BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005I13

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like    47.8    1e-04   Solanum tuberosum [potatoes]
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...  46.2    4e-04   Nicotiana tomentosiformis
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         45.4    8e-04   Solanum lycopersicum
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like    45.4    0.001   Nicotiana sylvestris



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -3

Query  284  MAKSGSDPKAAVISGGAMGEVEKVFRKFDSNGDGCVNFEEF  162
            M K+ SD K  ++S   M EVEKVFRKFD+NGDG ++  E 
Sbjct  1    MDKTPSDSKQPIVSSAEMDEVEKVFRKFDANGDGKISLSEL  41



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -3

Query  284  MAKSGSDPKAAVISGGAMGEVEKVFRKFDSNGDGCVNFEEF  162
            MAK+ SD K   +S   M EV KVFRKFD+NGDG ++  E 
Sbjct  1    MAKTPSDSKEPAVSAAEMDEVAKVFRKFDANGDGKISLSEL  41



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -3

Query  284  MAKSGSDPKAAVISGGAMGEVEKVFRKFDSNGDGCVNFEEF  162
            MAK+ SD K   +S   M  VEKVFRKFD+NGDG ++  E 
Sbjct  1    MAKTPSDSKQPAVSSAEMDGVEKVFRKFDANGDGKISLSEL  41



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -3

Query  284  MAKSGSDPKAAVISGGAMGEVEKVFRKFDSNGDGCVNFEEF  162
            MAK+ +D K   +S   M EV KVFRKFD+NGDG ++  E 
Sbjct  1    MAKTPTDSKEPAVSTAEMDEVAKVFRKFDTNGDGKISLSEL  41



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562698116640