.1|  hypothetical protein PHSY_000229                     53.5    2e-05   
gb|EMD31815.1|  hypothetical protein CERSUDRAFT_119386                53.1    2e-05   
gb|EIF47336.1|  nut2p                                                 52.4    2e-05   
gb|KJA30096.1|  hypothetical protein HYPSUDRAFT_105712                52.4    2e-05   
gb|EME49304.1|  hypothetical protein DOTSEDRAFT_19766                 52.4    2e-05   
ref|XP_002558681.1|  Pc13g02400                                       52.8    2e-05   
ref|XP_001383112.2|  hypothetical protein PICST_30038                 52.4    2e-05   
ref|XP_003016155.1|  hypothetical protein ARB_05552                   52.0    3e-05   
emb|CDK24512.1|  unnamed protein product                              52.0    3e-05   
ref|XP_002554998.1|  KLTH0F18678p                                     52.0    3e-05   
gb|KEY82754.1|  RNA polymerase II mediator complex protein Nut2       52.0    3e-05   
ref|XP_003238389.1|  RNA polymerase II mediator complex protein Nut2  52.0    3e-05   
gb|KHJ78989.1|  hypothetical protein OESDEN_21380                     53.5    3e-05   
emb|CCO37431.1|  hypothetical protein BN14_11587                      53.9    3e-05   
emb|CBQ72138.1|  conserved hypothetical protein                       52.8    3e-05   
ref|XP_007585454.1|  putative mediator of rna polymerase ii trans...  51.6    4e-05   
ref|XP_750344.1|  RNA polymerase II mediator complex protein Nut2     52.0    4e-05   
ref|XP_008035931.1|  hypothetical protein TRAVEDRAFT_164202           52.4    4e-05   
ref|XP_008080838.1|  mediator of RNA polymerase II transcription ...  51.6    4e-05   
gb|KIY66446.1|  hypothetical protein CYLTODRAFT_437433                52.0    4e-05   
gb|EZF30727.1|  hypothetical protein H101_05641                       52.0    4e-05   
gb|KFY00302.1|  hypothetical protein O988_03389                       51.6    4e-05   
gb|KFX93430.1|  hypothetical protein V490_04835                       51.6    5e-05   
gb|KII96083.1|  hypothetical protein PLICRDRAFT_35043                 52.0    5e-05   
gb|EGD94933.1|  RNA polymerase II mediator complex protein Nut2       51.6    5e-05   
gb|KFZ08527.1|  hypothetical protein V501_05930                       51.6    5e-05   
gb|EWC44059.1|  hypothetical protein DRE_01411                        52.4    5e-05   
gb|EGE02496.1|  RNA polymerase II mediator complex protein Nut2       52.0    5e-05   
gb|KHN86453.1|  Mediator of RNA polymerase II transcription subun...  51.2    5e-05   
ref|XP_003177053.1|  RNA polymerase II transcription subunit 10 m...  51.6    5e-05   
gb|KFY46723.1|  hypothetical protein V495_02296                       51.6    5e-05   
gb|KIK08419.1|  hypothetical protein K443DRAFT_672438                 51.6    6e-05   
gb|ACM08981.1|  Mediator of RNA polymerase II transcription subun...  50.4    6e-05   
ref|XP_002620017.1|  hypothetical protein CLUG_01176                  51.2    6e-05   
ref|XP_006460159.1|  hypothetical protein AGABI2DRAFT_67575           51.2    6e-05   
ref|XP_005843815.1|  hypothetical protein CHLNCDRAFT_54921            51.2    6e-05   
ref|XP_003954881.1|  hypothetical protein KAFR_0A03110                51.6    7e-05   
gb|KFY92010.1|  hypothetical protein V500_04369                       51.2    7e-05   
gb|KFY15417.1|  hypothetical protein V492_01995                       51.6    7e-05   
ref|XP_011387837.1|  hypothetical protein UMAG_01906                  52.0    7e-05   
gb|EKV08263.1|  Mediator of RNA polymerase II transcription subun...  51.2    8e-05   
gb|KFY36176.1|  hypothetical protein V494_05256                       51.2    8e-05   
ref|XP_007911172.1|  putative mediator of rna polymerase ii trans...  50.8    9e-05   
gb|KIM46001.1|  hypothetical protein M413DRAFT_441066                 50.8    1e-04   
ref|XP_007597703.1|  transcription factor subunit Med10               50.8    1e-04   
gb|EGU12851.1|  Mediator of RNA polymerase II transcription subun...  51.2    1e-04   
gb|KDE07975.1|  hypothetical protein MVLG_01881                       51.6    1e-04   
emb|CCA40028.1|  Mediator of RNA polymerase II transcription subu...  50.4    1e-04   
emb|CDH55147.1|  predicted protein                                    50.1    1e-04   
ref|XP_002492359.1|  Subunit of the RNA polymerase II mediator co...  50.4    1e-04   



>ref|XP_009358713.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Pyrus x bretschneideri]
Length=189

 Score =   273 bits (698),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG++HQLYLTVSSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  36   KQNLNQVINSIQKTLGLIHQLYLTVSSFNAASQLPLLQRLNALVMELDNMAKLSEKCNIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+ELE+ FPDEVE
Sbjct  96   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEELEQTFPDEVE  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE K+LAQAQ+ LPNGDVKVKPE+
Sbjct  156  SYRDIRAASAAETKRLAQAQSTLPNGDVKVKPEL  189



>ref|XP_009359543.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Pyrus x bretschneideri]
 ref|XP_009370921.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Pyrus x bretschneideri]
Length=190

 Score =   273 bits (697),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG++HQLYLTVSSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLIHQLYLTVSSFNAASQLPILQRLNALVMELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+N CIAKNQITKGKTD FK LRKHLL+ELE+AFPDEVE
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINGCIAKNQITKGKTDTFKSLRKHLLEELEQAFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE K+LAQAQ+ LPNGDVKVKPE+
Sbjct  157  SYRDIRAASAAETKRLAQAQSTLPNGDVKVKPEL  190



>ref|XP_008346652.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Malus domestica]
 ref|XP_008346653.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Malus domestica]
Length=189

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+ HQLYLTVSSFNA SQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  36   KQNLNQVINSIQKTLGLXHQLYLTVSSFNAXSQLPLLQRLNALVMELDNMAKLSEKCNIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+ELE+AFPDEVE
Sbjct  96   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEELEQAFPDEVE  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE K+LAQAQ+ LPNGDVKVKPE+
Sbjct  156  SYRDIRAASAAETKRLAQAQSTLPNGDVKVKPEL  189



>ref|XP_006439221.1| hypothetical protein CICLE_v10022441mg [Citrus clementina]
 gb|ESR52461.1| hypothetical protein CICLE_v10022441mg [Citrus clementina]
Length=186

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLLDELE+ FPDEVE
Sbjct  93   VPMEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLDELEQTFPDEVE  152

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA SAAEAK+LAQ+Q+ LPNGDVKVK E+
Sbjct  153  AYREIRANSAAEAKRLAQSQSMLPNGDVKVKSEL  186



>ref|XP_008390269.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Malus domestica]
Length=190

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG++HQLYLTVSSFN+ASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLIHQLYLTVSSFNSASQLPLLQRLNALVMELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+N CIAKNQITKGKTD FK LRKHLL+ELE+AFPDEVE
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINGCIAKNQITKGKTDTFKSLRKHLLEELEQAFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE K+LAQAQ+ LPNGDVKVKPE+
Sbjct  157  SYRDIRAASAAETKRLAQAQSTLPNGDVKVKPEL  190



>ref|XP_009608618.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Nicotiana tomentosiformis]
Length=196

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+ELE+AFP+EVE
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLEELEQAFPEEVE  162

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA SAAEAK+LAQAQ+ LPNGDVKVKPE+
Sbjct  163  AYREIRAASAAEAKRLAQAQSLLPNGDVKVKPEI  196



>gb|KHG13856.1| Mediator of RNA polymerase II transcription subunit 10 [Gossypium 
arboreum]
Length=190

 Score =   270 bits (691),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLN CIAKNQ+TKGKTDAFKGLRKHLL+ELE+AFPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNGCIAKNQVTKGKTDAFKGLRKHLLEELEQAFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA++AAE+K+LAQ+Q+ L NGDVKVK E+
Sbjct  157  SYREIRASAAAESKRLAQSQSILQNGDVKVKTEL  190



>ref|XP_002527873.1| nut2, putative [Ricinus communis]
 gb|EEF34504.1| nut2, putative [Ricinus communis]
Length=187

 Score =   270 bits (690),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLN VI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LVLELD +AKL+EKC+IQ
Sbjct  34   KQNLNNVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVLELDKMAKLSEKCNIQ  93

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFKGLRKHLL+ELE+AFPDEVE
Sbjct  94   VPLEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKGLRKHLLEELEQAFPDEVE  153

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE+K+LAQAQ++LPNGDVKVK E+
Sbjct  154  SYREIRAISAAESKRLAQAQSSLPNGDVKVKSEL  187



>ref|XP_002280081.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Vitis vinifera]
Length=194

 Score =   270 bits (689),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NALV ELDN+ KL+EKC+IQ
Sbjct  41   KQNLNQVINSIQKTLGLLHQLYLTVSSFNVASQLPLLQRLNALVSELDNMTKLSEKCNIQ  100

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LID+GKNPDEFTRDVLNSCIAKNQITKGKTD+FKGLR+HLL+ELE+AFPDEVE
Sbjct  101  VPMEVLNLIDEGKNPDEFTRDVLNSCIAKNQITKGKTDSFKGLRRHLLEELEQAFPDEVE  160

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE+K+LAQAQ+ LPNGD+KVK E+
Sbjct  161  SYREIRAASAAESKRLAQAQSVLPNGDLKVKTEL  194



>gb|KJB51996.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
 gb|KJB51997.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
Length=190

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLN CIAKNQ+TKGKTDAFKGLRKHLL+ELE+AFPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNGCIAKNQVTKGKTDAFKGLRKHLLEELEQAFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA++AAE K+LAQ+Q+ L NGDVKVK E+
Sbjct  157  SYREIRASAAAEYKRLAQSQSILQNGDVKVKTEL  190



>ref|XP_006476288.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Citrus sinensis]
 ref|XP_006476289.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Citrus sinensis]
 gb|KDO76723.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
Length=186

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLLDELE+ FPDEVE
Sbjct  93   VPTEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLDELEQTFPDEVE  152

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA SAAEAK+LAQ+Q+ LPNGDVKVK E+
Sbjct  153  AYREIRANSAAEAKRLAQSQSMLPNGDVKVKSEL  186



>ref|XP_007039389.1| Mediator complex, subunit Med10 isoform 1 [Theobroma cacao]
 gb|EOY23890.1| Mediator complex, subunit Med10 isoform 1 [Theobroma cacao]
Length=190

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+ELE+ FPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQTFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA+SAAE K+LAQ+Q+ LPNGDVKVK E+
Sbjct  157  SYREIRASSAAECKRLAQSQSMLPNGDVKVKTEL  190



>ref|XP_002299427.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
 gb|EEE84232.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
Length=190

 Score =   268 bits (685),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LV ELDN+ KL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMVKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEF+RDV+NSCIAKNQ+TKGKTDAFK LRKHLL+ELE+ FPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFSRDVINSCIAKNQVTKGKTDAFKSLRKHLLEELEQTFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAEAK+LAQAQ++LPNGDVKVK E+
Sbjct  157  SYREIRAMSAAEAKRLAQAQSSLPNGDVKVKAEL  190



>ref|XP_011022410.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
 ref|XP_011022411.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
 ref|XP_011022412.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
 ref|XP_011022413.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
Length=185

 Score =   267 bits (683),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI SIQKTLG LHQLYLTVSSFN ASQLP LQR+N LV ELDN+AKL+E+C+IQ
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMAKLSERCNIQ  91

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTR V+NSCIAKNQ+TKGKTDAFK LRKHLL+ELE+ FPDEVE
Sbjct  92   VPMEVLNLIDDGKNPDEFTRGVMNSCIAKNQVTKGKTDAFKSLRKHLLEELEQTFPDEVE  151

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +YR  RA SAAEAK+LAQ+Q++LPNGDVKVKPE
Sbjct  152  SYREIRAMSAAEAKRLAQSQSSLPNGDVKVKPE  184



>ref|XP_004245099.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Solanum lycopersicum]
Length=201

 Score =   267 bits (683),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SI KTLG+LHQL LTVSS+N +SQLP LQRMN LVLELDN+AKL EKC+IQ
Sbjct  48   KQNLNQVINSIDKTLGILHQLNLTVSSYNVSSQLPLLQRMNNLVLELDNMAKLGEKCNIQ  107

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLR HLL++LE+AFP+EVE
Sbjct  108  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRGHLLEDLEQAFPEEVE  167

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA SAAEAK+LAQAQ+ LPNGDVKVKPE+
Sbjct  168  AYREIRAASAAEAKRLAQAQSLLPNGDVKVKPEV  201



>emb|CBI34587.3| unnamed protein product [Vitis vinifera]
Length=284

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NALV ELDN+ KL+EKC+IQ
Sbjct  131  KQNLNQVINSIQKTLGLLHQLYLTVSSFNVASQLPLLQRLNALVSELDNMTKLSEKCNIQ  190

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LID+GKNPDEFTRDVLNSCIAKNQITKGKTD+FKGLR+HLL+ELE+AFPDEVE
Sbjct  191  VPMEVLNLIDEGKNPDEFTRDVLNSCIAKNQITKGKTDSFKGLRRHLLEELEQAFPDEVE  250

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE+K+LAQAQ+ LPNGD+KVK E+
Sbjct  251  SYREIRAASAAESKRLAQAQSVLPNGDLKVKTEL  284



>ref|XP_006360992.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Solanum tuberosum]
Length=201

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SI KTLG+LHQL LTVSS+N +SQLP LQRMN LVLELDN+AKL EKC+IQ
Sbjct  48   KQNLNQVINSIDKTLGILHQLNLTVSSYNVSSQLPLLQRMNNLVLELDNMAKLGEKCNIQ  107

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLR HLL++LE+AFP+EVE
Sbjct  108  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRGHLLEDLEQAFPEEVE  167

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA SAAEAK+LAQAQ+ LPNGDVKVKPE+
Sbjct  168  AYREIRAASAAEAKRLAQAQSLLPNGDVKVKPEV  201



>ref|XP_011026786.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Populus euphratica]
Length=190

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LV ELDN+ KL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMVKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLL+ELE  FPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLEELELTFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +YR  RA SAAEAK+LAQAQ++LPNGDVKVK E
Sbjct  157  SYREIRAMSAAEAKRLAQAQSSLPNGDVKVKAE  189



>ref|XP_011462613.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462614.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462615.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462616.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462617.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
Length=190

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQ+LN+VI+SIQKTLG++HQLYLTVSSFNA SQLP LQR+N+L+ ELDN+AKL++KC+IQ
Sbjct  37   KQDLNKVINSIQKTLGLIHQLYLTVSSFNAGSQLPLLQRLNSLITELDNMAKLSDKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLLDELE+AFPDEVE
Sbjct  97   IPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLDELEQAFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE K+LAQAQ++LPNGDVKVKPE 
Sbjct  157  SYREIRAASAAETKRLAQAQSSLPNGDVKVKPEF  190



>ref|XP_004296727.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Fragaria vesca subsp. vesca]
Length=196

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQ+LN+VI+SIQKTLG++HQLYLTVSSFNA SQLP LQR+N+L+ ELDN+AKL++KC+IQ
Sbjct  43   KQDLNKVINSIQKTLGLIHQLYLTVSSFNAGSQLPLLQRLNSLITELDNMAKLSDKCNIQ  102

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLLDELE+AFPDEVE
Sbjct  103  IPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLDELEQAFPDEVE  162

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAE K+LAQAQ++LPNGDVKVKPE 
Sbjct  163  SYREIRAASAAETKRLAQAQSSLPNGDVKVKPEF  196



>ref|XP_009787277.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009787278.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Nicotiana sylvestris]
Length=196

 Score =   265 bits (676),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+ LE+AFP+EVE
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLEGLEQAFPEEVE  162

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA SAAEAK+LAQAQ+ L NGDVKVKPE+
Sbjct  163  AYREIRAASAAEAKRLAQAQSLLSNGDVKVKPEI  196



>gb|KDP24502.1| hypothetical protein JCGZ_25066 [Jatropha curcas]
Length=187

 Score =   264 bits (675),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LV+ELDN+ KL+EKCDIQ
Sbjct  34   KQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVVELDNMVKLSEKCDIQ  93

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LID+G+NPDEFTR+V+NSCIAKNQ+TKGKTDAFK LRKHLL+ELE+AFPDEVE
Sbjct  94   VPMEVLNLIDEGENPDEFTRNVINSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPDEVE  153

