BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005G07

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          374   2e-127   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     374   3e-127   Solanum tuberosum [potatoes]
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     370   8e-126   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     370   1e-125   Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     370   1e-125   Nicotiana tomentosiformis
ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     369   3e-125   Nicotiana sylvestris
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    369   4e-125   Solanum tuberosum [potatoes]
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     368   8e-125   Sesamum indicum [beniseed]
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                365   6e-124   Erythranthe guttata [common monkey flower]
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          359   2e-121   Prunus mume [ume]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     358   3e-121   Cucumis sativus [cucumbers]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     358   4e-121   Pyrus x bretschneideri [bai li]
gb|EPS61043.1|  hypothetical protein M569_13757                         358   5e-121   Genlisea aurea
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             358   6e-121   Prunus persica
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             357   1e-120   Phaseolus vulgaris [French bean]
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          357   1e-120   Cucumis melo [Oriental melon]
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     357   1e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          356   3e-120   Vitis vinifera
gb|KHN31904.1|  Proteasome subunit beta type-5                          355   6e-120   Glycine soja [wild soybean]
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        352   6e-120   Prunus persica
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    355   6e-120   Glycine max [soybeans]
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     355   7e-120   
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     355   8e-120   Glycine max [soybeans]
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             354   1e-119   Capsella rubella
gb|ACP43315.1|  20S proteasome beta subunit 5                           354   1e-119   Citrus maxima [buntan]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    354   1e-119   Citrus sinensis [apfelsine]
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     354   1e-119   Fragaria vesca subsp. vesca
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             354   1e-119   Citrus clementina [clementine]
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             353   2e-119   Eutrema salsugineum [saltwater cress]
gb|KHG05622.1|  Proteasome subunit beta type-5                          353   3e-119   Gossypium arboreum [tree cotton]
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         353   3e-119   Jatropha curcas
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    353   3e-119   
gb|ACP43316.1|  20S proteasome beta subunit 5                           350   4e-119   Citrus maxima [buntan]
gb|ACU23791.1|  unknown                                                 353   5e-119   Glycine max [soybeans]
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     353   6e-119   Nelumbo nucifera [Indian lotus]
gb|KJB15718.1|  hypothetical protein B456_002G192400                    352   6e-119   Gossypium raimondii
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          352   8e-119   Nelumbo nucifera [Indian lotus]
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          352   9e-119   Pyrus x bretschneideri [bai li]
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     352   9e-119   Phoenix dactylifera
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          352   9e-119   
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        352   1e-118   Eucalyptus grandis [rose gum]
emb|CDY34594.1|  BnaC03g56940D                                          352   2e-118   Brassica napus [oilseed rape]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     351   3e-118   Elaeis guineensis
emb|CDX98014.1|  BnaA06g07650D                                          351   3e-118   
gb|KHG25400.1|  Proteasome subunit beta type-5                          351   3e-118   Gossypium arboreum [tree cotton]
emb|CDY19402.1|  BnaC05g09110D                                          351   3e-118   Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        350   4e-118   Brassica rapa
gb|KJB78067.1|  hypothetical protein B456_012G175200                    350   4e-118   Gossypium raimondii
emb|CDP13326.1|  unnamed protein product                                353   4e-118   Coffea canephora [robusta coffee]
emb|CDY21081.1|  BnaA08g24440D                                          350   5e-118   Brassica napus [oilseed rape]
gb|AFK46055.1|  unknown                                                 350   5e-118   Lotus japonicus
ref|XP_010105786.1|  Proteasome subunit beta type-5                     350   7e-118   Morus notabilis
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             350   1e-117   
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             349   1e-117   Eutrema salsugineum [saltwater cress]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    349   1e-117   Brassica rapa
emb|CDY16054.1|  BnaC08g40690D                                          349   2e-117   Brassica napus [oilseed rape]
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        349   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     349   2e-117   Phoenix dactylifera
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    349   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_003602092.1|  Proteasome subunit beta type                       348   2e-117   Medicago truncatula
gb|AFK34329.1|  unknown                                                 348   4e-117   Medicago truncatula
ref|NP_189265.1|  proteasome subunit beta type-5-B                      348   5e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    348   6e-117   Brassica rapa
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    346   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          346   2e-116   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY26610.1|  BnaA09g46670D                                          345   4e-116   Brassica napus [oilseed rape]