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  R  SAAE+K+LAQAQ++LPNGD+KVK E+
Sbjct  154  SYREIRTISAAESKRLAQAQSSLPNGDMKVKTEL  187



>ref|XP_010533544.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Tarenaya hassleriana]
Length=190

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+SIQK LG+LHQLYLTVSSFN ASQLP LQR+N+LV+ELDN+AKL+EKC+IQ
Sbjct  36   KENLNQVINSIQKNLGLLHQLYLTVSSFNPASQLPLLQRLNSLVMELDNMAKLSEKCNIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDV+NSCIA+NQ+TKGKTDAFKGLR+HLL+EL++ FPDEVE
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVINSCIARNQVTKGKTDAFKGLRRHLLEELDQVFPDEVE  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVK  126
             YR  RATSAAEAK+LAQ+QN LPNGD+KV+
Sbjct  156  TYREIRATSAAEAKRLAQSQNMLPNGDLKVE  186



>ref|XP_008234780.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Prunus mume]
Length=187

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLN+VI+SIQKTLG++HQLYLTVSSFN ASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  34   KQNLNEVINSIQKTLGLIHQLYLTVSSFNDASQLPLLQRLNALVIELDNMAKLSEKCNIQ  93

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+ELE+ FPDEVE
Sbjct  94   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEELEQTFPDEVE  153

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +YR  RA SAAE K+LAQAQ+ L NGDVKVKPE
Sbjct  154  SYREIRAASAAETKRLAQAQSILQNGDVKVKPE  186



>ref|XP_007218477.1| hypothetical protein PRUPE_ppa012016mg [Prunus persica]
 gb|EMJ19676.1| hypothetical protein PRUPE_ppa012016mg [Prunus persica]
Length=187

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLN+VI+SIQKTLG++HQLYLTVSSFN ASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  34   KQNLNEVINSIQKTLGLIHQLYLTVSSFNDASQLPLLQRLNALVIELDNMAKLSEKCNIQ  93

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+ELE+ FPDEVE
Sbjct  94   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEELEQTFPDEVE  153

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +YR  RA SAAE K+LAQAQ+ L NGDVKVKPE
Sbjct  154  SYREIRAASAAETKRLAQAQSILQNGDVKVKPE  186



>ref|XP_009608619.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Nicotiana tomentosiformis]
Length=194

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+ELE+AFP+EVE
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLEELEQAFPEEVE  162

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKV  129
            AYR  RA SAAEAK+LAQAQ+ LPNGDVKV
Sbjct  163  AYREIRAASAAEAKRLAQAQSLLPNGDVKV  192



>emb|CDP12227.1| unnamed protein product [Coffea canephora]
Length=166

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K NL QVI+S+QKTLG+LHQLYLTVSSFN ASQLP LQR+N LVLELDN++KLAEKC+IQ
Sbjct  13   KHNLTQVINSVQKTLGILHQLYLTVSSFNVASQLPLLQRLNNLVLELDNMSKLAEKCNIQ  72

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDAFKGLR+HLL+ELE+AFPDEVE
Sbjct  73   VPMEVLNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDAFKGLRRHLLEELEQAFPDEVE  132

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA SAAE K+ AQAQ+ LPNGDVKVK E+
Sbjct  133  AYRDIRAGSAAELKRFAQAQSMLPNGDVKVKSEI  166



>ref|XP_002303692.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
 gb|EEE78671.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
Length=185

 Score =   262 bits (670),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI SIQKTLG LHQLYLTVSSFN ASQLP LQR+N LV ELDN+ KL+E+C+IQ
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMVKLSERCNIQ  91

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTR V+NSCI KNQ+TKGKTD FK LRKHLL+ELE+ FPDEVE
Sbjct  92   VPMEVLNLIDDGKNPDEFTRGVINSCITKNQVTKGKTDGFKSLRKHLLEELEQTFPDEVE  151

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +YR  RA SAAEAK+LAQ+Q++LPNGDVKVKPE
Sbjct  152  SYREIRAMSAAEAKRLAQSQSSLPNGDVKVKPE  184



>gb|EYU33473.1| hypothetical protein MIMGU_mgv1a013913mg [Erythranthe guttata]
Length=206

 Score =   263 bits (672),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NL QV +SIQKTLG+LHQLYLTVSSFN ASQLP LQRMN LVLELDN+ +LA+KC+IQ
Sbjct  53   KENLTQVTNSIQKTLGILHQLYLTVSSFNVASQLPLLQRMNNLVLELDNMTRLADKCNIQ  112

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL LIDDGKNPDEFTRD+LN CIAKNQITKGKTDAFKG+R+HLL+EL++AFPDEVE
Sbjct  113  VPMEVLQLIDDGKNPDEFTRDMLNGCIAKNQITKGKTDAFKGMRRHLLEELDQAFPDEVE  172

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RA SAAE+KQ AQAQ+ LPNGDVKVK E
Sbjct  173  AYREIRAASAAESKQFAQAQSILPNGDVKVKKE  205



>gb|EPS62420.1| hypothetical protein M569_12371 [Genlisea aurea]
Length=199

 Score =   262 bits (670),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSS+N ASQLP LQRMN LVLELD+++KLAEKC+IQ
Sbjct  44   KQNLNQVINSIQKTLGILHQLYLTVSSYNVASQLPLLQRMNNLVLELDSMSKLAEKCNIQ  103

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EVL+LIDDGKNPDEFTRD+LN CI KNQITKGKTD+FK LR+HLL+ELE+AFPDEVE
Sbjct  104  VPIEVLNLIDDGKNPDEFTRDMLNGCITKNQITKGKTDSFKSLRRHLLEELEQAFPDEVE  163

Query  218  AYRMSRATSAAEAKQLAQAQN--ALPNGDVKVKPE  120
            AYR  RATSAAEAK+ AQAQ+   +PNGDVKVKPE
Sbjct  164  AYREIRATSAAEAKRSAQAQSMMMMPNGDVKVKPE  198



>ref|XP_010251657.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Nelumbo nucifera]
Length=181

 Score =   262 bits (669),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NA+V ELD + KLAE C+IQ
Sbjct  28   KQNLNQVINSIQKTLGLLHQLYLTVSSFNLASQLPLLQRLNAVVSELDTMQKLAENCNIQ  87

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDV+N CIA+NQITKGKTDAFK LRKHLL+ELE+AFP+EVE
Sbjct  88   VPMEVVNLIDDGKNPDEFTRDVINGCIARNQITKGKTDAFKSLRKHLLEELEQAFPEEVE  147

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAE+K+LAQAQ+ LPNGDVKVK E
Sbjct  148  AYREIRATSAAESKRLAQAQSILPNGDVKVKTE  180



>ref|XP_009608620.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X3 [Nicotiana tomentosiformis]
Length=193

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+ELE+AFP+EVE
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLEELEQAFPEEVE  162

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKV  129
            AYR  RA SAAEAK+LAQAQ+ LPNGDVK+
Sbjct  163  AYREIRAASAAEAKRLAQAQSLLPNGDVKL  192



>ref|XP_008448559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Cucumis melo]
 ref|XP_008448560.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Cucumis melo]
 ref|XP_008448561.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Cucumis melo]
Length=189

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  36   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+ELE+ FPDEVE
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEELEQTFPDEVE  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAEAK++AQAQ+ LPNGD+KVK E+
Sbjct  156  SYREIRAASAAEAKRIAQAQSMLPNGDMKVKMEV  189



>ref|XP_004146135.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Cucumis sativus]
Length=189

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  36   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+ELE+ FPDEVE
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEELEQTFPDEVE  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAEAK++AQAQ+ LPNGD+KVK E+
Sbjct  156  SYREIRAASAAEAKRIAQAQSMLPNGDMKVKMEV  189



>ref|NP_001150529.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 gb|ACG32758.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 gb|ACG39422.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 tpg|DAA40594.1| TPA: mediator complex subunit 10 CG5057-PA [Zea mays]
Length=190

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  37   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCI KNQITKGKTDAFKGLRKHLL+ELE+AFP++VE
Sbjct  97   VPMEVVNLIDDGKNPDEFTRDVLNSCIVKNQITKGKTDAFKGLRKHLLEELEQAFPEDVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAEAK+LAQ+Q  LPNGDVKVK E
Sbjct  157  AYREIRATSAAEAKRLAQSQGTLPNGDVKVKAE  189



>ref|XP_002460557.1| hypothetical protein SORBIDRAFT_02g030650 [Sorghum bicolor]
 gb|EER97078.1| hypothetical protein SORBIDRAFT_02g030650 [Sorghum bicolor]
Length=188

 Score =   259 bits (662),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  35   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  94

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELE+AFP++VE
Sbjct  95   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVE  154

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAEAK+LAQ+Q  LPNGDVKVK E
Sbjct  155  AYREIRATSAAEAKRLAQSQGTLPNGDVKVKAE  187



>ref|XP_007209640.1| hypothetical protein PRUPE_ppa011942mg [Prunus persica]
 gb|EMJ10839.1| hypothetical protein PRUPE_ppa011942mg [Prunus persica]
Length=190

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLN+V +SIQK LG++HQLYLT+SSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNEVNNSIQKILGLIHQLYLTISSFNAASQLPLLQRLNALVIELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+ELE+ FPDEVE
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEELEQTFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +YR  RA SA+E K+LAQAQ+ L NGD+KVKPE
Sbjct  157  SYREIRAASASETKRLAQAQSILQNGDMKVKPE  189



>ref|XP_004957432.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Setaria italica]
Length=188

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  35   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  94

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELE+AFP++VE
Sbjct  95   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVE  154

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
             YR  RATSAAEAK+LAQ+Q++LPNGDVKVK E
Sbjct  155  QYREIRATSAAEAKRLAQSQSSLPNGDVKVKAE  187



>gb|KGN55669.1| Nut2 [Cucumis sativus]
Length=249

 Score =   259 bits (663),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  96   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  155

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+ELE+ FPDEVE
Sbjct  156  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEELEQTFPDEVE  215

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            +YR  RA SAAEAK++AQAQ+ LPNGD+KVK E+
Sbjct  216  SYREIRAASAAEAKRIAQAQSMLPNGDMKVKMEV  249



>ref|XP_010931382.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Elaeis guineensis]
Length=203

 Score =   258 bits (658),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNL QVI+S+ KTLG+LHQLYLTVSSF+AASQLP LQR+NALV ELD + KLAE CDIQV
Sbjct  51   QNLKQVINSVDKTLGLLHQLYLTVSSFSAASQLPLLQRLNALVAELDTMQKLAENCDIQV  110

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRK+LL+ELE+AFPDEVE 
Sbjct  111  PMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKYLLEELEQAFPDEVEN  170

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            YR  RA+SAAE+K+LAQ+Q+ LPNGDVKVK E
Sbjct  171  YREIRASSAAESKRLAQSQSVLPNGDVKVKTE  202



>ref|XP_008239229.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Prunus mume]
Length=190

 Score =   257 bits (656),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLN V +SIQK LG++HQLYLTVSSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNDVNNSIQKILGLIHQLYLTVSSFNAASQLPLLQRLNALVIELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+ELE+ FPDEVE
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDIFKSLRKHLLEELEQTFPDEVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +YR  RA SA+E K+LAQAQ+ L NGD+KVKPE
Sbjct  157  SYREIRAASASETKRLAQAQSILQNGDMKVKPE  189



>emb|CDM85480.1| unnamed protein product [Triticum aestivum]
Length=195

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  42   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  101

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELEEAFPD+VE
Sbjct  102  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPDDVE  161

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAE+K+LAQ+Q+ALPNGD KVKPE
Sbjct  162  AYRQIRATSAAESKRLAQSQSALPNGDAKVKPE  194



>ref|XP_006415945.1| hypothetical protein EUTSA_v10008848mg [Eutrema salsugineum]
 gb|ESQ34298.1| hypothetical protein EUTSA_v10008848mg [Eutrema salsugineum]
Length=191

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LVLELD++AKL+EKC+IQ
Sbjct  38   KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVLELDSMAKLSEKCNIQ  97

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEVLSLIDDGKNPDEFTRDVLNSCIA+NQ+TKGKTDAFK LRKH+L+ELE+ FPDEV+
Sbjct  98   IPMEVLSLIDDGKNPDEFTRDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQTFPDEVD  157

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA+SAAEAK+LAQ+Q  LPNGD KVK E+
Sbjct  158  KYREIRASSAAEAKRLAQSQTVLPNGDAKVKSEL  191



>ref|XP_010676908.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010676909.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Beta vulgaris subsp. vulgaris]
Length=193

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL+ V +SI KTLG+LHQLYLTVSSFN ASQLP LQR+N+LV+ELDN+ KL+ KC+IQ
Sbjct  40   KQNLSDVTNSIDKTLGLLHQLYLTVSSFNVASQLPLLQRINSLVMELDNMMKLSSKCNIQ  99

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEVL+LIDDGKNPDEFT+DVLNSCIAKNQITKGK DAFK LRKHLL+ELE+AFP EVE
Sbjct  100  IPMEVLNLIDDGKNPDEFTKDVLNSCIAKNQITKGKADAFKSLRKHLLEELEQAFPSEVE  159

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            AYR  RA+SAAE K++AQAQ+ALPNGDVKVK E+
Sbjct  160  AYRDIRASSAAEMKRMAQAQSALPNGDVKVKSEL  193



>emb|CDM85486.1| unnamed protein product [Triticum aestivum]
Length=193

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  40   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDAMQKLADGCNIQ  99

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELEEAFPD+VE
Sbjct  100  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPDDVE  159

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAE+K+LAQ+Q+ALPNGD KVKPE
Sbjct  160  AYRQIRATSAAESKRLAQSQSALPNGDAKVKPE  192



>ref|XP_009398711.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Musa acuminata subsp. malaccensis]
Length=202

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QVI+S+ KTLG+LHQLYLTVSSF+ ASQLP LQR+NALV ELD + K+A+KC+IQ
Sbjct  49   KQNLTQVINSVDKTLGLLHQLYLTVSSFSVASQLPLLQRLNALVAELDAMQKMADKCNIQ  108

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDV+NSCIAKNQITKGKTDAFK LRKHLL+EL++AFPDEVE
Sbjct  109  VPMEVVNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDAFKSLRKHLLEELDQAFPDEVE  168

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
             YR  RA+SAAE+K+LAQ+Q+ALPNGDVKVK E
Sbjct  169  TYREIRASSAAESKRLAQSQSALPNGDVKVKQE  201



>ref|XP_006660876.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Oryza brachyantha]
Length=189

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV +SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  36   KQNLAQVTASIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLL+ELE+AFP++VE
Sbjct  96   VPMEVVNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVE  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAE+K+LAQ+Q+ LPNGDVKVKPE
Sbjct  156  AYREIRATSAAESKRLAQSQSTLPNGDVKVKPE  188



>ref|XP_010089858.1| Mediator of RNA polymerase II transcription subunit 10 [Morus 
notabilis]
 gb|EXB38474.1| Mediator of RNA polymerase II transcription subunit 10 [Morus 
notabilis]
Length=209

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 138/150 (92%), Gaps = 1/150 (1%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+S QK LG+LHQLYLTVSSFNAASQLP LQR+N+LVLELDN+ KL+EKC+IQ
Sbjct  38   KQNLNQVINSTQKNLGLLHQLYLTVSSFNAASQLPLLQRLNSLVLELDNMVKLSEKCNIQ  97

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDV+NSCI+KNQITKGKTDAFKGLRKHLL+ELE+ FPDEVE
Sbjct  98   VPMEVLNLIDDGKNPDEFTRDVINSCISKNQITKGKTDAFKGLRKHLLEELEQTFPDEVE  157

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKV  129
            +YR  RA SAAE K+  QAQ+ +PNGD+KV
Sbjct  158  SYREIRAASAAELKR-QQAQSMMPNGDMKV  186



>ref|XP_004488501.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Cicer arietinum]
Length=186

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNLNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFTRD++N+CIAKNQITKGKTDA K LRKHLL+ELE+ FPDEVE+
Sbjct  94   PMEVVNLIDDGKNPDEFTRDIINNCIAKNQITKGKTDALKNLRKHLLEELEQNFPDEVES  153

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R SRA SAAE K+LAQAQ+ LPNGDV+VK E
Sbjct  154  FRESRAASAAELKRLAQAQSVLPNGDVRVKSE  185



>tpg|DAA62423.1| TPA: mediator complex subunit 10 CG5057-PA isoform 1 [Zea mays]
 tpg|DAA62424.1| TPA: mediator complex subunit 10 CG5057-PA isoform 2 [Zea mays]
Length=187

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  34   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  93

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELE+AFP++VE
Sbjct  94   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVE  153

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAEAK+LAQ+   L NGDVKVK E
Sbjct  154  AYREIRATSAAEAKRLAQSHGNLLNGDVKVKAE  186



>ref|XP_004504338.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Cicer arietinum]
Length=186

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNLNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFTRD++N+CIAKNQITKGKTDA K  RKHLL+ELE+ FPDEVE+
Sbjct  94   PMEVVNLIDDGKNPDEFTRDIINNCIAKNQITKGKTDALKNFRKHLLEELEQNFPDEVES  153

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R SRA SAAE K+LAQAQ+ LPNGDV+VK E
Sbjct  154  FRESRAASAAELKRLAQAQSVLPNGDVRVKSE  185



>ref|NP_001150327.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 gb|ACG38665.1| mediator complex subunit 10 CG5057-PA [Zea mays]
Length=187

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV  LD + KLAE C+IQ
Sbjct  34   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAXLDTMQKLAEGCNIQ  93

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELE+AFP++VE
Sbjct  94   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVE  153

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAEAK+LAQ+   L NGDVKVK E
Sbjct  154  AYREIRATSAAEAKRLAQSHGNLLNGDVKVKAE  186



>ref|XP_009103104.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Brassica rapa]
Length=190

 Score =   250 bits (638),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LV EL+++ KL+EKC+IQ
Sbjct  37   KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVLSLIDDGKNPDEFTRDV+NSC+A+NQ+TKGKTDAFK LRKH+L+ELEE FPDEV+
Sbjct  97   VPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEELEETFPDEVD  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA SAAEAK++AQ+Q+ LPNGD KVK E+
Sbjct  157  KYREIRAASAAEAKRVAQSQSVLPNGDAKVKSEL  190



>gb|EMS63705.1| Mediator of RNA polymerase II transcription subunit 10 [Triticum 
urartu]
Length=193

 Score =   249 bits (637),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV +SIQ+TLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  40   KQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  99

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELEEAFP+++E
Sbjct  100  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPEDIE  159

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAE+K+LAQ+QN LPNGD  VK E
Sbjct  160  AYRQIRATSAAESKRLAQSQNVLPNGDSNVKAE  192



>ref|NP_001063737.1| Os09g0528300 [Oryza sativa Japonica Group]
 dbj|BAF25651.1| Os09g0528300 [Oryza sativa Japonica Group]
 gb|EAZ09832.1| hypothetical protein OsI_32122 [Oryza sativa Indica Group]
 gb|EAZ45438.1| hypothetical protein OsJ_30088 [Oryza sativa Japonica Group]
 dbj|BAH00329.1| unnamed protein product [Oryza sativa Japonica Group]
Length=190

 Score =   249 bits (636),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL  +++SIQ+TLG+LHQL L VSSF++ASQLP LQR+N+LV ELD + K AE C+IQ
Sbjct  37   KQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+ELE+AFP++VE
Sbjct  97   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVE  156

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RAT+AAE+KQLAQ+Q+ALPNGDVKVKPE
Sbjct  157  AYREIRATAAAESKQLAQSQSALPNGDVKVKPE  189



>gb|KCW82860.1| hypothetical protein EUGRSUZ_C04229 [Eucalyptus grandis]
Length=181

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQ+LNQVI+SIQKTLG+LHQLYL VSSFN   QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  28   KQDLNQVINSIQKTLGLLHQLYLNVSSFNTGLQLPLLQRINSLVLELDNMVKLSEKCHIQ  87

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EVL+LIDDGKNPD FT+D++N CIAKNQITKGKTD+FKGLRKHLL+EL++AFPDE +
Sbjct  88   VPVEVLNLIDDGKNPDGFTKDIINGCIAKNQITKGKTDSFKGLRKHLLEELDQAFPDEAD  147

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            ++R  RA SAAEAK+LAQAQ++LPNGD+KVK E
Sbjct  148  SFREIRAASAAEAKRLAQAQSSLPNGDMKVKAE  180



>ref|XP_010050022.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Eucalyptus grandis]
 gb|KCW82859.1| hypothetical protein EUGRSUZ_C04229 [Eucalyptus grandis]
Length=188

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQ+LNQVI+SIQKTLG+LHQLYL VSSFN   QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  35   KQDLNQVINSIQKTLGLLHQLYLNVSSFNTGLQLPLLQRINSLVLELDNMVKLSEKCHIQ  94

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EVL+LIDDGKNPD FT+D++N CIAKNQITKGKTD+FKGLRKHLL+EL++AFPDE +
Sbjct  95   VPVEVLNLIDDGKNPDGFTKDIINGCIAKNQITKGKTDSFKGLRKHLLEELDQAFPDEAD  154

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            ++R  RA SAAEAK+LAQAQ++LPNGD+KVK E
Sbjct  155  SFREIRAASAAEAKRLAQAQSSLPNGDMKVKAE  187



>ref|XP_008788520.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Phoenix dactylifera]
Length=207

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            +NL QVI+SI KTLG+LHQLYLTVSSF+ ASQLP LQR+NALV ELD + KLAE CDIQV
Sbjct  55   KNLKQVINSIDKTLGLLHQLYLTVSSFSVASQLPLLQRLNALVAELDTMQKLAENCDIQV  114

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            P EV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRK+LL+ELE+AFPDEVE 
Sbjct  115  PAEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKYLLEELEQAFPDEVEN  174

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            YR  R +SAAE+K+LAQ+Q+ LPNGDVKVK E
Sbjct  175  YREIRTSSAAESKRLAQSQSTLPNGDVKVKAE  206



>dbj|BAK04300.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV +SIQ+TLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  38   KQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  97

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELEEAFP+++E
Sbjct  98   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPEDIE  157

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            AYR  RATSAAE+K+LAQ+Q+ LPNGD KVK E
Sbjct  158  AYRQIRATSAAESKRLAQSQSVLPNGDSKVKAE  190



>ref|XP_011070384.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Sesamum indicum]
Length=206

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QVI+SIQKTLG+LHQLYLTVSS+N ASQLP LQR+N LVLELDN+ +LAEKC+IQ
Sbjct  53   KQNLTQVINSIQKTLGLLHQLYLTVSSYNVASQLPLLQRLNNLVLELDNMTRLAEKCNIQ  112

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKG+R+HLL+ELE+AFPDEVE
Sbjct  113  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGMRRHLLEELEQAFPDEVE  172

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
             YR  RA SAAEAK+ AQAQ+ LPNGDVKVK E
Sbjct  173  TYREIRAASAAEAKRAAQAQSMLPNGDVKVKTE  205



>ref|NP_564254.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
 gb|AAK49628.1|AF372912_1 At1g26660/T24P13_4 [Arabidopsis thaliana]
 gb|AAL15363.1| At1g26660/T24P13_4 [Arabidopsis thaliana]
 gb|AEE30718.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
Length=189

 Score =   247 bits (630),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  36   KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+ELE+ FPDEV+
Sbjct  96   IPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQNFPDEVD  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA+SAAEAK+LAQ+Q+ LPNGD KVK E+
Sbjct  156  MYREIRASSAAEAKRLAQSQSVLPNGDAKVKNEL  189



>ref|XP_008788119.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Phoenix dactylifera]
Length=204

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNL QVI S+ KTLG+LHQLYLTVSSF+  SQLP LQR+NALV +LD + KLAE CDIQV
Sbjct  52   QNLKQVIHSVDKTLGLLHQLYLTVSSFSVVSQLPLLQRLNALVADLDTMQKLAENCDIQV  111

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFTRDVLN+CIAKNQ TKGKTDAFK LRK+LL+ELE+AFPDEVE 
Sbjct  112  PMEVVNLIDDGKNPDEFTRDVLNNCIAKNQSTKGKTDAFKSLRKYLLEELEQAFPDEVEN  171

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            YR  RA+SAAE+K++AQ+Q+ LPNGDVKVK E
Sbjct  172  YREIRASSAAESKRMAQSQSVLPNGDVKVKTE  203



>emb|CDY20567.1| BnaC07g12340D [Brassica napus]
Length=248

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LV EL+++ KL+EKC+IQ
Sbjct  95   KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQ  154

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVLSLIDDGKNPDEFTRDV+NSC+A+NQ+TKGKTDAFK LRKH+L+ELEE FPDEV+
Sbjct  155  VPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEELEETFPDEVD  214

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA SAAEAK+  Q+Q+ LPNGD KVK E+
Sbjct  215  KYREIRAASAAEAKRQVQSQSVLPNGDAKVKSEL  248



>ref|NP_973916.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
 sp|F4HPA7.1|MD10B_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
10b [Arabidopsis thaliana]
 gb|AEE30717.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
Length=189

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  36   KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+ELE+ FPDEV+
Sbjct  96   IPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQNFPDEVD  155

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA+SAA  K+LAQ+Q+ LPNGD KVK E+
Sbjct  156  MYREIRASSAAVTKRLAQSQSVLPNGDAKVKNEL  189



>gb|KJB51998.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
 gb|KJB52000.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
Length=169

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLN CIAKNQ+TKGKTDAFKGLRKHLL+ELE+AFPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNGCIAKNQVTKGKTDAFKGLRKHLLEELEQAFPDEVE  156

Query  218  AYRMSRATSAA  186
            +YR  RA++AA
Sbjct  157  SYREIRASAAA  167



>ref|NP_001241316.1| uncharacterized protein LOC100806084 [Glycine max]
 ref|XP_006601827.1| PREDICTED: uncharacterized protein LOC100806084 isoform X1 [Glycine 
max]
 ref|XP_006601828.1| PREDICTED: uncharacterized protein LOC100806084 isoform X2 [Glycine 
max]
 gb|ACU23358.1| unknown [Glycine max]
 gb|KHN30521.1| Mediator of RNA polymerase II transcription subunit 10 [Glycine 
soja]
Length=190

 Score =   242 bits (617),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  99

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+NSCIAKNQITKGKTDA K LRKHLL+ELE+ FPDEVE 
Sbjct  100  PMEVVNLIDDGKNPDEFTKDVINSCIAKNQITKGKTDALKSLRKHLLEELEQNFPDEVET  159

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R SR  +AAE K+  QAQ+ALPNGDV+VK E
Sbjct  160  FRESRTAAAAELKR--QAQSALPNGDVRVKSE  189



>gb|EMT06746.1| Mediator of RNA polymerase II transcription subunit 10 [Aegilops 
tauschii]
Length=241

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  38   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  97

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELEEAFPD+ E
Sbjct  98   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPDDAE  157

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVK  132
            AYR  RATSAA +K+LAQ+Q+ALPNGD K
Sbjct  158  AYRQIRATSAAGSKRLAQSQSALPNGDAK  186



>ref|XP_007039391.1| Mediator complex, subunit Med10 isoform 3, partial [Theobroma 
cacao]
 gb|EOY23892.1| Mediator complex, subunit Med10 isoform 3, partial [Theobroma 
cacao]
Length=184

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 8/148 (5%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+ELE+ FPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQTFPDEVE  156

Query  218  AYRMSRATSAA--------EAKQLAQAQ  159
            +YR  RA+SAA        E K+LAQ+Q
Sbjct  157  SYREIRASSAALKALGTMQECKRLAQSQ  184



>ref|XP_010922762.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Elaeis guineensis]
Length=206

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            +NL QVI+S+  TLG+LHQLYLTVSSF+ ASQLP +QR+NALV ELD + KLAE CDIQV
Sbjct  54   KNLQQVINSVDMTLGLLHQLYLTVSSFSVASQLPLIQRLNALVAELDTMQKLAENCDIQV  113

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRK+LL+E+++AFP EVE 
Sbjct  114  PMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKYLLEEIKQAFPHEVEN  173

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            YR  RA+SAAE+K+L Q+Q+ LP+GDVKVK E
Sbjct  174  YREIRASSAAESKRLTQSQSGLPDGDVKVKTE  205



>ref|XP_006586008.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X6 [Glycine max]
Length=165

 Score =   239 bits (610),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  13   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  72

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+NSCI KNQITKGKTDA K LRKHLL+ELE  FPDEVE 
Sbjct  73   PMEVVNLIDDGKNPDEFTKDVINSCIVKNQITKGKTDALKSLRKHLLEELEHNFPDEVET  132

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R SRA +AAE K+ AQAQ+ALPNGDV+VK E
Sbjct  133  FRESRAAAAAELKRQAQAQSALPNGDVRVKSE  164



>ref|XP_007153845.1| hypothetical protein PHAVU_003G069600g [Phaseolus vulgaris]
 gb|ESW25839.1| hypothetical protein PHAVU_003G069600g [Phaseolus vulgaris]
Length=192

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV+ELDN+ KLAEK +IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVVELDNMVKLAEKSNIQV  99

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+NSCIAKNQITKGKTDA K LRKHLL+ELE+ FPDEVE 
Sbjct  100  PMEVVNLIDDGKNPDEFTKDVINSCIAKNQITKGKTDALKNLRKHLLEELEQNFPDEVET  159

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R SRA +AAE K+ AQAQ+ALPNGDV+VK E
Sbjct  160  FRESRAAAAAELKRQAQAQSALPNGDVRVKSE  191



>ref|XP_010499011.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Camelina sativa]
Length=195

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+SI   L +LHQ++LT+ SF  ASQLP LQR+N LVLELDN+AKL+EKC IQ
Sbjct  42   KENLNQVINSIHNILTLLHQIHLTIGSFTPASQLPLLQRLNTLVLELDNMAKLSEKCSIQ  101

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEV++L+D+GKNPD++T+DVLN CIA+NQ+TKGKTDAFK LRKH+L+ELEE FPDEVE
Sbjct  102  IPMEVINLVDNGKNPDDYTKDVLNGCIARNQVTKGKTDAFKDLRKHILEELEETFPDEVE  161

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR +RA SAAEAK++AQ+Q+ LPNGD KVK E+
Sbjct  162  MYRETRANSAAEAKRVAQSQSVLPNGDAKVKNEL  195



>ref|XP_006586003.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Glycine max]
 ref|XP_006586004.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Glycine max]
 ref|XP_006586005.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X3 [Glycine max]
 ref|XP_006586006.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X4 [Glycine max]
 ref|XP_006586007.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X5 [Glycine max]
 gb|KHN13486.1| Mediator of RNA polymerase II transcription subunit 10 [Glycine 
soja]
Length=192

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  99

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+NSCI KNQITKGKTDA K LRKHLL+ELE  FPDEVE 
Sbjct  100  PMEVVNLIDDGKNPDEFTKDVINSCIVKNQITKGKTDALKSLRKHLLEELEHNFPDEVET  159

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R SRA +AAE K+ AQAQ+ALPNGDV+VK E
Sbjct  160  FRESRAAAAAELKRQAQAQSALPNGDVRVKSE  191



>emb|CDY40258.1| BnaA07g09420D [Brassica napus]
Length=515

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LV EL+++ KL+EKC+IQ
Sbjct  362  KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQ  421

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVLSLIDDGKNPDEFTRDV+NSC+A+NQ+TKGKTDAFK LRKH+L+ELEE FPDEV+
Sbjct  422  VPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEELEETFPDEVD  481

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA SAAEAK++AQ+Q+ LPNGD KVK E+
Sbjct  482  KYREIRAASAAEAKRVAQSQSVLPNGDAKVKSEL  515



>ref|XP_006849160.1| hypothetical protein AMTR_s00027p00143800 [Amborella trichopoda]
 gb|ERN10741.1| hypothetical protein AMTR_s00027p00143800 [Amborella trichopoda]
Length=175

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K NLN VI+SI KTLG+LHQL+LTVSSF+ +SQLP L+R+NA+V ELD + +LA+ C+IQ
Sbjct  22   KHNLNNVINSIDKTLGLLHQLHLTVSSFSVSSQLPLLERLNAVVTELDTMQRLADSCNIQ  81

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEV++LIDDGKNPDEFTRDV N+CIAKNQITKGKT+ FK LRKHLL+ELE+AFPDEV+
Sbjct  82   IPMEVVNLIDDGKNPDEFTRDVFNNCIAKNQITKGKTEVFKSLRKHLLEELEQAFPDEVD  141

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
             YR  RATSAAE K+  QAQ+ LPNGD+KVK E
Sbjct  142  TYREIRATSAAELKRQTQAQSILPNGDMKVKTE  174



>ref|XP_007039392.1| Mediator complex, subunit Med10 isoform 4, partial [Theobroma 
cacao]
 gb|EOY23893.1| Mediator complex, subunit Med10 isoform 4, partial [Theobroma 
cacao]
Length=177

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+ELE+ FPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQTFPDEVE  156

Query  218  AYRMSRATSAAEAKQLA  168
            +YR  RA+SAA   +L+
Sbjct  157  SYREIRASSAAIEAELS  173



>ref|XP_002868569.1| hypothetical protein ARALYDRAFT_493793 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44828.1| hypothetical protein ARALYDRAFT_493793 [Arabidopsis lyrata subsp. 
lyrata]
Length=178