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    345   4e-116   Tarenaya hassleriana [spider flower]
ref|NP_172765.1|  20S proteasome beta subunit E1                        345   6e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          345   6e-116   
gb|AAK92808.1|  putative proteasome epsilon chain precursor             345   6e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             345   6e-116   Capsella rubella
ref|NP_001184978.1|  20S proteasome beta subunit E1                     346   7e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             344   1e-115   
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    344   1e-115   Brachypodium distachyon [annual false brome]
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     344   1e-115   Cucumis sativus [cucumbers]
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     343   2e-115   Elaeis guineensis
gb|ABK25888.1|  unknown                                                 343   2e-115   Picea sitchensis
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       344   3e-115   Cucumis sativus [cucumbers]
gb|EMS57921.1|  Proteasome subunit beta type-5                          342   3e-115   Triticum urartu
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    343   3e-115   Spinacia oleracea
gb|AAU82107.1|  20S proteasome beta 5 subunit                           343   5e-115   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    342   6e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    342   6e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        342   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        342   8e-115   Tarenaya hassleriana [spider flower]
dbj|BAJ97061.1|  predicted protein                                      342   8e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK25785.1|  unknown                                                 342   9e-115   Picea sitchensis
gb|AFK38197.1|  unknown                                                 342   1e-114   Medicago truncatula
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          340   5e-114   Sorghum bicolor [broomcorn]
ref|NP_001132821.1|  uncharacterized protein LOC100194311               340   8e-114   Zea mays [maize]
gb|ABE68720.1|  20S proteasome beta subunit                             337   2e-113   Arachis hypogaea [goober]
dbj|BAG92607.1|  unnamed protein product                                336   3e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    338   3e-113   Setaria italica
gb|EEE65108.1|  hypothetical protein OsJ_20167                          338   5e-113   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       337   9e-113   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       337   1e-112   
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    336   2e-112   Populus euphratica
ref|XP_002312631.2|  20S proteasome beta subunit family protein         336   2e-112   
gb|EEC80034.1|  hypothetical protein OsI_21721                          336   2e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    335   3e-112   Oryza brachyantha
gb|ACJ85344.1|  unknown                                                 334   6e-112   Medicago truncatula
ref|XP_002315619.1|  20S proteasome beta subunit family protein         333   3e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    332   1e-110   Populus euphratica
emb|CAC43326.1|  putative beta5 proteasome subunit                      325   1e-109   Nicotiana tabacum [American tobacco]
gb|ACU51028.1|  20S proteasome beta5 subunit                            323   4e-107   Conocephalum conicum
ref|XP_001759925.1|  predicted protein                                  321   2e-106   
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        343   5e-105   
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             316   2e-104   Selaginella moellendorffii
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             314   8e-104   Selaginella moellendorffii
ref|NP_001265983.1|  proteasome subunit beta type-5-like                310   1e-102   Cicer arietinum [garbanzo]
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     309   8e-102   Phoenix dactylifera
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     307   5e-101   Elaeis guineensis
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    300   3e-98    
ref|XP_001751936.1|  predicted protein                                  295   6e-97    
ref|XP_003061052.1|  predicted protein                                  289   6e-94    Micromonas pusilla CCMP1545
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    290   8e-94    Ostreococcus tauri
ref|XP_002506817.1|  predicted protein                                  287   4e-93    Micromonas commoda
ref|XP_007514496.1|  predicted protein                                  286   4e-92    Bathycoccus prasinos
ref|XP_001421201.1|  predicted protein                                  283   3e-91    Ostreococcus lucimarinus CCE9901
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         278   5e-90    
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              274   4e-88    Chlorella variabilis
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         273   1e-87    Coccomyxa subellipsoidea C-169
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   266   9e-87    Brassica napus [oilseed rape]
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              269   4e-86    Volvox carteri f. nagariensis
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         267   3e-85    Chlamydomonas reinhardtii
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   262   2e-83    Auxenochlorella protothecoides
gb|KDD75121.1|  proteasome subunit protein                              256   1e-81    Helicosporidium sp. ATCC 50920
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              256   2e-81    Helobdella robusta
gb|EIE87710.1|  proteasome component PRE2                               252   1e-80    Rhizopus delemar RA 99-880
ref|XP_792356.3|  PREDICTED: proteasome subunit beta type-5-like        251   4e-80    
gb|EIE77859.1|  proteasome component PRE2                               253   5e-80    Rhizopus delemar RA 99-880
emb|CEG76257.1|  Putative Proteasome subunit beta type                  253   6e-80    Rhizopus microsporus
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             253   6e-80    Lottia gigantea
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like     252   2e-79    Aplysia californica
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like     250   5e-79    Latimeria chalumnae