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+S QKTL +LHQL LTVSSF  ASQL  LQR+N LV+ELDN+A+ ++KC+IQ
Sbjct  24   KENLNQVINSNQKTLVLLHQLKLTVSSFTPASQLDLLQRLNCLVMELDNMAQFSDKCNIQ  83

Query  398  VPMEVLSLIDDGKNPDEFTRDVL-NSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEV  222
            VPMEVL+LIDDGKNPDEFT++VL NSCIA+NQ+TKGKTDAFKGLRKHLL+ELE+ FPDEV
Sbjct  84   VPMEVLNLIDDGKNPDEFTKNVLNNSCIARNQVTKGKTDAFKGLRKHLLEELEQTFPDEV  143

Query  221  EAYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            + YR  RA+ AAEAK+LAQ+Q+ LPNGD KVK E+
Sbjct  144  DTYREIRASYAAEAKRLAQSQSVLPNGDPKVKSEL  178



>ref|XP_007039390.1| Mediator complex, subunit Med10 isoform 2 [Theobroma cacao]
 gb|EOY23891.1| Mediator complex, subunit Med10 isoform 2 [Theobroma cacao]
Length=189

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+ELE+ FPDEVE
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQTFPDEVE  156

Query  218  AYRMSRATSAA  186
            +YR  RA+SAA
Sbjct  157  SYREIRASSAA  167



>gb|AGV54170.1| mediator of RNA polymerase II transcription subunit [Phaseolus 
vulgaris]
Length=192

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV+ELDN+ KLAEK +IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVVELDNMVKLAEKSNIQV  99

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEF++DV+NSCIAKNQI KGKTDA K LRKHLL+ELE+ FPDEVE 
Sbjct  100  PMEVVNLIDDGKNPDEFSKDVINSCIAKNQIPKGKTDALKNLRKHLLEELEQNFPDEVET  159

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R SRA +AAE K+ AQAQ+ALPNGDV+VK E
Sbjct  160  FRESRAAAAAELKRQAQAQSALPNGDVRVKSE  191



>gb|KDP25204.1| hypothetical protein JCGZ_20360 [Jatropha curcas]
Length=188

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QVI+SIQ+TL  LH LYLTVS+FNAASQLP L+R+N LV+ELDNL KL++K +IQ
Sbjct  35   KQNLIQVINSIQRTLAFLHHLYLTVSTFNAASQLPLLRRLNVLVMELDNLIKLSDKLNIQ  94

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP EVLS IDDGKNPD+FTRDV+N+CI+ NQ TKG+ DAFK LR HLL+ELE+AFP+EVE
Sbjct  95   VPTEVLSYIDDGKNPDDFTRDVINNCISTNQATKGQADAFKSLRSHLLEELEQAFPEEVE  154

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA SAAE+KQLA+AQ++LPNGDVKV  E+
Sbjct  155  HYREIRAISAAESKQLAEAQSSLPNGDVKVNSEL  188



>gb|KDO76724.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
Length=212

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLLDELE+ FPDEVE
Sbjct  93   VPTEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLDELEQTFPDEVE  152

Query  218  AYRMSRATSAA  186
            AYR  RA SAA
Sbjct  153  AYREIRANSAA  163



>ref|NP_199006.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
 sp|Q9FHZ2.1|MD10A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
10a [Arabidopsis thaliana]
 dbj|BAB08424.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO22665.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42425.1| unknown protein [Arabidopsis thaliana]
 gb|AED94743.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
Length=186

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            + LNQ+I+S QK L +LHQL LTVSSF  ASQL  LQR+N+LV+ELDN+AKL++KC+IQV
Sbjct  33   EKLNQIINSNQKILELLHQLKLTVSSFTPASQLHLLQRLNSLVMELDNMAKLSDKCNIQV  92

Query  395  PMEVLSLIDDGKNPDEFTRDVLN-SCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            P+EVL+LIDDGKNPDEFT+DVLN +CIAKNQ+TKGK+DAFKGLRKHLL+ELE+AFPDEV+
Sbjct  93   PIEVLNLIDDGKNPDEFTKDVLNKNCIAKNQVTKGKSDAFKGLRKHLLEELEQAFPDEVD  152

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA+ AAEAK+LAQ Q+ LPNGD KVK E+
Sbjct  153  RYRDIRASYAAEAKRLAQTQSVLPNGDAKVKSEL  186



>ref|XP_010238414.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 10b-like [Brachypodium distachyon]
Length=187

 Score =   231 bits (589),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  39   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  98

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELE+AFP++VE
Sbjct  99   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVE  158

Query  218  AYRMSRATSAAEAKQLAQAQNALP  147
            AYR  RATSAA++K+LAQ+Q+  P
Sbjct  159  AYRQIRATSAADSKRLAQSQSLCP  182



>dbj|BAJ94367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV +SIQ+TLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  38   KQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  97

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+ELEEAFP+++E
Sbjct  98   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPEDIE  157

Query  218  AYRMSRATSAAEAKQLAQAQN  156
            AYR  RATSAAE+K+LAQ+Q+
Sbjct  158  AYRQIRATSAAESKRLAQSQS  178



>ref|XP_004170927.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like, partial [Cucumis sativus]
Length=166

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  36   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  95

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+ELE+ FPDEVE
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEELEQTFPDEVE  155

Query  218  AYRMSRATSAA  186
            +YR  RA SAA
Sbjct  156  SYREIRAASAA  166



>ref|XP_011022415.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Populus euphratica]
Length=179

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI SIQKTLG LHQLYLTVSSFN ASQLP LQR+N LV ELDN+AKL+E+C+IQ
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMAKLSERCNIQ  91

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFTR V+NSCIAKNQ+TKGKTDAFK LRKHLL+ELE+ FPDEVE
Sbjct  92   VPMEVLNLIDDGKNPDEFTRGVMNSCIAKNQVTKGKTDAFKSLRKHLLEELEQTFPDEVE  151

Query  218  AYRMSRATSAA  186
            +YR  RA SAA
Sbjct  152  SYREIRAMSAA  162



>gb|AFK42425.1| unknown [Lotus japonicus]
Length=191

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P L+R+N LV ELDN+ KLAEKC+I V
Sbjct  39   QELNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLERINGLVEELDNMVKLAEKCNIHV  98

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTD  K LRK LL ELE+ FPDEVE 
Sbjct  99   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDGLKNLRKQLLGELEQNFPDEVET  158

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            YR +RA +AAE K++AQAQN L NGD +VK E
Sbjct  159  YRETRAAAAAELKRMAQAQNVLSNGDARVKSE  190



>ref|XP_003629699.1| Mediator of RNA polymerase II transcription subunit [Medicago 
truncatula]
Length=154

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNL+Q+ +SI+KTLG++HQL LTVS+FN+A Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  2    QNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVAELDNMVKLAEKCNIQV  61

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDA K LRKHLL+ELE+ FPDEVE 
Sbjct  62   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEELEQNFPDEVET  121

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R +RA +AAE K+LAQA + LPNGD + K E
Sbjct  122  FRENRAAAAAELKRLAQAPSVLPNGDARAKVE  153



>ref|XP_003629698.1| Mediator of RNA polymerase II transcription subunit [Medicago 
truncatula]
 gb|AET04174.1| mediator of RNA polymerase II transcription subunit 10 [Medicago 
truncatula]
Length=186

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNL+Q+ +SI+KTLG++HQL LTVS+FN+A Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDA K LRKHLL+ELE+ FPDEVE 
Sbjct  94   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEELEQNFPDEVET  153

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R +RA +AAE K+LAQA + LPNGD + K E
Sbjct  154  FRENRAAAAAELKRLAQAPSVLPNGDARAKVE  185



>gb|AFK33660.1| unknown [Medicago truncatula]
Length=186

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNL+Q+ +SI+KTLG++HQL LTVS+FN+A Q+P LQR+N LV+ELDN+ KLAEKC+IQV
Sbjct  34   QNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVVELDNMVKLAEKCNIQV  93

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDA K LRKHLL+ELE+ FPDEVE 
Sbjct  94   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEELEQNFPDEVET  153

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            +R +RA +AAE K+LAQA + LPNG  + K E
Sbjct  154  FRENRAAAAAELKRLAQAPSVLPNGGARAKVE  185



>ref|XP_004504337.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Cicer arietinum]
Length=189

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNLNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFTRD++N+CIAKNQITKGKTDA K  RKHLL+ELE+ FPDEVE+
Sbjct  94   PMEVVNLIDDGKNPDEFTRDIINNCIAKNQITKGKTDALKNFRKHLLEELEQNFPDEVES  153

Query  215  YRMSRATSAA  186
            +R SRA SAA
Sbjct  154  FRESRAASAA  163



>ref|XP_010477833.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Camelina sativa]
Length=196

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NLNQVI+SI K L +LHQL+LT+SSF  ASQL  LQR+N LVLELDN+AKL+EKC IQ
Sbjct  43   KENLNQVINSIDKVLTLLHQLHLTISSFTPASQLHLLQRLNNLVLELDNMAKLSEKCSIQ  102

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEV++L+DDGKNPD+FT+DV+N CIA+NQ+TKGKTDAFK LRKH+++ LEE FP+E+E
Sbjct  103  IPMEVINLVDDGKNPDDFTKDVVNGCIARNQVTKGKTDAFKDLRKHIMENLEETFPNEIE  162

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA SAAEAK++AQ+Q+ LPNGD KVK E+
Sbjct  163  MYREIRANSAAEAKRVAQSQSVLPNGDAKVKNEL  196



>ref|XP_002893389.1| T24P13.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69648.1| T24P13.4 [Arabidopsis lyrata subsp. lyrata]
Length=309

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  176  KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  235

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+ELE+ FPDEV+
Sbjct  236  VPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQTFPDEVD  295

Query  218  AYRMSRATSAA  186
             YR  RA+SAA
Sbjct  296  MYREIRASSAA  306



>gb|AAF87025.1|AC006535_3 T24P13.4 [Arabidopsis thaliana]
Length=309

 Score =   215 bits (547),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  176  KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  235

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            +PMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+ELE+ FPDEV+
Sbjct  236  IPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQNFPDEVD  295

Query  218  AYRMSRATSAA  186
             YR  RA+SAA
Sbjct  296  MYREIRASSAA  306



>ref|XP_006305653.1| hypothetical protein CARUB_v10010356mg [Capsella rubella]
 gb|EOA38551.1| hypothetical protein CARUB_v10010356mg [Capsella rubella]
Length=193

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            K+N+NQV++S +K L ++HQL LT++SF  ASQL  LQR+N LV ELDN+ KL+EKC+ Q
Sbjct  40   KENINQVVNSTEKILTLVHQLQLTLTSFTPASQLHLLQRLNLLVSELDNMDKLSEKCNFQ  99

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VPMEVL+LIDDGKNPD+F ++ LNSCIA+NQ+TKGKTDAFK LRKH+L+ELE+ FPDEV+
Sbjct  100  VPMEVLNLIDDGKNPDDFMKEALNSCIARNQVTKGKTDAFKDLRKHILEELEQTFPDEVD  159

Query  218  AYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             YR  RA SAAEAK++AQ+Q+ALPNGD KVK E+
Sbjct  160  IYREIRANSAAEAKRVAQSQSALPNGDAKVKNEL  193



>ref|XP_009115391.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Brassica rapa]
Length=180

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLP-FLQRMNALVLELDNLAKLAEKCDI  402
            K++L+QVI+SI K+L +LHQL+L++SS    S     L R+N+LV EL++++KL+EKC+I
Sbjct  26   KESLDQVINSINKSLVVLHQLHLSLSSSLTPSSQLHLLPRLNSLVSELNSISKLSEKCNI  85

Query  401  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEV  222
            Q+PMEVLSLIDDGKNPDEF RDVLNSC+A+NQ TKGKTDAFK LRKH+L+ELEE FPDEV
Sbjct  86   QIPMEVLSLIDDGKNPDEFARDVLNSCVARNQATKGKTDAFKELRKHILEELEETFPDEV  145

Query  221  EAYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            + YR  RATSAAEAK+LAQ+Q  LPNGD KVK E+
Sbjct  146  DKYREIRATSAAEAKRLAQSQTVLPNGDAKVKSEL  180



>gb|EMT18148.1| Mediator of RNA polymerase II transcription subunit 10 [Aegilops 
tauschii]
Length=148

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  458  NALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  279
            NALV ELD + KLAE C+IQVPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF
Sbjct  35   NALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  94

Query  278  KGLRKHLLDELEEAFPDEVEAYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            K LRKHLL+ELEEAFP+++EAYR  RATSAAE+K+LAQ+QN LPNGD  VK E
Sbjct  95   KSLRKHLLEELEEAFPEDIEAYRQIRATSAAESKRLAQSQNVLPNGDSNVKAE  147



>ref|XP_009766948.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Nicotiana sylvestris]
Length=183

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 5/126 (4%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQ I+SI+KTLG+LH+LYLTVSS     QL  +QR+N LVLELDN+A   EKC+IQ
Sbjct  44   KQNLNQSINSIEKTLGILHKLYLTVSS-----QLLLIQRLNNLVLELDNMATFGEKCNIQ  98

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EVL+LID+GKNPDEFTRDVLN+CI KNQITKGKTDAFKGLR+HLL+ELE+ FP+E E
Sbjct  99   VPIEVLNLIDNGKNPDEFTRDVLNNCIVKNQITKGKTDAFKGLRRHLLEELEQTFPEEAE  158

Query  218  AYRMSR  201
            AY   R
Sbjct  159  AYGEIR  164



>emb|CDY16179.1| BnaA09g29130D [Brassica napus]
Length=180

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLP-FLQRMNALVLELDNLAKLAEKCDI  402
            K++L+QVI+SI K+L +LHQL+L++SS    S     L R+N+LV EL++++KL+EKC+I
Sbjct  26   KESLDQVINSINKSLVVLHQLHLSLSSSLTPSSQLHLLPRLNSLVSELNSISKLSEKCNI  85

Query  401  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEV  222
            Q+PMEVLSLIDDGKNPDEF RDVLNSC+A+NQ TKGKTDAFK LRKH+L+ELEE FPDEV
Sbjct  86   QIPMEVLSLIDDGKNPDEFARDVLNSCVARNQATKGKTDAFKELRKHILEELEETFPDEV  145

Query  221  EAYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
            + YR  RATSAA  K+LAQ+Q  LPNGD KVK E+
Sbjct  146  DKYREIRATSAAVTKRLAQSQTVLPNGDAKVKSEL  180



>gb|KDO76725.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
 gb|KDO76726.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
Length=135

 Score =   186 bits (472),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  276
            VP EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK
Sbjct  93   VPTEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFK  133



>ref|XP_008788120.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Phoenix dactylifera]
Length=174

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 109/152 (72%), Gaps = 30/152 (20%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            QNL QVI S+ KTLG+LHQLYLTVSSF+  SQLP LQR+NALV +LD + KLAE CDIQV
Sbjct  52   QNLKQVIHSVDKTLGLLHQLYLTVSSFSVVSQLPLLQRLNALVADLDTMQKLAENCDIQV  111

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            PMEV++LIDDGKNPDEFTRDVLN+CIAKNQ TKGKTDAFK                    
Sbjct  112  PMEVVNLIDDGKNPDEFTRDVLNNCIAKNQSTKGKTDAFK--------------------  151

Query  215  YRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
                      E+K++AQ+Q+ LPNGDVKVK E
Sbjct  152  ----------ESKRMAQSQSVLPNGDVKVKTE  173



>emb|CAN83497.1| hypothetical protein VITISV_026967 [Vitis vinifera]
Length=209

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 5/154 (3%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NALV ELDN+ KL+EKC+IQ
Sbjct  44   KQNLNQVINSIQKTLGLLHQLYLTVSSFNVASQLPLLQRLNALVSELDNMTKLSEKCNIQ  103

Query  398  VPMEVLS----LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFP  231
            VPMEVL+     +    + +    DV    +    I  G  D   GLR+HLL+ELE+AFP
Sbjct  104  VPMEVLNWGLRFVRQLHDWELEEVDVFFGRLYDQSIRSGFEDTM-GLRRHLLEELEQAFP  162

Query  230  DEVEAYRMSRATSAAEAKQLAQAQNALPNGDVKV  129
            DEVE+YR  RA SAAE+K+LAQAQ+ LPNGD+K+
Sbjct  163  DEVESYREIRAASAAESKRLAQAQSVLPNGDLKI  196



>tpg|DAA40596.1| TPA: hypothetical protein ZEAMMB73_822884 [Zea mays]
Length=105

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  431  LAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  252
            + KLAE C+IQVPMEV++LIDDGKNPDEFTRDVLNSCI KNQITKGKTDAFKGLRKHLL+
Sbjct  1    MQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIVKNQITKGKTDAFKGLRKHLLE  60

Query  251  ELEEAFPDEVEAYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            ELE+AFP++VEAYR  RATSAAEAK+LAQ+Q  LPNGDVKVK E
Sbjct  61   ELEQAFPEDVEAYREIRATSAAEAKRLAQSQGTLPNGDVKVKAE  104



>ref|XP_009606753.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Nicotiana tomentosiformis]
Length=168

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQN+N+ I+SI+KTLG+LHQLYLTVSS+N +SQL  LQ +N LVLELDN+ K   KC+IQ
Sbjct  50   KQNINESINSIEKTLGILHQLYLTVSSYNVSSQLLLLQCLNNLVLELDNMVKFGGKCNIQ  109

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEV  222
            VPMEVL+LID+GKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLR+HLL+ELE+AFP+EV
Sbjct  110  VPMEVLNLIDNGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRRHLLEELEQAFPEEV  168



>gb|EMS49589.1| Mediator of RNA polymerase II transcription subunit 10 [Triticum 
urartu]
Length=175

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  61   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  120

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  276
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK
Sbjct  121  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  161



>ref|XP_010460282.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Camelina sativa]
Length=105

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  431  LAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  252
            +AKL+EKC IQ+PMEV++L+DDGKNPD+FT+DVLN CIA+NQ+TKGKTDAFK LRKH+++
Sbjct  1    MAKLSEKCSIQIPMEVINLVDDGKNPDDFTKDVLNGCIARNQVTKGKTDAFKDLRKHIME  60

Query  251  ELEEAFPDEVEAYRMSRATSAAEAKQLAQAQNALPNGDVKVKPEM  117
             LEE FPDEVE YR  RA SAAEAK++AQ+Q+ LPNGD KVK E+
Sbjct  61   NLEETFPDEVEMYREIRANSAAEAKRVAQSQSVLPNGDAKVKNEL  105



>emb|CDX85042.1| BnaC05g20130D [Brassica napus]
Length=157

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = -3

Query  464  RMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTD  285
            R+N+LV EL++++ L+EKC+IQ+P+EVLSLIDDGKNPDEFTRDVLNSCI++NQ+TKGKTD
Sbjct  44   RLNSLVSELNSMSNLSEKCNIQIPVEVLSLIDDGKNPDEFTRDVLNSCISRNQVTKGKTD  103

Query  284  AFKGLRKHLLDELEEAFPDEVEAYRMSRATS-AAEAKQLAQAQNALPNGDVKVKPEM  117
            AFK L KH+L+ELEE FPDEV+ YR  RATS AAEAK+L   Q+ L NGD KVK E+
Sbjct  104  AFKELGKHILEELEETFPDEVDKYREIRATSAAAEAKRL---QSVLTNGDAKVKSEL  157



>gb|ABK23782.1| unknown [Picea sitchensis]
 gb|ACN40738.1| unknown [Picea sitchensis]
Length=173

 Score =   169 bits (429),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = -3

Query  569  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPM  390
            L+ +  SIQK+LG+LHQ++ TVSSF A SQL  L R+N LV E++ + K A+  DIQVP+
Sbjct  23   LDPISRSIQKSLGILHQMHCTVSSFTANSQLNLLDRINYLVNEINEMQKAAQDIDIQVPL  82

Query  389  EVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            EV+ LIDDGKNPDEFT+D++N CI +NQ TKGK++AFK LRK LL+ELE+ +P+EVE YR
Sbjct  83   EVIKLIDDGKNPDEFTKDIINKCIQRNQTTKGKSEAFKNLRKQLLEELEQEYPEEVEVYR  142

Query  209  MSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
              RA SAAE K+  QAQ  LPNGD K+K E
Sbjct  143  ELRAASAAELKKQMQAQGGLPNGDAKIKTE  172



>ref|XP_006367261.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Solanum tuberosum]
Length=124

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 97/129 (75%), Gaps = 13/129 (10%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSF--NAASQLPFLQRMNALVLELDNLAKLAEKC-  408
            KQNLNQVI SI KTL +LHQL    SSF  N AS L      N LV E DN+AKL E C 
Sbjct  5    KQNLNQVIYSIDKTLEILHQL----SSFDVNVASHL------NNLVFEFDNMAKLGENCH  54

Query  407  DIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPD  228
             I+VPMEVL+LID+GKNPDEF RD+LN+CIAKNQITKGK DAFK LR HLL++LE AFPD
Sbjct  55   SIKVPMEVLNLIDNGKNPDEFARDLLNNCIAKNQITKGKVDAFKDLRGHLLEDLEHAFPD  114

Query  227  EVEAYRMSR  201
            EVE YR  R
Sbjct  115  EVEDYRQRR  123



>ref|XP_006380132.1| hypothetical protein POPTR_0008s22200g, partial [Populus trichocarpa]
 gb|ERP57929.1| hypothetical protein POPTR_0008s22200g, partial [Populus trichocarpa]
Length=141

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 89/110 (81%), Gaps = 9/110 (8%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRM---------NALVLELDNLA  426
            KQNLNQVI SIQKTLG LHQLYLT SSFN ASQ P LQR+         N LV ELDN+ 
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTFSSFNTASQPPLLQRLYFSINPLFCNGLVTELDNMV  91

Query  425  KLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  276
            KL+E+C+IQVPMEVL+LIDDG+NPDEFTR V+NSCI KNQ+TK KTDAFK
Sbjct  92   KLSERCNIQVPMEVLNLIDDGRNPDEFTRAVINSCITKNQVTKEKTDAFK  141



>ref|XP_006367259.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Solanum tuberosum]
Length=124

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 97/127 (76%), Gaps = 9/127 (7%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DI  402
            KQNLNQVI SI KTL +LHQL    SSF+    +     +N LV E+DN+AKL E C  I
Sbjct  5    KQNLNQVIYSIDKTLEILHQL----SSFD----VDVASHLNNLVFEIDNMAKLGENCHSI  56

Query  401  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEV  222
            +VPMEVL+LID+GKNPDEF RD+LN+CIAKNQITKGK DAFK LR HLL++LE AFPDEV
Sbjct  57   KVPMEVLNLIDNGKNPDEFARDLLNNCIAKNQITKGKVDAFKDLRGHLLEDLEHAFPDEV  116

Query  221  EAYRMSR  201
            E YR  R
Sbjct  117  EDYRQRR  123



>tpg|DAA40595.1| TPA: hypothetical protein ZEAMMB73_822884 [Zea mays]
Length=107

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -3

Query  431  LAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  252
            L + + +C         SLIDDGKNPDEFTRDVLNSCI KNQITKGKTDAFKGLRKHLL+
Sbjct  3    LWRSSTRCRNSPRGATSSLIDDGKNPDEFTRDVLNSCIVKNQITKGKTDAFKGLRKHLLE  62

Query  251  ELEEAFPDEVEAYRMSRATSAAEAKQLAQAQNALPNGDVKVKPE  120
            ELE+AFP++VEAYR  RATSAAEAK+LAQ+Q  LPNGDVKVK E
Sbjct  63   ELEQAFPEDVEAYREIRATSAAEAKRLAQSQGTLPNGDVKVKAE  106



>ref|XP_001765923.1| predicted protein [Physcomitrella patens]
 gb|EDQ69244.1| predicted protein [Physcomitrella patens]
Length=162

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -3

Query  560  VISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVL  381
             ++S+ + L +LHQL  +VS F   SQL  L+R+N LV E  N+   ++ C IQ+P+EVL
Sbjct  15   TLASVHRALALLHQLQCSVSGFQLPSQLVLLERLNGLVSEFGNMHSASQDCHIQIPLEVL  74

Query  380  SLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSR  201
            + ID+G+NPDE+T+ +LN CI +NQ +KGK D+FK LRKHLL+++EE FP E EAYR  R
Sbjct  75   NFIDEGRNPDEYTKHLLNGCIQQNQASKGKVDSFKALRKHLLEQVEEVFPAETEAYRDIR  134

Query  200  ATSAAEAKQLAQAQNALPNGDVKVKPE  120
              S+ E+++     N + NGD+K+K E
Sbjct  135  NQSSLESRRSLHTGNPMSNGDMKLKIE  161



>gb|AGV54175.1| mediator of RNA polymerase II transcription subunit [Phaseolus 
vulgaris]
Length=209

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  396
            + LNQV +SIQKTLG++HQ YL V +FNAA Q+P +QR+N LV+ELDN+ KLAEK    V
Sbjct  39   RKLNQVSNSIQKTLGLIHQFYLPVFTFNAAFQMPRIQRINGLVVELDNMVKLAEKSRFPV  98

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPD  228
            P EV++LIDDGKNPDEF++DV+  C AKNQIT+GKT A     KH L+EL + F D
Sbjct  99   PREVVNLIDDGKNPDEFSKDVIKRCFAKNQITQGKTGALNISGKHFLEELGQKFLD  154



>gb|EAZ03627.1| hypothetical protein OsI_25763 [Oryza sativa Indica Group]
Length=216

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL  +++SIQ+TLG+LHQL L VSSF++ASQLP LQR+N+LV ELD + K AE C+IQ
Sbjct  37   KQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQ  96

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  279
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQ  + K   F
Sbjct  97   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQEKEKKNHQF  136



>ref|XP_004493708.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Cicer arietinum]
Length=113

 Score =   131 bits (329),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = -3

Query  479  LPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQIT  300
            +P LQ +N L ++LDN+ KL EKC  QVPM+ ++LID  KNPDEF RD++N+CI KNQIT
Sbjct  1    MPLLQLVNGLFVKLDNMVKLIEKCSFQVPMKFVNLIDVNKNPDEFIRDIINNCIVKNQIT  60

Query  299  KGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATSAAEAKQLAQAQNALPNG  141
            KGKT   K L +HLL ELE+ FPDEVE +  ++  SAAE       QN LPNG
Sbjct  61   KGKTCFLKNLCQHLLKELEQNFPDEVETFFENQYASAAEL-----IQNVLPNG  108



>ref|XP_002986650.1| hypothetical protein SELMODRAFT_235078 [Selaginella moellendorffii]
 gb|EFJ12213.1| hypothetical protein SELMODRAFT_235078 [Selaginella moellendorffii]
Length=157

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 102/145 (70%), Gaps = 6/145 (4%)
 Frame = -3

Query  551  SIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLI  372
            S+   L  LHQL+ +VSSF   SQL  L+R+N LV +L+ +   + +C++++P+EV+  I
Sbjct  15   SLHSALATLHQLHCSVSSFTLPSQLLVLERLNELVKDLNLMQSSSNQCNLEIPVEVIRFI  74

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
            D+GKNPDEFT+D+LN CI +NQ TKG     K LRKH+L+E+EEAFP+E E YRM R  S
Sbjct  75   DEGKNPDEFTKDLLNHCIQRNQATKG-----KALRKHILEEVEEAFPEETETYRMLRTAS  129

Query  191  AAEAKQ-LAQAQNALPNGDVKVKPE  120
            A E+++  AQ    L NGD +VKPE
Sbjct  130  ALESRRSAAQPIPGLSNGDARVKPE  154



>ref|XP_006387573.1| hypothetical protein POPTR_0829s00210g [Populus trichocarpa]
 gb|ERP46487.1| hypothetical protein POPTR_0829s00210g [Populus trichocarpa]
Length=113

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = -3

Query  431  LAKLAEKCDIQ-VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLL  255
            + KL+E+C+IQ V   VLSLIDDGKNPDEFTR V+NSCI KNQ+TKGKTDAFK L KH L
Sbjct  1    MVKLSERCNIQQVYCFVLSLIDDGKNPDEFTRGVINSCITKNQVTKGKTDAFKSLCKHQL  60

Query  254  DELEEAFPDEVEAYRMSRATSAA  186
            +ELE+ FPDEVE+Y   RA SAA
Sbjct  61   EELEQTFPDEVESYWEIRAMSAA  83



>gb|KJB51999.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
Length=128

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  398  VPMEVLSLI  372
            VPMEVL  +
Sbjct  97   VPMEVLKWV  105



>tpg|DAA40593.1| TPA: hypothetical protein ZEAMMB73_822884 [Zea mays]
Length=108

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  399
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  37   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  96



>gb|EFX81997.1| hypothetical protein DAPPUDRAFT_302806 [Daphnia pulex]
Length=136

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++N++V  L  + KL  +  D+ VP+EV   ID+G+NP 
Sbjct  19   IRQVKIIVSDFQPQGQSVLNQKINSIVQGLQEIDKLKSQVQDVHVPLEVFEYIDEGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK D+++  R HLL+EL + FP+E   YR SR 
Sbjct  79   LYTKDCMEKALNKNEQVKGKIDSYRKFRAHLLEELSQVFPNETMKYRTSRG  129



>ref|XP_794222.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Strongylocentrotus purpuratus]
 ref|XP_780323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Strongylocentrotus purpuratus]
Length=137

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 75/124 (60%), Gaps = 2/124 (2%)
 Frame = -3

Query  560  VISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPME-  387
            ++ ++++ + +  QL L VS F    Q P  Q+++ LV  L  L K  E+  D+QVP+E 
Sbjct  12   LVENLERFIEITRQLGLVVSDFQPQGQAPLNQKLHMLVSSLQELDKNKEQVQDVQVPLEL  71

Query  386  VLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRM  207
            +   +D GKNP  +T+D +   +AKN++ KGK + F+  +K L+ EL + FP+E++ Y+ 
Sbjct  72   IYEYVDQGKNPQLYTKDCMERAVAKNELVKGKIETFRRFKKALVTELGKMFPEEIDRYKT  131

Query  206  SRAT  195
             R +
Sbjct  132  VRGS  135



>ref|XP_005102641.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X2 [Aplysia californica]
Length=134

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = -3

Query  524  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDE  348
             Q+ + VS F    Q    Q++  +V EL+ + KL  +  D+QVP+EV   ID G+NP  
Sbjct  20   RQMGIIVSDFQPQGQNVLNQKIQTMVTELNEIDKLRTQIQDVQVPLEVFDYIDQGRNPSL  79

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            +T+D L   +AKN+  KGKTD+ K  +  LL EL + FP E+E YR
Sbjct  80   YTKDCLEKALAKNEQVKGKTDSLKRFKAMLLQELSKVFPSEIEMYR  125



>gb|EHJ63693.1| putative mediator complex, subunit [Danaus plexippus]
Length=131

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++ +LV  L  + KL A+  DI VP EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQSVLNQKIQSLVTGLQEVDKLKAQVHDIHVPTEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D ++  +AKN+  KGK D++K  + HLL EL + FP+E+  Y+  R 
Sbjct  79   LYTKDCIDKALAKNEEVKGKIDSYKRFKSHLLSELSKTFPNEIAKYKAIRG  129



>ref|XP_004932922.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X2 [Bombyx mori]
Length=118

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  DI VP EV   ID G+NP 
Sbjct  6    VRQIRIIVSDFQPQGQSVLNQKIQSLVTGLQEIDKLKSQVHDIHVPTEVFDYIDQGRNPQ  65

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D ++  +AKN+  KGK D++K  + HLL EL + FP+E+  Y+  R 
Sbjct  66   LYTKDCIDKALAKNEEVKGKIDSYKRFKTHLLSELSKTFPNEITKYKALRG  116



>ref|XP_004932921.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X1 [Bombyx mori]
Length=131

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  DI VP EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQSVLNQKIQSLVTGLQEIDKLKSQVHDIHVPTEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D ++  +AKN+  KGK D++K  + HLL EL + FP+E+  Y+  R 
Sbjct  79   LYTKDCIDKALAKNEEVKGKIDSYKRFKTHLLSELSKTFPNEITKYKALRG  129



>gb|ENN74363.1| hypothetical protein YQE_09044, partial [Dendroctonus ponderosae]
 gb|ERL90584.1| hypothetical protein D910_07931 [Dendroctonus ponderosae]
Length=135

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = -3

Query  521  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEF  345
            Q+++ VS F   SQ    Q++  +V  L  + KL  +  D+QVP EVL  ID G+NP  +
Sbjct  21   QMHIIVSDFQPQSQNALNQKLQTMVHGLQEVDKLKSQFQDVQVPPEVLDYIDQGRNPKLY  80

Query  344  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRAT  195
            T++ +   +AKN+  KGK DA++ L+K L+ ELE+ FP+E+  Y+  R +
Sbjct  81   TKNCIEKALAKNEQVKGKIDAYQKLKKSLIVELEKIFPNEISKYKALRHS  130



>ref|XP_001845336.1| RNA polymerase II mediator complex subunit 10 [Culex quinquefasciatus]
 gb|EDS40177.1| RNA polymerase II mediator complex subunit 10 [Culex quinquefasciatus]
Length=130

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  348
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQVDVNVPLEVFDYIDQGRNPQL  78