gb|AAI55951.1|  LOC100127332 protein                                    249   7e-79    Xenopus laevis [clawed frog]
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  250   2e-78    
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          249   2e-78    Xenopus tropicalis [western clawed frog]
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like     249   3e-78    Crassostrea gigas
ref|XP_002678668.1|  predicted protein                                  249   4e-78    Naegleria gruberi strain NEG-M
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5          248   5e-78    Python bivittatus
gb|KFH71396.1|  20S proteasome subunit beta 5                           248   5e-78    Mortierella verticillata NRRL 6337
gb|AAL74417.1|  proteosome PSMB5/8 protein                              245   7e-78    Branchiostoma lanceolatum [common lancelet]
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              248   7e-78    Batrachochytrium dendrobatidis JAM81
gb|AAY98499.1|  LMP X                                                   248   7e-78    Swiftia exserta
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    245   9e-78    Mus musculus [mouse]
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 248   1e-77    Guillardia theta CCMP2712
gb|ADQ00176.1|  20S proteasome beta subunit E type beta 5               244   1e-77    Chlamydomonas sp. ICE-L
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    246   2e-77    
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          247   2e-77    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     246   3e-77    Saccoglossus kowalevskii
ref|XP_004994692.1|  LMP X protein                                      247   3e-77    Salpingoeca rosetta
gb|AAM18885.1|AF391293_2  unknown                                       246   3e-77    Branchiostoma floridae
emb|CAA66313.1|  LMP7-like protein                                      245   4e-77    Botryllus schlosseri
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  243   4e-77    Homo sapiens [man]
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    243   5e-77    Bos taurus [bovine]
emb|CAA66312.1|  LMP7-like protein                                      246   6e-77    Geodia cydonium
gb|EPY87607.1|  proteasome subunit beta type-5-like isoform 1           243   6e-77    Camelus ferus
dbj|BAA08204.1|  proteasome subunit RCX                                 243   6e-77    Rattus rattus [house rat]
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    246   7e-77    Capsaspora owczarzaki ATCC 30864
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          245   7e-77    Dasypus novemcinctus
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    243   7e-77    synthetic construct
emb|CDH56820.1|  20s proteasome subunit                                 245   8e-77    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002179855.1|  predicted protein                                  246   8e-77    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          245   8e-77    Stegastes partitus
dbj|BAA06097.1|  proteasome subunit X                                   243   9e-77    Homo sapiens [man]
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  245   9e-77    Capitella teleta
ref|XP_001730616.1|  hypothetical protein MGL_2412                      246   1e-76    Malassezia globosa CBS 7966
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    243   1e-76    
gb|ADL27419.1|  proteasome subunit beta type                            245   1e-76    Pheronema raphanus
dbj|GAM19629.1|  hypothetical protein SAMD00019534_028040               244   2e-76    Acytostelium subglobosum LB1
dbj|BAE93066.1|  low molecular mass polypeptide                         242   2e-76    Lethenteron camtschaticum [Japanese lamprey]
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          244   2e-76    Chrysochloris asiatica
emb|CEP17612.1|  hypothetical protein                                   244   3e-76    Parasitella parasitica
gb|EWM22648.1|  proteasome subunit beta type 5                          244   3e-76    Nannochloropsis gaditana
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          243   4e-76    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_001626004.1|  predicted protein                                  243   5e-76    Nematostella vectensis
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          243   5e-76    Loxodonta africana [African bush elephant]
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    241   5e-76    
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     243   5e-76    Hydra vulgaris
gb|EFA82937.1|  proteasome subunit beta type 5                          243   5e-76    Heterostelium album PN500
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          243   5e-76    Trichechus manatus latirostris
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          243   5e-76    Sarcophilus harrisii
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          241   5e-76    
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5          243   6e-76    Anolis carolinensis [Carolina anole]
gb|ELR56586.1|  Proteasome subunit beta type-5                          243   6e-76    Bos mutus
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    243   6e-76    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          243   6e-76    Ovis aries [domestic sheep]
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          243   6e-76    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     243   6e-76    Haplochromis burtoni
ref|NP_001032701.1|  proteasome subunit beta type-5                     243   7e-76    Bos taurus [bovine]
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          243   7e-76    Bubalus bubalis [domestic water buffalo]
ref|XP_001745267.1|  hypothetical protein                               242   7e-76    Monosiga brevicollis MX1
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    242   7e-76    Orycteropus afer afer
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     243   7e-76    Pundamilia nyererei
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     243   8e-76    
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          242   8e-76    Peromyscus maniculatus bairdii
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     243   8e-76    Oreochromis niloticus
ref|NP_035316.1|  proteasome subunit beta type-5                        242   8e-76    Mus musculus [mouse]
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    242   9e-76    Mus musculus [mouse]
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          242   9e-76    Callithrix jacchus [common marmoset]
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          242   9e-76    Saimiri boliviensis boliviensis
gb|ABQ50544.1|  hypothetical protein                                    241   9e-76    Brassica rapa
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     242   9e-76    Myotis brandtii
gb|ADO27969.1|  proteasome subunit beta type-5                          242   1e-75    Ictalurus furcatus
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          242   1e-75    Ailuropoda melanoleuca
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          242   1e-75    Monodelphis domestica
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          241   1e-75    Ursus maritimus [white bear]
gb|EFX81688.1|  hypothetical protein DAPPUDRAFT_303318                  242   1e-75    Daphnia pulex
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          241   1e-75    Felis catus [cat]
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 243   2e-75    Cyanidioschyzon merolae strain 10D
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    241   2e-75    Condylura cristata
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          241   2e-75    Rhinopithecus roxellana
ref|NP_001099197.2|  proteasome subunit beta type-5                     241   2e-75    Rattus norvegicus [brown rat]
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5          241   2e-75    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005707411.1|  20S proteasome subunit beta 5                      242   2e-75    Galdieria sulphuraria
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    241   2e-75    Lipotes vexillifer [baiji]
gb|AAW24786.1|  SJCHGC05978 protein                                     241   2e-75    Schistosoma japonicum
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    241   2e-75    Physeter catodon
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          241   2e-75    Vicugna pacos
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          241   2e-75    Myotis lucifugus
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    241   2e-75    
dbj|BAA10935.1|  nurse shark LMPX                                       241   2e-75    Ginglymostoma cirratum
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          241   2e-75    Odobenus rosmarus divergens
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    241   2e-75    Rattus norvegicus [brown rat]
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          241   2e-75    
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              241   2e-75    Trichoplax adhaerens
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    241   2e-75    Eptesicus fuscus
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     242   2e-75    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Myotis davidii
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              241   3e-75    Homo sapiens [man]
gb|ETE64662.1|  Proteasome subunit beta type-5                          242   3e-75    Ophiophagus hannah
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    241   3e-75    Orcinus orca [Orca]
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Camelus ferus
ref|NP_001247774.1|  proteasome subunit beta type-5                     241   3e-75    Macaca mulatta [rhesus macaque]
emb|CAD97956.1|  hypothetical protein                                   241   3e-75    Homo sapiens [man]
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Balaenoptera acutorostrata scammoni
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    241   3e-75    Gorilla gorilla gorilla [lowland gorilla]
gb|EPY26658.1|  20S proteasome subunit beta 5                           239   3e-75    Angomonas deanei
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Cavia porcellus [guinea pig]
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    241   3e-75    Chlorocebus sabaeus
gb|EPB87271.1|  proteasome component PRE2                               241   3e-75    Mucor circinelloides f. circinelloides 1006PhL
emb|CAF97719.1|  unnamed protein product                                241   3e-75    Tetraodon nigroviridis
dbj|GAN10935.1|  20S proteasome subunit                                 241   3e-75    Mucor ambiguus
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Tupaia chinensis
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    241   3e-75    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Pteropus alecto
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Equus przewalskii [Przewalski horse]
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    241   3e-75    
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          241   3e-75    Galeopterus variegatus [Malayan flying lemur]
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    241   3e-75    Oryctolagus cuniculus [domestic rabbit]
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          241   4e-75    Cricetulus griseus [Chinese hamsters]
ref|XP_001568804.1|  putative proteasome beta 5 subunit                 242   4e-75    Leishmania braziliensis MHOM/BR/75/M2904
gb|KGB40340.1|  Proteasome subunit beta type-5                          239   4e-75    Schistosoma haematobium
dbj|BAB26942.1|  unnamed protein product                                241   4e-75    Mus musculus [mouse]
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          240   4e-75    Microtus ochrogaster [prairie voles]
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          240   5e-75    Canis lupus familiaris [dogs]
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          240   5e-75    
dbj|BAA10932.1|  LMPX of lamprey                                        241   5e-75    Petromyzon marinus [marine lamprey]
ref|XP_010703107.1|  proteasome beta 5 subunit, putative                241   5e-75    Leishmania panamensis
emb|CBY21147.1|  unnamed protein product                                241   5e-75    Oikopleura dioica
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          241   5e-75    Sus scrofa [pigs]
gb|AAB33092.1|  proteasome subunit MB1                                  238   5e-75    Homo sapiens [man]
gb|KFH65162.1|  20S proteasome subunit beta 5                           241   5e-75    Mortierella verticillata NRRL 6337
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          240   5e-75    Carlito syrichta
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          240   7e-75    Myotis brandtii