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            +T+D ++  + KN+  KGK DA++  + +LL EL + FP E+  Y+  R 
Sbjct  79   YTKDCIDKALTKNEEVKGKIDAYRKFKSNLLSELSDTFPGEIGKYKAIRG  128



>ref|XP_001648875.1| AAEL014501-PA [Aedes aegypti]
 sp|Q16G71.1|MED10_AEDAE RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Aedes aegypti]
 gb|EAT33233.1| AAEL014501-PA [Aedes aegypti]
Length=130

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 64/110 (58%), Gaps = 0/110 (0%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  348
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQVDVNVPLEVFDYIDQGRNPQL  78

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            +T+D ++  + KN+  KGK D+++  + +L+ EL+E FP E+  Y+  R 
Sbjct  79   YTKDCIDKALTKNEEVKGKIDSYRKFKSNLMKELDETFPTEIAKYKAIRG  128



>ref|XP_011412649.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Crassostrea gigas]
 gb|EKC26203.1| Mediator of RNA polymerase II transcription subunit 10 [Crassostrea 
gigas]
Length=137

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 1/110 (1%)
 Frame = -3

Query  524  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVPMEVLSLIDDGKNPDE  348
             QL + VS F    Q    Q+++ +V  L  + KL  +  DIQVP+EV   ID GKNP+ 
Sbjct  23   RQLGIIVSDFQPQGQNVLNQKLHTMVTGLQEIDKLKTQMGDIQVPLEVFDYIDQGKNPNL  82

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            +T+D L   +AKN+  KGK D FK  +  LL EL++ FP E+  YR  R 
Sbjct  83   YTKDCLEKALAKNEQVKGKIDNFKKFKAALLVELDKVFPHEINNYRAMRG  132



>ref|XP_316314.2| AGAP006248-PA [Anopheles gambiae str. PEST]
 sp|Q7Q5R5.2|MED10_ANOGA RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Anopheles 
gambiae]
 gb|EAA11572.2| AGAP006248-PA [Anopheles gambiae str. PEST]
 gb|KFB36016.1| AGAP006248-PA-like protein [Anopheles sinensis]
Length=130

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  348
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQIDVNVPLEVFDYIDQGRNPQL  78

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            +T+D ++  + KN+  KGK D+++  + +L+ EL E FP E+  Y+  R 
Sbjct  79   YTKDCIDKALTKNEEVKGKIDSYRKFKSNLMKELSETFPVEISKYKAIRG  128



>ref|XP_005681589.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X2 [Capra hircus]
Length=139

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 72/131 (55%), Gaps = 5/131 (4%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC----  408
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  +KC    
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKYIDKCRQQL  62

Query  407  -DIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFP  231
             DI VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP
Sbjct  63   HDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFP  122

Query  230  DEVEAYRMSRA  198
            +++  YR  R 
Sbjct  123  EDMAKYRSIRG  133



>gb|ETN67202.1| RNA polymerase II mediator complex subunit 10 [Anopheles darlingi]
Length=130

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  348
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKTQIDVNVPLEVFDYIDQGRNPQL  78

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            +T+D ++  + KN+  KGK D+++  + +L+ EL E FP E+  Y+  R 
Sbjct  79   YTKDCIDKALTKNEEVKGKIDSYRKFKSNLMKELSETFPIEISKYKAIRG  128



>ref|XP_002424879.1| nut2, putative [Pediculus humanus corporis]
 gb|EEB12141.1| nut2, putative [Pediculus humanus corporis]
Length=149

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  ++ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVHGLQEIDKLKSQVQEVHVPLEVFEYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + HLL EL  AFP+E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKAHLLVELNAAFPNEITKYRAIRG  129



>ref|XP_002594058.1| hypothetical protein BRAFLDRAFT_118806 [Branchiostoma floridae]
 gb|EEN50069.1| hypothetical protein BRAFLDRAFT_118806 [Branchiostoma floridae]
Length=136

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 1/132 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            + L Q+   +++ +    Q+ + VS F    Q    Q+++A++  +  + +   +  D+Q
Sbjct  3    EKLEQLEQHLEQFIENTRQMGIIVSDFQPQGQPVLNQKIHAMITGMQEIDRCKSQLQDVQ  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T+D +   +AKN+  KGK DA K  R  L+ EL++ FP+E+ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKDCMEKSLAKNEQVKGKIDALKKFRSQLILELDKVFPEEIA  122

Query  218  AYRMSRATSAAE  183
             Y+ +R     E
Sbjct  123  KYKAAREIVKEE  134



>ref|XP_969834.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Tribolium castaneum]
 gb|EFA00809.1| hypothetical protein TcasGA2_TC003696 [Tribolium castaneum]
Length=131

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+++ VS F   SQ    Q++ ALV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIHIIVSDFQPQSQNVLNQKLLALVHGLQEVDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   +AKN+  KGK DA++  + ++L EL + FP E+  YR  R 
Sbjct  79   LYTKDCIEKALAKNEQVKGKIDAYRKFKANMLLELSKTFPTELSKYRAIRG  129



>ref|XP_007898728.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Callorhinchus milii]
Length=135

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 69/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N+++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNSMITGLQDVDKCRQQLHDINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+E+  YR  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLKKFKGLLIHELSKVFPEEMSKYRAIRC  129



>gb|ENN74364.1| hypothetical protein YQE_09045, partial [Dendroctonus ponderosae]
 gb|ERL90585.1| hypothetical protein D910_07932 [Dendroctonus ponderosae]
Length=128

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -3

Query  521  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEF  345
            Q+++ VS F+  SQ    Q++ ++V  L  + KL  +  D+ VP+EV   ID G+NP  +
Sbjct  21   QMHIIVSDFHPQSQNALNQKLQSMVHGLQEVDKLKSQFQDVHVPLEVFDYIDQGRNPKLY  80

Query  344  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAY  213
            T++ +   +AKN+  KGK DA++ L+ +L+ ELE+ FP+E+  Y
Sbjct  81   TKNCIEKALAKNEQVKGKIDAYRKLKTNLIVELEKIFPNEISEY  124



>ref|XP_004512812.1| PREDICTED: uncharacterized protein LOC101488839 [Cicer arietinum]
Length=123

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  434  NLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  276
            N   +AE  +IQVPMEV+ LID  KNPDEFTRD++N+CI KNQITKGKTDA K
Sbjct  66   NFPAMAENRNIQVPMEVVDLIDHRKNPDEFTRDIINNCIPKNQITKGKTDALK  118



>ref|XP_003462300.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cavia porcellus]
Length=135

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 73/131 (56%), Gaps = 1/131 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRATSAA  186
             YR  R  + A
Sbjct  123  KYRSIRGEAHA  133



>gb|ENN78401.1| hypothetical protein YQE_05201, partial [Dendroctonus ponderosae]
 gb|ERL93280.1| hypothetical protein D910_10576 [Dendroctonus ponderosae]
Length=136

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 65/114 (57%), Gaps = 1/114 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F   SQ    Q++ A+V  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQMDIIVSDFQPQSQNVLNQKLQAMVHGLQEIDKLKTQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATSA  189
             +T+D +   +AKN+  KGK DA++  + ++L EL + FP+E+  YR  R    
Sbjct  79   LYTKDCIEKALAKNEQVKGKIDAYRKFKANMLVELGKTFPNELSKYRALRGDEG  132



>ref|XP_005645629.1| hypothetical protein COCSUDRAFT_8935, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21085.1| hypothetical protein COCSUDRAFT_8935, partial [Coccomyxa subellipsoidea 
C-169]
Length=90

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  458  NALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  279
            N LV EL  L+   E   + VP+E+L  ID+G NPD FT ++ N     NQ+ KGK +AF
Sbjct  1    NGLVAELGGLSSHREALAVDVPVELLRYIDEGGNPDAFTSEIFNRANRSNQLAKGKVEAF  60

Query  278  KGLRKHLLDELEEAFPDEVEAYR  210
               R+ LL E  +AFP+E EA++
Sbjct  61   GAFREALLKEAGKAFPEETEAFK  83



>ref|XP_007520627.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Erinaceus europaeus]
Length=135

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   IAKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERAIAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_010968666.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camelus bactrianus]
 ref|XP_010970329.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camelus bactrianus]
Length=135

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP+ +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPELYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_001600793.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Nasonia vitripennis]
Length=131

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL A+  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVTGLQEIDKLKAQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D ++  + KN+  KGK DA++  + ++L EL   FP+E+  YR  R 
Sbjct  79   LYTKDCIDKALTKNEQVKGKIDAYRKFKANMLVELNRVFPNELAKYRAIRG  129



>ref|XP_006198447.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Vicugna pacos]
Length=137

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 69/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYI  73

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP+ +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  YR  R 
Sbjct  74   DQGRNPELYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRG  131



>ref|XP_008832792.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Nannospalax galili]
Length=135

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  EYRSIRG  129



>dbj|BAE33733.1| unnamed protein product [Mus musculus]
Length=135

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|NP_613062.1| mediator of RNA polymerase II transcription subunit 10 [Mus musculus]
 ref|NP_001099567.2| mediator of RNA polymerase II transcription subunit 10 [Rattus 
norvegicus]
 ref|XP_005065510.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mesocricetus auratus]
 ref|XP_006227831.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Rattus norvegicus]
 ref|XP_006987848.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Peromyscus maniculatus bairdii]
 ref|XP_007640532.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cricetulus griseus]
 ref|XP_007632054.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cricetulus griseus]
 sp|Q9CXU0.1|MED10_MOUSE RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Mus musculus]
 dbj|BAB29103.1| unnamed protein product [Mus musculus]
 gb|AAH56438.1| Mediator of RNA polymerase II transcription, subunit 10 homolog 
(NUT2, S. cerevisiae) [Mus musculus]
 gb|AAH48638.2| Mediator of RNA polymerase II transcription, subunit 10 homolog 
(NUT2, S. cerevisiae) [Mus musculus]
 gb|EDL87621.1| similar to DNA segment, Chr 13, Wayne State University 50, expressed 
(predicted), isoform CRA_b [Rattus norvegicus]
 gb|ERE82644.1| mediator of RNA polymerase II transcription subunit 10-like protein 
[Cricetulus griseus]
Length=135

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_005356754.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Microtus ochrogaster]
Length=135

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_001639313.1| predicted protein [Nematostella vectensis]
 gb|EDO47250.1| predicted protein [Nematostella vectensis]
Length=139

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  551  SIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-----DIQVPME  387
            +I++ +    Q+ + VS F   SQ    Q++N +V   DNL ++ EKC     D++VP+E
Sbjct  17   TIEQFVETTRQIGIIVSDFQPGSQGVLNQKINMMV---DNLREI-EKCKAHVADVEVPLE  72

Query  386  VLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRM  207
            V   ID G+NP  +T+D L   + KN+  KGK DA+K  +  L+DEL +  P +++ Y  
Sbjct  73   VFEYIDQGRNPQLYTKDCLEKALVKNEQVKGKIDAYKNFKSLLVDELSKVLPKDMKEYNK  132

Query  206  SRATSAA  186
             + +  +
Sbjct  133  IKESQGS  139



>ref|XP_004274551.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Orcinus orca]
Length=135

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSVRG  129



>ref|XP_006875023.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chrysochloris asiatica]
Length=135

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (55%), Gaps = 1/131 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRATSAA  186
             YR  R    +
Sbjct  123  KYRSIRGEEQS  133



>ref|XP_004894714.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Heterocephalus glaber]
 ref|XP_004845208.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Heterocephalus glaber]
 gb|EHB09385.1| Mediator of RNA polymerase II transcription subunit 10 [Heterocephalus 
glaber]
Length=137

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_001363617.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Monodelphis domestica]
Length=135

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIS  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_010984281.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camelus dromedarius]
Length=159

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  27   EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  86

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP+ +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  87   VPLEVFEYIDQGRNPELYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  146

Query  218  AYRMSRA  198
             YR  R 
Sbjct  147  KYRSIRG  153



>ref|XP_004678110.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Condylura cristata]
Length=135

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +TR+ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPLLYTRECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_004625247.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Octodon degus]
 ref|XP_005407122.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chinchilla lanigera]
Length=135

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_011242829.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Mus musculus]
Length=164

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  32   EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  91

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  92   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  151

Query  218  AYRMSRA  198
             YR  R 
Sbjct  152  KYRSIRG  158



>ref|NP_001247782.1| mediator of RNA polymerase II transcription subunit 10 [Macaca 
mulatta]
 ref|XP_003899530.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Papio anubis]
 ref|XP_007959357.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chlorocebus sabaeus]
 ref|XP_010374320.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Rhinopithecus roxellana]
 gb|EHH26385.1| Mediator complex subunit 10 [Macaca mulatta]
Length=135

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_006081530.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Myotis lucifugus]
Length=135

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_004380332.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Trichechus manatus latirostris]
 ref|XP_006901362.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Elephantulus edwardii]
 ref|XP_007951450.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Orycteropus afer afer]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_003134205.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Sus scrofa]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|NP_115662.2| mediator of RNA polymerase II transcription subunit 10 [Homo 
sapiens]
 ref|NP_001029928.1| mediator of RNA polymerase II transcription subunit 10 [Bos taurus]
 ref|NP_001128985.1| mediator of RNA polymerase II transcription subunit 10 [Pongo 
abelii]
 ref|XP_001143506.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pan troglodytes]
 ref|XP_002745181.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Callithrix jacchus]
 ref|XP_003263266.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 1 [Nomascus leucogenys]
 ref|XP_003808015.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pan paniscus]
 ref|XP_003932559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Saimiri boliviensis boliviensis]
 ref|XP_004059105.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Gorilla gorilla gorilla]
 ref|XP_004088238.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 2 [Nomascus leucogenys]
 ref|XP_004088239.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 3 [Nomascus leucogenys]
 ref|XP_004416501.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 1 [Odobenus rosmarus divergens]
 ref|XP_004416502.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 2 [Odobenus rosmarus divergens]
 ref|XP_004440105.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ceratotherium simum simum]
 ref|XP_004468983.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Dasypus novemcinctus]
 ref|XP_004768436.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mustela putorius furo]
 ref|XP_004812565.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mustela putorius furo]
 ref|XP_005681588.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X1 [Capra hircus]
 ref|XP_005857955.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Myotis brandtii]
 ref|XP_005899029.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Bos mutus]
 ref|XP_006917205.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pteropus alecto]
 ref|XP_007107895.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Physeter catodon]
 ref|XP_006047772.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Bubalus bubalis]
 ref|XP_007191711.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Balaenoptera acutorostrata scammoni]
 ref|XP_008160026.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Eptesicus fuscus]
 ref|XP_008247056.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Oryctolagus cuniculus]
 ref|XP_008570905.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Galeopterus variegatus]
 ref|XP_010855419.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Bison bison bison]
 sp|Q9BTT4.1|MED10_HUMAN RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10; AltName: 
Full=Transformation-related gene 17 protein; Short=TRG-17; 
AltName: Full=Transformation-related gene 20 protein; Short=TRG-20 
[Homo sapiens]
 sp|Q5R6P5.1|MED10_PONAB RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Pongo abelii]
 sp|Q3ZCF2.1|MED10_BOVIN RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Bos taurus]
 gb|AAH03353.1| Mediator complex subunit 10 [Homo sapiens]
 gb|AAQ18038.1| transformation-related protein 17 [Homo sapiens]
 gb|AAS47514.1| transformation-related protein 20 [Homo sapiens]
 gb|AAT06736.1| L6 [Homo sapiens]
 emb|CAH92565.1| hypothetical protein [Pongo abelii]
 gb|AAI02440.1| Mediator complex subunit 10 [Bos taurus]
 gb|EAX08110.1| hypothetical protein MGC5309 [Homo sapiens]
 gb|ACS13739.1| mediator of RNA polymerase II transcription subunit 10-like protein 
[Homo sapiens]
 tpg|DAA17760.1| TPA: mediator of RNA polymerase II transcription subunit 10 [Bos 
taurus]
 dbj|BAJ21185.1| mediator complex subunit 10 [synthetic construct]
 gb|ELK08158.1| Mediator of RNA polymerase II transcription subunit 10 [Pteropus 
alecto]
 gb|ELR54096.1| Mediator of RNA polymerase II transcription subunit 10 [Bos mutus]
 gb|EPQ02513.1| Mediator of RNA polymerase II transcription subunit 10 [Myotis 
brandtii]
 gb|AIC52532.1| MED10, partial [synthetic construct]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>gb|KFW71686.1| Mediator of RNA polymerase II transcription subunit 10 [Pygoscelis 
adeliae]
Length=134

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIFVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FPD++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPDDMAKYKAIRG  129



>ref|XP_009328746.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pygoscelis adeliae]
Length=136

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIFVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FPD++  Y+  R 
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPDDMAKYKAIRG  131



>ref|XP_004597953.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ochotona princeps]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  YR  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRG  129