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    240   7e-75    Pantholops hodgsonii [Tibetan antelope]
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          240   8e-75    Fukomys damarensis [Damara mole rat]
gb|EFX80663.1|  hypothetical protein DAPPUDRAFT_303852                  240   8e-75    Daphnia pulex
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          240   8e-75    Ochotona princeps [southern American pika]
ref|XP_004054985.1|  PREDICTED: proteasome subunit beta type-5 is...    240   8e-75    
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          239   8e-75    Octodon degus
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like     240   8e-75    
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             225   8e-75    
emb|CAX70714.1|  proteasome (prosome, macropain) subunit, beta ty...    239   1e-74    Schistosoma japonicum
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          239   1e-74    Nannospalax galili
gb|EPY20654.1|  20S proteasome subunit beta 5                           241   1e-74    Strigomonas culicis
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5          239   1e-74    
gb|ERE89366.1|  proteasome subunit beta type-5-like protein             241   1e-74    Cricetulus griseus [Chinese hamsters]
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                238   1e-74    
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    239   1e-74    
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          239   1e-74    
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          239   2e-74    
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          239   2e-74    
ref|XP_001686739.1|  putative proteasome beta 5 subunit                 240   2e-74    
ref|XP_009311762.1|  proteasome beta 5 subunit                          240   2e-74    
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    238   2e-74    
gb|EPY31554.1|  20S proteasome subunit beta 5                           238   3e-74    
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          238   3e-74    
ref|XP_006261242.1|  PREDICTED: proteasome subunit beta type-5          238   3e-74    
ref|XP_004358358.1|  proteasome subunit beta type 5                     239   3e-74    
ref|XP_001469755.1|  putative proteasome beta 5 subunit                 239   4e-74    
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5          238   4e-74    
gb|EJK48257.1|  hypothetical protein THAOC_32963                        237   4e-74    
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     238   5e-74    
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          238   5e-74    
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          238   5e-74    
ref|XP_011391773.1|  putative proteasome core particle subunit be...    238   6e-74    
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          238   6e-74    
ref|XP_002050049.1|  GJ21921                                            238   6e-74    
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          237   7e-74    
gb|EPY36607.1|  20S proteasome subunit beta 5                           239   7e-74    
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               239   7e-74    
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like     238   7e-74    
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 238   8e-74    
dbj|BAA10934.1|  LMP7                                                   238   8e-74    
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         238   8e-74    
gb|AGG11598.1|  hypothetical protein                                    238   8e-74    
ref|XP_010571771.1|  PREDICTED: proteasome subunit beta type-5          234   1e-73    
dbj|BAO50694.1|  proteasome subunit beta type 8,F-type                  234   1e-73    
ref|XP_003874511.1|  putative proteasome beta 5 subunit                 238   1e-73    
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      239   1e-73    
emb|CCC93748.1|  proteasome beta 5 subunit                              238   1e-73    
gb|ABQ22856.1|  proteasome subunit beta type 5 precursor-like pro...    233   1e-73    
gb|AAF37285.1|AF226674_1  20S proteasome beta 5 subunit                 236   2e-73    
ref|XP_003287743.1|  proteasome subunit beta type 5                     236   2e-73    
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           236   2e-73    
gb|KFM59336.1|  Proteasome subunit beta type-5                          236   2e-73    
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    236   2e-73    
gb|EPQ17641.1|  Proteasome subunit beta type-5                          239   2e-73    
ref|NP_001270574.1|  uncharacterized protein LOC101865806               236   2e-73    
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     236   2e-73    
gb|AAI53590.1|  Psmb5 protein                                           236   3e-73    
gb|AAC97957.2|  proteasome beta 5 subunit                               236   3e-73    
gb|AGG11403.1|  hypothetical protein                                    237   3e-73    
ref|XP_628966.1|  proteasome subunit beta type 5                        236   3e-73    
dbj|BAM21000.1|  proteasome subunit beta type-8                         234   3e-73    
emb|CCC51553.1|  putative proteasome beta 5 subunit, fragment           236   3e-73    
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    238   3e-73    
ref|XP_002033298.1|  GM21240                                            236   4e-73    
ref|XP_002080955.1|  GD10758                                            236   4e-73    
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    235   5e-73    
ref|NP_571226.1|  proteasome subunit beta type-5                        235   5e-73    
gb|AAL59862.1|AF363583_1  proteasome beta-subunit LMP7                  235   7e-73    
dbj|BAO50685.1|  proteasome subunit beta type 8,F-type                  232   1e-72    
emb|CBN74512.1|  conserved unknown protein                              235   1e-72    
ref|XP_008036606.1|  proteasome component pts1                          236   1e-72    
ref|XP_822850.1|  proteasome subunit beta 5                             236   1e-72    
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    
ref|XP_810086.1|  proteasome beta 5 subunit                             235   2e-72    
dbj|BAO50692.1|  proteasome subunit beta type 8,A-type                  232   2e-72    
dbj|BAO50697.1|  proteasome subunit beta type 8,F-type                  232   2e-72    
ref|XP_008543771.1|  PREDICTED: proteasome subunit beta type-5          234   2e-72    
ref|XP_002063746.1|  GK15836                                            234   2e-72    
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    236   2e-72    
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             234   2e-72    
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      235   3e-72    
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     233   3e-72    
gb|AAF26416.1|AF217726_1  20S proteasome beta5 subunit                  234   3e-72    
ref|NP_652014.1|  proteasome beta5 subunit, isoform A                   234   3e-72    
gb|ESL07999.1|  proteasome beta 5 subunit                               234   3e-72    
ref|XP_810804.1|  proteasome beta 5 subunit                             234   4e-72    
gb|ESS68038.1|  proteasome beta 5 subunit                               234   4e-72    
dbj|BAA10933.1|  LMP7 of nurse shark                                    233   4e-72    
gb|EKG04000.1|  proteasome beta 5 subunit, putative                     234   4e-72    
ref|XP_011184652.1|  PREDICTED: proteasome subunit beta type-5-like     233   4e-72    
gb|EKF32460.1|  proteasome beta 5 subunit, putative                     234   5e-72    
ref|XP_007418509.1|  20S proteasome subunit                             233   6e-72    
dbj|BAO50693.1|  proteasome subunit beta type 8,F-type                  230   6e-72    
ref|XP_007863011.1|  20S proteasome subunit                             234   7e-72    
ref|XP_001961263.1|  GF13778                                            233   7e-72    
gb|AGM32352.1|  proteasome subunit beta type-5-like protein             233   8e-72    
ref|XP_001361733.1|  GA11556                                            233   8e-72    
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    233   9e-72    
ref|XP_394680.3|  PREDICTED: proteasome subunit beta type-5-like        233   1e-71    
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              234   1e-71    
emb|CAA40494.1|  proteasome C1 subunit                                  229   1e-71    
ref|XP_001986559.1|  GH20460                                            232   1e-71    
dbj|BAO50687.1|  proteasome subunit beta type 8,F-type                  229   1e-71    
dbj|BAA10931.1|  LMPX of hagfish                                        232   1e-71    
ref|XP_003694700.1|  PREDICTED: proteasome subunit beta type-5-like     232   1e-71    
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              233   1e-71    
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  233   1e-71    
ref|XP_011182734.1|  PREDICTED: proteasome subunit beta type-5-like     231   2e-71    
gb|KDE05583.1|  proteasome component PRE2                               233   2e-71    
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    233   2e-71    
gb|AJK90586.1|  20S proteasome beta5 subunit                            231   2e-71    
ref|XP_001976166.1|  GG20151                                            232   2e-71    
dbj|BAO49776.1|  proteasome subunit beta type 8,A-type-A                228   2e-71    
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               233   2e-71    
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   232   3e-71    
ref|NP_001264655.1|  proteasome subunit beta type-5                     230   3e-71    
ref|XP_003332961.2|  20S proteasome subunit beta 5                      231   3e-71    
ref|XP_003394930.1|  PREDICTED: proteasome subunit beta type-5-like     231   3e-71    
ref|XP_011214452.1|  PREDICTED: proteasome subunit beta type-5-like     231   3e-71    
ref|XP_002090364.1|  Prosbeta5                                          231   3e-71    
ref|XP_003488646.1|  PREDICTED: proteasome subunit beta type-5-like     231   3e-71    
ref|XP_002005785.1|  GI18886                                            231   4e-71    
gb|EJU05281.1|  proteasome-domain-containing protein                    232   4e-71    
sp|P34065.2|PSB5_CHICK  RecName: Full=Proteasome subunit beta typ...    230   4e-71    
ref|XP_007850837.1|  proteasome component pre2 precursor                231   4e-71    
gb|ACI66984.1|  Proteasome subunit beta type-8 precursor                231   4e-71    
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              232   4e-71    
emb|CDQ73245.1|  unnamed protein product                                230   5e-71    
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                230   5e-71    
ref|NP_001017791.1|  proteasome subunit beta type 8                     230   5e-71    
dbj|BAO50689.1|  proteasome subunit beta type 8,A-type                  228   5e-71    
emb|CCM00020.1|  predicted protein                                      231   5e-71    
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     230   6e-71    
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  231   6e-71    
ref|XP_011351485.1|  PREDICTED: proteasome subunit beta type-5          230   7e-71    
dbj|BAO50684.1|  proteasome subunit beta type 8,A-type                  228   7e-71    
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                230   7e-71    
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   231   8e-71    
ref|XP_011206211.1|  PREDICTED: proteasome subunit beta type-5-like     230   8e-71    
ref|XP_005188727.1|  PREDICTED: proteasome subunit beta type-5          230   8e-71    
gb|ACN10160.1|  Proteasome subunit beta type-8 precursor                231   9e-71    
gb|EFN77251.1|  Proteasome subunit beta type-5                          230   9e-71    
dbj|BAM20999.1|  proteasome subunit beta type-8                         228   1e-70    
ref|XP_011150435.1|  PREDICTED: proteasome subunit beta type-5          230   1e-70    
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  231   1e-70    
dbj|BAO50690.1|  proteasome subunit beta type 8,A-type                  227   1e-70    
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   230   1e-70    
gb|ETS60462.1|  hypothetical protein PaG_05302                          236   1e-70    
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                229   2e-70    
ref|XP_004534832.1|  PREDICTED: proteasome subunit beta type-5-like     229   2e-70    
gb|AAL59861.1|AF363582_1  proteasome beta-subunit LMP7-like protein     229   2e-70    
ref|NP_001158688.1|  Proteasome subunit beta type 8                     229   2e-70    
emb|CAN13318.1|  proteasome (prosome, macropain) subunit, beta ty...    226   2e-70    
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  226   2e-70    
dbj|BAM20998.1|  proteasome subunit beta type-8                         227   2e-70    