>ref|XP_009867898.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Apaloderma vittatum]
 gb|KFP88940.1| Mediator of RNA polymerase II transcription subunit 10 [Apaloderma 
vittatum]
Length=134

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 69/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ+   Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQVGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>ref|XP_003800937.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Otolemur garnettii]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVSGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRATSAAEA  180
             YR  R      A
Sbjct  123  KYRSIRGEDHPPA  135



>ref|XP_010194202.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Colius striatus]
 gb|KFP29313.1| Mediator of RNA polymerase II transcription subunit 10 [Colius 
striatus]
Length=134

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNCMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>gb|KFV94189.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Eurypyga helias]
Length=129

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 70/124 (56%), Gaps = 1/124 (1%)
 Frame = -3

Query  566  NQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPM  390
            N +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+
Sbjct  1    NSLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPL  60

Query  389  EVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+
Sbjct  61   EVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYK  120

Query  209  MSRA  198
              R 
Sbjct  121  AIRG  124



>ref|XP_010152321.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 10 [Eurypyga helias]
Length=138

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 70/124 (56%), Gaps = 1/124 (1%)
 Frame = -3

Query  566  NQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPM  390
            N +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+
Sbjct  10   NSLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPL  69

Query  389  EVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+
Sbjct  70   EVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYK  129

Query  209  MSRA  198
              R 
Sbjct  130  AIRG  133



>ref|XP_006171581.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Tupaia chinensis]
 gb|ELV09425.1| Mediator of RNA polymerase II transcription subunit 10 [Tupaia 
chinensis]
Length=135

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQANLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_005873843.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Myotis brandtii]
 gb|EPQ12386.1| Mediator of RNA polymerase II transcription subunit 10 [Myotis 
brandtii]
Length=142

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 1/125 (1%)
 Frame = -3

Query  569  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVP  393
            L+ +   ++K +  + QL +  S F  +SQ    Q++N +V  L ++ K  ++  DI VP
Sbjct  5    LDHLEEHLEKFVENIRQLSIIASDFQPSSQAGLNQKLNLIVTGLQDIDKCRQQLHDITVP  64

Query  392  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAY  213
            +EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+  L E FP++V  Y
Sbjct  65   LEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKMDTMKKFKGLLIQGLSEVFPEDVAKY  124

Query  212  RMSRA  198
            R  R 
Sbjct  125  RSIRG  129



>ref|XP_008543284.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Microplitis demolitor]
Length=131

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + +LL EL   FP+E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANLLVELNRVFPNELAKYRAIRG  129



>ref|XP_001601868.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Nasonia vitripennis]
Length=149

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 73/124 (59%), Gaps = 4/124 (3%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDI  402
            ++NL   + S  + + +++   + V+ F   +Q    Q++  +V +L ++ K   E  D+
Sbjct  9    QENLETTLESFIENVRLIN---IMVADFQPQAQTVLNQKIQKIVTDLRDINKFKTEMMDV  65

Query  401  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEV  222
            Q+PMEV   ID G NP  +T+D ++  +AKN+  KGK DA+K  + ++L +L + FP E+
Sbjct  66   QIPMEVFEYIDQGYNPQLYTKDCMSKALAKNEEAKGKIDAYKRFKANMLVKLSKTFPREM  125

Query  221  EAYR  210
             AYR
Sbjct  126  NAYR  129



>ref|NP_001004914.1| mediator of RNA polymerase II transcription subunit 10 [Xenopus 
(Silurana) tropicalis]
 sp|Q6DJ25.1|MED10_XENTR RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Xenopus 
(Silurana) tropicalis]
 gb|AAH75360.1| MGC89063 protein [Xenopus (Silurana) tropicalis]
Length=135

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N LV  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFLVTGLQDIDKCRQQLHDITVPLEVFDYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLKKFKSLLIQELSKVFPEDMAKYKAIRG  129



>ref|XP_007435877.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Python bivittatus]
Length=134

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 69/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRS  129



>ref|NP_001085232.1| mediator of RNA polymerase II transcription subunit 10 [Xenopus 
laevis]
 sp|Q6IP67.1|MED10_XENLA RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Xenopus 
laevis]
 gb|AAH72051.1| Med10 protein [Xenopus laevis]
Length=135

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N LV  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFLVRGLQDIDKCRQQLHDITVPLEVFDYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLKKFKSLLIQELSKVFPEDMAKYKAVRG  129



>ref|XP_001621967.1| hypothetical protein NEMVEDRAFT_v1g176376 [Nematostella vectensis]
 gb|EDO29867.1| predicted protein [Nematostella vectensis]
Length=139

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  551  SIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-----DIQVPME  387
            +I++ +    Q+ + VS F   SQ    Q++N +V   DNL ++ EKC     D++VP+E
Sbjct  17   TIEQFVETTRQIGIIVSDFQPGSQGVLNQKINMMV---DNLREI-EKCKAHVADVEVPLE  72

Query  386  VLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRM  207
            V   ID G+NP  +T+D L   + KN+  KGK DA+K  +  L+DEL +  P  ++ Y  
Sbjct  73   VFEYIDQGRNPQLYTKDCLEKALVKNEQVKGKIDAYKNFKSLLVDELSKVLPKGMKEYNK  132

Query  206  SRATSAA  186
             + +  +
Sbjct  133  IKESQGS  139



>ref|XP_008948061.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Merops nubicus]
 gb|KFQ17374.1| Mediator of RNA polymerase II transcription subunit 10 [Merops 
nubicus]
Length=134

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (58%), Gaps = 1/119 (1%)
 Frame = -3

Query  551  SIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSL  375
            +++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   
Sbjct  11   NLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEY  70

Query  374  IDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  71   IDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>ref|XP_004698165.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Echinops telfairi]
Length=135

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  +GK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVRGKMDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_005959297.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pantholops hodgsonii]
Length=135

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q+ N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKXNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_002412765.1| nut2, putative [Ixodes scapularis]
 gb|EEC16061.1| nut2, putative [Ixodes scapularis]
Length=135

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 9/115 (8%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-----DIQVPMEVLSLIDDG  363
            + QL + VS F    Q    Q++N +V     L +  +KC     DIQVP+EV   ID G
Sbjct  19   VRQLGIIVSDFQPQGQTTLNQKINHIV----TLMQEVDKCKPQVQDIQVPLEVFDYIDQG  74

Query  362  KNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            +NP  FT+D +   +AKN+  KGK ++++  +  LL EL + FP E+  YR  R 
Sbjct  75   RNPQLFTKDCMEKALAKNEQVKGKIESYRRFKALLLLELSKVFPTEMAKYRAIRG  129



>ref|XP_006001826.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Latimeria chalumnae]
Length=135

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYKAIRG  129



>ref|NP_001232567.1| putative MGC89063 protein variant 2 [Taeniopygia guttata]
 ref|XP_005041752.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ficedula albicollis]
 ref|XP_005484320.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Zonotrichia albicollis]
 ref|XP_005533567.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pseudopodoces humilis]
 ref|XP_009904865.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Picoides pubescens]
 gb|ACH44028.1| putative MGC89063 protein variant 2 [Taeniopygia guttata]
 gb|KFP86373.1| Mediator of RNA polymerase II transcription subunit 10 [Acanthisitta 
chloris]
 gb|KFR04975.1| Mediator of RNA polymerase II transcription subunit 10 [Nipponia 
nippon]
 gb|KFV72041.1| Mediator of RNA polymerase II transcription subunit 10 [Picoides 
pubescens]
Length=134

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>ref|XP_009078838.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Acanthisitta chloris]
 ref|XP_009470338.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Nipponia nippon]
Length=136

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  131



>ref|XP_011141422.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Harpegnathos saltator]
 gb|EFN83182.1| Mediator of RNA polymerase II transcription subunit 10 [Harpegnathos 
saltator]
Length=131

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVSGLQEVDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP+E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELNRVFPNELAKYRAIRG  129



>gb|KFQ70639.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Phaethon lepturus]
Length=133

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>gb|EFZ10240.1| hypothetical protein SINV_14848 [Solenopsis invicta]
Length=133

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  21   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  80

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP+E+  YR  R 
Sbjct  81   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELNRVFPNELAKYRAIRG  131



>ref|XP_006025079.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Alligator sinensis]
 ref|XP_006271187.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Alligator mississippiensis]
Length=134

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>ref|XP_011171735.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Solenopsis invicta]
 ref|XP_011255299.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camponotus floridanus]
 ref|XP_011349932.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cerapachys biroi]
 gb|EFN68975.1| Mediator of RNA polymerase II transcription subunit 10 [Camponotus 
floridanus]
 gb|EZA47377.1| Mediator of RNA polymerase II transcription subunit [Cerapachys 
biroi]
Length=131

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP+E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELNRVFPNELAKYRAIRG  129



>ref|XP_008489554.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Calypte anna]
 ref|XP_009978222.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Tauraco erythrolophus]
 gb|KFO70712.1| Mediator of RNA polymerase II transcription subunit 10 [Cuculus 
canorus]
 gb|KFO98974.1| Mediator of RNA polymerase II transcription subunit 10 [Calypte 
anna]
 gb|KFQ39898.1| Mediator of RNA polymerase II transcription subunit 10 [Mesitornis 
unicolor]
 gb|KFV04415.1| Mediator of RNA polymerase II transcription subunit 10 [Tauraco 
erythrolophus]
 gb|KFV39953.1| Mediator of RNA polymerase II transcription subunit 10 [Gavia 
stellata]
 gb|KFV99228.1| Mediator of RNA polymerase II transcription subunit 10 [Fulmarus 
glacialis]
 gb|KGL82127.1| Mediator of RNA polymerase II transcription subunit 10 [Tinamus 
guttatus]
 gb|KGL92269.1| Mediator of RNA polymerase II transcription subunit 10 [Charadrius 
vociferus]
Length=134

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>ref|XP_010569720.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Haliaeetus leucocephalus]
Length=136

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  131



>ref|XP_010295441.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Phaethon lepturus]
Length=136

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  131



>ref|XP_009568584.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cuculus canorus]
 ref|XP_009586152.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Fulmarus glacialis]
 ref|XP_009814748.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Gavia stellata]
 ref|XP_009882064.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Charadrius vociferus]
 ref|XP_010189208.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mesitornis unicolor]
 ref|XP_010219982.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Tinamus guttatus]
 ref|XP_003204894.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Meleagris gallopavo]
Length=136

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  131



>ref|XP_005188303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Musca domestica]
Length=132

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  DI VP EV   ID  KNP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVSGLQEINKLKNQVQDIYVPFEVFDYIDQDKNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATSA  189
             +T+D +   +AKN+  KGK DA++  + ++L EL + FP+E+  YR  R  S 
Sbjct  79   LYTKDCVEKALAKNEEVKGKIDAYRKFKSNMLAELFKTFPNEMNMYRAYRPDSV  132



>gb|KFQ66578.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Pelecanus crispus]
Length=115

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 64/113 (57%), Gaps = 1/113 (1%)
 Frame = -3

Query  524  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDE  348
             QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   ID G+NP  
Sbjct  1    RQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYIDQGRNPQL  60

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATSA  189
            +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R   +
Sbjct  61   YTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRGEDS  113



>ref|XP_003737748.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Metaseiulus occidentalis]
Length=148

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 76/139 (55%), Gaps = 6/139 (4%)
 Frame = -3

Query  569  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVP  393
            L Q+ +S++  +  + QL + V+ F    Q    Q++  LV  + +++ +     DIQVP
Sbjct  9    LQQLEASLELFIENVRQLGIVVADFQPQGQPALNQKITTLVSLMQDISAVRPHVEDIQVP  68

Query  392  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAY  213
            +EV   ID+ +NP  +T+D +   +AKN+  KGK DA++  +  LL EL + FP E+  Y
Sbjct  69   LEVCDYIDEARNPQLYTKDCMEKALAKNEQVKGKIDAYRRFKALLLVELGKVFPHEISKY  128

Query  212  RMSR-----ATSAAEAKQL  171
            R  R     ATS   + Q+
Sbjct  129  RAYRGENGVATSPHPSMQM  147



>ref|XP_001511205.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ornithorhynchus anatinus]
Length=161

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -3

Query  512  LTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEFTRD  336
            L +S F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   ID G+NP  +T++
Sbjct  50   LLLSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYIDQGRNPQLYTKE  109

Query  335  VLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             L   +AKN+  KGK D  K  +  L+ EL + FPD++  YR +R 
Sbjct  110  CLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPDDMAKYRSTRG  155



>ref|XP_005427987.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Geospiza fortis]
Length=134

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFPPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKTIRG  129



>ref|XP_003408084.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Loxodonta africana]
Length=135

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K     L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKXXXXXLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  NYRSIRG  129



>ref|XP_009489761.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10, partial [Pelecanus crispus]
Length=115

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -3

Query  521  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEF  345
            QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   ID G+NP  +
Sbjct  1    QLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYIDQGRNPQLY  60

Query  344  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATSA  189
            T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R   +
Sbjct  61   TKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRGEDS  112



>gb|KFO14882.1| Mediator of RNA polymerase II transcription subunit 10 [Balearica 
regulorum gibbericeps]
Length=134

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFPPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>ref|XP_010308856.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Balearica regulorum gibbericeps]
Length=136

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFPPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  131



>ref|XP_006635939.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Lepisosteus oculatus]
Length=134

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 1/114 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIDKCRQQLHDINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+E+  Y+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELGKVFPEEMAKYK  125



>gb|KFM58995.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Stegodyphus mimosarum]
Length=134

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + QL + VS F    Q    Q++  +V  +  + K   +  DIQVP+EV   ID G+NP 
Sbjct  19   VRQLGIIVSDFQPQGQTILNQKIAQMVTYMQEIDKCKNQVQDIQVPLEVFEYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSR  201
             +T+D +   + KN++ KGK D+++  +  LL EL + FP+E+  YR  R
Sbjct  79   LYTKDCMEKALNKNEVVKGKIDSYRRFKSLLLVELSKVFPNEMAQYRAIR  128



>ref|XP_011285416.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Felis catus]
Length=135

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q+ N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKXNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +A+N+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALARNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_011050147.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Acromyrmex echinatior]
 gb|EGI68057.1| Mediator of RNA polymerase II transcription subunit 10 [Acromyrmex 
echinatior]
Length=131

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELNRVFPHELTKYRAIRG  129



>ref|XP_624779.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Apis mellifera]
 ref|XP_006607903.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Apis dorsata]
Length=131

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELTRVFPQELAKYRAIRG  129



>ref|XP_004935190.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X3 [Gallus gallus]
Length=157

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  35   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  94

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  95   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  152



>ref|XP_004270303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Orcinus orca]
Length=135

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  + ++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYNKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_003397402.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Bombus terrestris]
 ref|XP_003485779.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Bombus impatiens]
Length=131

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELTRVFPHELAKYRAIRG  129



>ref|XP_011501311.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ceratosolen solmsi marchali]
Length=136

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = -3

Query  578  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DI  402
            +QN  ++++ ++  +  + Q+ + V +F   +Q    +++  +V +L  +  L +   D+
Sbjct  4    RQNSEKLVNQMETFIENVRQINIMVCNFQPQAQHILNRKIQNIVTDLQVINNLKDSVKDM  63

Query  401  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEV  222
            ++P+EVL  +D G+NP  FT+D ++  + KNQ  KGK D++K  + ++L E+ + FP EV
Sbjct  64   RIPVEVLKYVDAGQNPHLFTKDCIDKAMIKNQELKGKIDSYKKFKANMLLEINKYFPKEV  123

Query  221  EAYRMSR  201
            E YR  R
Sbjct  124  EKYRAIR  130



>ref|XP_002112039.1| hypothetical protein TRIADDRAFT_24417 [Trichoplax adhaerens]
 gb|EDV26006.1| hypothetical protein TRIADDRAFT_24417 [Trichoplax adhaerens]
Length=137

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -3

Query  524  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCD-IQVPMEVLSLIDDGKNPDE  348
             Q+ +  S F A SQ     ++  L+  L  +  + EK D I+VP+EV S ID+G+NP+ 
Sbjct  26   RQVGIIASDFQATSQKVLNDKLRGLITNLREINDMKEKFDDIEVPLEVFSYIDEGRNPEL  85

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAY  213
            +T+  L+  +  NQ  KGK DA+K  +  L + L + FP E+EAY
Sbjct  86   YTKACLDKVVMMNQEMKGKVDAYKNFKTTLCEGLAKVFPKEMEAY  130



>ref|NP_001271609.1| mediator of RNA polymerase II transcription subunit 10 [Macaca 
fascicularis]
 sp|Q4R6W4.1|MED10_MACFA RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Macaca fascicularis]
 dbj|BAE01160.1| unnamed protein product [Macaca fascicularis]
Length=135