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     229   2e-70    
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  230   2e-70    
ref|XP_011502385.1|  PREDICTED: proteasome subunit beta type-5          228   2e-70    
ref|XP_006619720.1|  PREDICTED: proteasome subunit beta type-5-like     229   3e-70    
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  229   3e-70    
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   230   3e-70    
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 229   3e-70    
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  229   3e-70    
emb|CCW60032.1|  unnamed protein product                                229   3e-70    
ref|XP_011060822.1|  PREDICTED: proteasome subunit beta type-5          229   3e-70    
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  229   3e-70    
ref|XP_970194.1|  PREDICTED: proteasome subunit beta type-5             228   4e-70    
emb|CCO27714.1|  20S proteasome subunit beta 5                          229   4e-70    
ref|XP_006001021.1|  PREDICTED: proteasome subunit beta type-8-like     228   4e-70    
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             229   4e-70    
gb|EMS25821.1|  20S proteasome subunit beta 5                           229   5e-70    
gb|ACM09015.1|  Proteasome subunit beta type-5 precursor                228   5e-70    
dbj|BAO50691.1|  proteasome subunit beta type 8,A-type                  225   5e-70    
ref|XP_011163166.1|  PREDICTED: proteasome subunit beta type-5          228   6e-70    
ref|XP_002911819.1|  proteasome component pts1                          229   6e-70    
dbj|BAO50686.1|  proteasome subunit beta type 8,A-type                  225   6e-70    
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 228   6e-70    
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     225   6e-70    
ref|XP_001867951.1|  proteasome subunit beta type 8                     227   7e-70    
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              228   7e-70    
ref|XP_011254239.1|  PREDICTED: proteasome subunit beta type-5          228   7e-70    
emb|CEG76258.1|  Putative Proteasome subunit beta type                  226   8e-70    
gb|AAR09671.1|  similar to Drosophila melanogaster Prosbeta5            223   9e-70    
gb|ABQ22703.1|  proteasome subunit beta type 5 precursor-like pro...    223   1e-69    
gb|KDR22252.1|  Proteasome subunit beta type-5                          227   1e-69    
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   225   1e-69    
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537             226   1e-69    
dbj|BAO50688.1|  proteasome subunit beta type 8,F-type                  224   1e-69    
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  228   1e-69    
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   228   1e-69    
gb|ABI31729.1|  low molecular mass protein 7                            226   1e-69    
ref|XP_011309100.1|  PREDICTED: proteasome subunit beta type-5          227   1e-69    
gb|AEE61820.1|  unknown                                                 227   2e-69    
dbj|BAA19767.1|  LMP7                                                   225   2e-69    
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              228   2e-69    
ref|XP_007764597.1|  20S proteasome subunit                             228   2e-69    
ref|XP_001663403.1|  AAEL013236-PA                                      226   2e-69    
gb|ENN71488.1|  hypothetical protein YQE_11784                          226   2e-69    
ref|XP_007882652.1|  PREDICTED: proteasome subunit beta type-8-like     226   2e-69    
gb|KGG50522.1|  proteasome subunit beta type                            226   2e-69    
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  227   2e-69    
dbj|BAO00931.1|  proteasome subunit beta type 8,F-type                  226   2e-69    
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  227   3e-69    
ref|XP_003700810.1|  PREDICTED: proteasome subunit beta type-5-like     226   3e-69    
dbj|BAH05039.1|  proteasome subunit, beta type 8                        224   3e-69    
gb|EHJ72628.1|  proteasome subunit beta 5                               226   3e-69    
ref|XP_010866810.1|  PREDICTED: proteasome subunit beta type-8-like     226   3e-69    
dbj|BAD93264.1|  PSMB8-A                                                226   3e-69    
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   227   3e-69    
ref|XP_001924154.2|  PREDICTED: proteasome subunit beta type-8          226   3e-69    
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   226   3e-69    
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            227   3e-69    
ref|XP_004590508.1|  PREDICTED: proteasome subunit beta type-8          226   4e-69    
ref|NP_999100.1|  proteasome subunit beta type-8                        225   4e-69    
ref|XP_006457891.1|  20S proteasome subunit                             227   4e-69    
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  227   4e-69    
gb|KJE01830.1|  proteasome subunit beta type-5                          226   4e-69    
dbj|BAO00930.1|  proteasome subunit beta type 8,A-type                  225   5e-69    
gb|ACO15462.1|  Proteasome subunit beta type-5 precursor                225   5e-69    
gb|KIM30973.1|  hypothetical protein M408DRAFT_327886                   223   5e-69    
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   226   6e-69    
dbj|BAM18296.1|  proteasome beta5 subunit                               225   6e-69    
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   226   6e-69    
ref|XP_571562.1|  proteasome component pts1                             226   6e-69    
ref|XP_001875479.1|  20S proteasome subunit                             226   7e-69    
dbj|BAJ51756.1|  proteasome subunit, beta type 8                        224   8e-69    
dbj|BAO50695.1|  proteasome subunit beta type 8,A-type                  222   9e-69    
dbj|GAK66792.1|  proteasome-domain-containing protein                   235   1e-68    
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    222   1e-68    
ref|XP_003194765.1|  proteasome component                               225   1e-68    
gb|KIR99960.1|  proteasome subunit beta type-5                          225   1e-68    
ref|XP_559226.2|  AGAP010718-PA                                         224   1e-68    
dbj|BAJ51776.1|  proteasome subunit, beta type 8                        223   1e-68    
dbj|BAO00926.1|  proteasome subunit beta type 8,A-type                  222   1e-68    