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+  L + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQGLSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>gb|KFH71415.1| hypothetical protein MVEG_01714 [Mortierella verticillata NRRL 
6337]
Length=239

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (54%), Gaps = 0/115 (0%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  348
            L +L +TV  F   S     Q++  L+ ++ ++    +K DI VPMEVLS I+DGKNPD 
Sbjct  71   LLELSITVYDFQPESNSLVHQKIQELISQISDIEAFKDKLDIMVPMEVLSFIEDGKNPDL  130

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATSAAE  183
            FT+  +     +NQ T GK  A K     L   L   FP+E++ Y+    + AAE
Sbjct  131  FTKSFIECVAGENQFTNGKITAMKSFESSLSQNLGAVFPEEMDEYQDILKSIAAE  185



>ref|XP_003223649.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Anolis carolinensis]
Length=134

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHEISVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  129



>ref|XP_011189186.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Bactrocera cucurbitae]
Length=132

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP EV   ID  KNP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVTGLQEIDKLKNQVQDVFVPFEVFDYIDQDKNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
             +T+D +   +AKN+  KGK DA++  + ++L EL + FP+E+  YR  R  S
Sbjct  79   LYTKDCVEKALAKNEEVKGKIDAYRKFKANMLLELYKTFPNEMNMYRAYRPDS  131



>ref|XP_419024.4| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Gallus gallus]
Length=207

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  85   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  144

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  145  DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  202



>sp|Q0VIA1.1|MED10_DANRE RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10; AltName: 
Full=Protein tennis match [Danio rerio]
 gb|AAW56465.1| Med10 [Danio rerio]
Length=134

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 66/114 (58%), Gaps = 1/114 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIEKCRQQLHDINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ EL + FP+E+  Y+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLTKFKSLLISELGKVFPEEMAKYK  125



>ref|XP_003707557.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Megachile rotundata]
Length=131

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVLVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELTRVFPHELAKYRAIRG  129



>ref|XP_004525900.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Ceratitis capitata]
 ref|XP_011197739.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Bactrocera dorsalis]
Length=132

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP EV   ID  KNP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVTGLQEIDKLKNQVQDVFVPFEVFDYIDQDKNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
             +T+D +   +AKN+  KGK DA++  + ++L EL + FP+E+  YR  R  S
Sbjct  79   LYTKDCVEKALAKNEEVKGKIDAYRKFKANMLLELFKTFPNEMNMYRAYRPDS  131



>ref|XP_007453559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Lipotes vexillifer]
Length=135

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  D+ 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDVT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + F +++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKMDTMKKFKIRLIQELSKVFSEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>gb|KHJ40733.1| hypothetical protein D918_09175 [Trichuris suis]
Length=213

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -3

Query  572  NLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNL-AKLAEKCDIQV  396
            NL Q   S++  +    QL +  S F A+SQ    Q++ A+   L +L +K ++  D++V
Sbjct  86   NLEQ---SLEALIENTRQLCMVASDFQASSQSVLNQKLQAITSGLQDLDSKKSKFHDVKV  142

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            P+E+L  +D GKNP  +TRD +   +AKN+    K D +K  R  LL EL E FP E   
Sbjct  143  PIELLEYVDSGKNPQLYTRDCIERTVAKNKELNSKIDQYKKFRCMLLSELTEEFPKETIQ  202

Query  215  YRMSR  201
            YR  R
Sbjct  203  YRTIR  207



>ref|NP_001017699.1| mediator of RNA polymerase II transcription subunit 10 [Danio 
rerio]
 gb|AAH93274.1| Mediator of RNA polymerase II transcription, subunit 10 homolog 
[Danio rerio]
Length=134

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 66/114 (58%), Gaps = 1/114 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFVITGLQDIEKCRQQLHDINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ EL + FP+E+  Y+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLTKFKSLLISELGKVFPEEMAKYK  125



>ref|XP_009058257.1| hypothetical protein LOTGIDRAFT_233490 [Lottia gigantea]
 gb|ESO90986.1| hypothetical protein LOTGIDRAFT_233490 [Lottia gigantea]
Length=134

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 60/106 (57%), Gaps = 1/106 (1%)
 Frame = -3

Query  524  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDE  348
             QL + VS F    Q    Q++N +V E+  + K      D+ VP+EV + ID+GKNP+ 
Sbjct  20   RQLGIIVSDFQPQGQNVLNQKINTMVTEMQEIEKFRPLLQDVHVPLEVFNYIDEGKNPNL  79

Query  347  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            +T+D L   + KN+  KGK D  K  +  L+ EL + FP+E+  YR
Sbjct  80   YTKDCLEKALDKNENVKGKMDNLKRFKGLLMVELTKVFPNEMNMYR  125



>gb|KFD52471.1| hypothetical protein M513_06668 [Trichuris suis]
 gb|KFD68995.1| hypothetical protein M514_06668 [Trichuris suis]
Length=223

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -3

Query  572  NLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNL-AKLAEKCDIQV  396
            NL Q   S++  +    QL +  S F A+SQ    Q++ A+   L +L +K ++  D++V
Sbjct  96   NLEQ---SLEALIENTRQLCMVASDFQASSQSVLNQKLQAITSGLQDLDSKKSKFHDVKV  152

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            P+E+L  +D GKNP  +TRD +   +AKN+    K D +K  R  LL EL E FP E   
Sbjct  153  PIELLEYVDSGKNPQLYTRDCIERTVAKNKELNSKIDQYKKFRCMLLSELTEEFPKETIQ  212

Query  215  YRMSR  201
            YR  R
Sbjct  213  YRTIR  217



>ref|XP_005294660.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chrysemys picta bellii]
 ref|XP_008171223.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chrysemys picta bellii]
Length=267

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 1/118 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  145  LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  204

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++  Y+  R 
Sbjct  205  DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELTKVFPEDMAKYKAIRG  262



>ref|XP_002732894.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Saccoglossus kowalevskii]
Length=139

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = -3

Query  521  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVPMEVLSLIDDGKNPDEF  345
            Q+ + VS F    Q    Q+++ ++  + ++ K  A   D+ VP+EV   ID G+NP  +
Sbjct  23   QMGIIVSDFQPQGQNVLNQKIHNMISGMKDIDKCKASVQDVNVPLEVFEYIDQGRNPQLY  82

Query  344  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSR  201
            T+D +   +AKN+  KGK D FK  +  L++EL + FP+E+E Y+  R
Sbjct  83   TKDCMEKALAKNEQVKGKIDTFKRFKTLLVNELNKMFPEEIEKYKSLR  130



>ref|NP_001188215.1| mediator of RNA polymerase II transcription subunit 10 [Ictalurus 
punctatus]
 gb|ADO29276.1| mediator of RNA polymerase II transcription subunit 10 [Ictalurus 
punctatus]
Length=134

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 65/114 (57%), Gaps = 1/114 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+E    I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQTGLNQKLNLMITGLQDIEKCRQQLNDIHVPLEAFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ EL + FP+E+  Y+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLISELGKVFPEEMAKYK  125



>gb|KIH45973.1| mediator of RNA polymerase II transcription subunit 10 family 
protein [Ancylostoma duodenale]
Length=150

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 69/124 (56%), Gaps = 1/124 (1%)
 Frame = -3

Query  569  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEK-CDIQVP  393
             NQ+  ++++       L +  + F A SQ PF Q+++ LV  L  L ++  +  D++VP
Sbjct  22   FNQLERTLEQFQENARHLGVIATDFGARSQEPFNQKIHTLVSGLQELDQMRNQFADVKVP  81

Query  392  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAY  213
            +E+L ++D GKNP  +T++VL   + KN+   GK + +K     LL EL E  P++   Y
Sbjct  82   LELLDVLDQGKNPQLYTKEVLERTLQKNKEVNGKVETYKKFHAALLKELGEEMPEDTMTY  141

Query  212  RMSR  201
            R  R
Sbjct  142  RNIR  145



>emb|CDW52045.1| UPF0203 and Med10 domain containing protein [Trichuris trichiura]
Length=242

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -3

Query  572  NLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNL-AKLAEKCDIQV  396
            NL Q   S++  +    QL +  S F A+SQ    Q++ A+   L +L +K ++  D++V
Sbjct  115  NLEQ---SLEALIENTRQLCMVASDFQASSQSVLNQKLQAITNGLQDLDSKKSKFHDVKV  171

Query  395  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEA  216
            P+E+L  +D GKNP  +TRD +   +AKN+    K D +K  R  LL EL E FP E   
Sbjct  172  PIELLEYVDSGKNPQLYTRDCIERTVAKNKELNSKIDQYKKFRCMLLSELTEEFPKETIQ  231

Query  215  YRMSR  201
            YR  R
Sbjct  232  YRTIR  236



>gb|KIH63536.1| mediator of RNA polymerase II transcription subunit 10 family 
protein [Ancylostoma duodenale]
Length=120

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -3

Query  521  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEK-CDIQVPMEVLSLIDDGKNPDEF  345
             L +  + F A SQ PF Q+++ LV  L  L ++  +  D++VP+E+L ++D GKNP  +
Sbjct  8    HLGVIATDFGARSQEPFNQKIHTLVSGLQELDQMRNQFADVKVPLELLDVLDQGKNPQLY  67

Query  344  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSR  201
            T++VL   + KN+   GK + +K     LL EL E  P++   YR  R
Sbjct  68   TKEVLERTLQKNKEVNGKVETYKKFHAALLKELGEEMPEDTMTYRNIR  115



>ref|XP_007563794.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Poecilia formosa]
 ref|XP_008419649.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Poecilia reticulata]
Length=134

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAVLNQKLNFMISGLQDIDKCQKQLHDINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ EL + FP+E+  Y+  R   
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISELSKVFPEEMAKYKDIRGED  131

Query  191  A  189
             
Sbjct  132  G  132



>ref|XP_003690347.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Apis florea]
Length=131

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + VS F    Q    Q+  +LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKNVSLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELTRVFPQELAKYRAIRG  129



>ref|XP_004315303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Tursiops truncatus]
Length=135

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 68/123 (55%), Gaps = 1/123 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + V  F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVRDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  + ++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYNKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYR  210
             YR
Sbjct  123  KYR  125



>ref|XP_005809155.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Xiphophorus maculatus]
Length=134

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 67/117 (57%), Gaps = 1/117 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAVLNQKLNFMISGLQDIDKCQKQLHDINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSR  201
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ EL + FP+E+  Y+  R
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISELSKVFPEEMAKYKDIR  128



>emb|CDJ97162.1| Mediator complex domain containing protein [Haemonchus contortus]
Length=150

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 70/124 (56%), Gaps = 1/124 (1%)
 Frame = -3

Query  569  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVP  393
             NQ+  ++++       L +  + F A SQ PF Q+++ L+  L  L ++ ++  D++VP
Sbjct  22   FNQLERTLEQFQENARHLGVIATDFGARSQEPFNQKIHTLISGLQELDQMRSQFMDVKVP  81

Query  392  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAY  213
            +E+L ++D GKNP  +T++VL   + KN+   GK + +K     LL EL E  P++   Y
Sbjct  82   LELLDVLDQGKNPQLYTKEVLERTLQKNKEVNGKVETYKKFHAALLKELGEEMPEDTMTY  141

Query  212  RMSR  201
            R  R
Sbjct  142  RNIR  145



>ref|XP_010733995.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Larimichthys crocea]
 ref|XP_010733996.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Larimichthys crocea]
Length=134

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ EL + FP+E+  Y+      
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISELSKVFPEEMSNYKAIHGED  131

Query  191  A  189
            A
Sbjct  132  A  132



>ref|XP_008302435.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Stegastes partitus]
Length=134

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ EL + FP+E+  Y+      
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISELSKVFPEEMAKYKAIHGED  131

Query  191  A  189
            A
Sbjct  132  A  132



>ref|XP_003443822.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Oreochromis niloticus]
 ref|XP_004563717.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Maylandia zebra]
 ref|XP_005745529.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Pundamilia nyererei]
 ref|XP_005937339.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Haplochromis burtoni]
 ref|XP_006806718.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Neolamprologus brichardi]
Length=134

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 1/121 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ EL + FP+E+  Y+      
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTLTKFKSLLVSELSKVFPEEMAKYKAIHGED  131

Query  191  A  189
            A
Sbjct  132  A  132



>ref|XP_011310696.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Fopius arisanus]
Length=131

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 1/111 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + ++ + VS      Q     ++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRRIRIIVSDVQPQGQTVLNSKIQGLVTGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRA  198
             +T+D +   + KN+  KGK DA++  + ++L EL   FP+E+  YR  R 
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELNRVFPNELAKYRQIRG  129



>ref|XP_007231771.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Astyanax mexicanus]
Length=134

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 65/114 (57%), Gaps = 1/114 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + Q+ + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+E    I
Sbjct  12   LEKFIENIRQMGIIVSDFQPSSQTGLNQKLNFMITGLQDVEKCRQQLNDIHVPLEAFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ EL + FP+E+  Y+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLITELGKVFPEEMAKYK  125



>ref|XP_008487303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Diaphorina citri]
 ref|XP_008487304.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Diaphorina citri]
Length=94

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -3

Query  443  ELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRK  264
            E+D L    +  DI VP+EV   ID G+NP  +T+D +   + KN+  KGK DA++  + 
Sbjct  7    EIDKLKSQVQ--DIHVPLEVFDYIDQGRNPQLYTKDCIEKALTKNEQVKGKIDAYRKFKA  64

Query  263  HLLDELEEAFPDEVEAYRMSRA  198
            H+L EL  AFP+E+  YR  R 
Sbjct  65   HMLVELSGAFPNELAKYRAIRG  86



>ref|XP_004017144.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ovis aries]
Length=135

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 68/127 (54%), Gaps = 1/127 (1%)
 Frame = -3

Query  575  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  399
            +  + +   ++K +  + QL + VS    +SQ      +N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDLQPSSQAGLPPTLNFIVTGLQDIDKCRQQLHDIT  62

Query  398  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVE  219
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ EL + FP+++ 
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMA  122

Query  218  AYRMSRA  198
             YR  R 
Sbjct  123  KYRSIRG  129



>ref|XP_002024961.1| GL17837 [Drosophila persimilis]
 ref|XP_001352539.2| GA18625 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW30434.1| GL17837 [Drosophila persimilis]
 gb|EAL30036.2| GA18625 [Drosophila pseudoobscura pseudoobscura]
Length=133

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 2/114 (2%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVL-SLIDDGKNP  354
            + Q+ + VS F    Q    Q++N+LV  L  + KL  +  D+ VP EV    ID  KNP
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKINSLVTGLQEIDKLRNQVQDVYVPFEVFFDYIDQDKNP  78

Query  353  DEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATS  192
              +T+D +   +AKN+  KGK ++ K  + +LL EL + FP+E+ +YR  R  S
Sbjct  79   QLYTKDCVEKALAKNEEVKGKIESLKKFKSNLLLELYKTFPNEMNSYRAYRKDS  132



>ref|XP_010871525.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Esox lucius]
Length=134

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 66/114 (58%), Gaps = 1/114 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + Q+ + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+E    I
Sbjct  12   LEKFVENIRQMGIIVSDFQPSSQTGLNQKLNFMITGLQDIEKCRQQLHEINVPLEAFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ EL +AFP+E+  Y+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLISELGKAFPEEMAKYK  125



>ref|XP_001951882.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Acyrthosiphon pisum]
Length=240

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 1/121 (1%)
 Frame = -3

Query  527  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  351
            + Q+ + V+ F    Q    Q++   V  L  + KL     DI VP+EV   ID G+NP 
Sbjct  24   VRQIRIIVADFQPQGQTVLNQKIQNAVTGLQEINKLKSNVQDIHVPLEVFEYIDRGRNPQ  83

Query  350  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYRMSRATSAAEAKQL  171
             +T+D +   + KN+  KGK DA K  + ++L +L + FP+E+  YR  R+     +  +
Sbjct  84   LYTKDCIEKALHKNEQVKGKIDALKKFKANVLTDLGQTFPNELNKYRALRSNCYGTSSVV  143

Query  170  A  168
            A
Sbjct  144  A  144



>ref|NP_001291005.1| mediator complex subunit 10 [Esox lucius]
 gb|ACO13813.1| Mediator of RNA polymerase II transcription subunit 10 [Esox 
lucius]
Length=140

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 66/114 (58%), Gaps = 1/114 (1%)
 Frame = -3

Query  548  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  372
            ++K +  + Q+ + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+E    I
Sbjct  12   LEKFVENIRQMGIIVSDFQPSSQTGLNQKLNFMITGLQDIEKCRQQLHEINVPLEAFEYI  71

Query  371  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDELEEAFPDEVEAYR  210
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ EL +AFP+E+  Y+
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKVDTMTKFKSLLISELGKAFPEEMAKYK  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340