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   374 bits (960),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR+DLSVEE
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRYDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE AAVE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEVAAVEQEM  267

Query  198  TEVPIA  181
             EVP+A
Sbjct  268  AEVPVA  273



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR+DLSVEE
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRYDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE AAVE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEVAAVEQEM  267

Query  198  TEVPIA  181
             EVP+A
Sbjct  268  AEVPVA  273



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   370 bits (950),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSVEE
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE AAVE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVEVAAVEQEM  267

Query  198  TEVPIA  181
             EVP+A
Sbjct  268  AEVPVA  273



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   370 bits (949),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GYRFDLSVEE
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYRFDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE  +VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVELESVEQEM  267

Query  198  TEVPIA  181
             EVP+A
Sbjct  268  AEVPVA  273



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   370 bits (949),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GYRFDLSVEE
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYRFDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE  +VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVELESVEQEM  267

Query  198  TEVPIA  181
             EVP+A
Sbjct  268  AEVPVA  273



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   369 bits (947),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/186 (94%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSV+E
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVKE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY+YYPVE AAVE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNYYPVEVAAVEQEM  267

Query  198  TEVPIA  181
             EVP+A
Sbjct  268  AEVPVA  273



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   369 bits (946),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR DLSVEE
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRNDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP+E AAVE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPIEVAAVEQEM  267

Query  198  TEVPIA  181
             EV +A
Sbjct  268  AEVSVA  273



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   368 bits (945),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYRFDLSVEE
Sbjct  148  GMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRFDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPVE  AVE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVEPTAVEQEM  267

Query  198  TEVPIA  181
            TEV IA
Sbjct  268  TEVSIA  273



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   365 bits (938),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+AGASK+LANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKMLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFDLSVEE
Sbjct  148  GMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGW+KLSGDDVGELHY YYPVE A VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWEKLSGDDVGELHYKYYPVETAVVEQEM  267

Query  198  TEVPIA  181
            TEV IA
Sbjct  268  TEVAIA  273



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   359 bits (921),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV   AVE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVQGAVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   358 bits (920),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLH+LANKRRISVAGASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHKLANKRRISVAGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY+YYPV    V+ EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYNYYPVTPTTVDQEM  266

Query  198  TEVPIA  181
            TEV  A
Sbjct  267  TEVTAA  272



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   358 bits (918),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  148  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV A +VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVAGSVEQEM  267

Query  198  TEV  190
             EV
Sbjct  268  VEV  270



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   358 bits (918),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLL NILYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLGNILYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG +FSVGSGSPYAYG+LD+G+RFDLSVEE
Sbjct  149  GMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGTKFSVGSGSPYAYGILDSGHRFDLSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYH+GPNGWKKLSGDDVGELHY YYPVE A VE EM
Sbjct  209  AAELARRAIYHATFRDGASGGVASVYHIGPNGWKKLSGDDVGELHYLYYPVEPATVEREM  268

Query  198  TEVPIA  181
            +EV I+
Sbjct  269  SEVAIS  274



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   358 bits (918),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDDGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV   AVE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVEGAVEQEM  266

Query  198  TEVPIA  181
             EV  A
Sbjct  267  VEVAAA  272



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   357 bits (916),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TEVP  187
             E P
Sbjct  267  VEAP  270



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   357 bits (916),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR HELANKRRISVAGASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRRHELANKRRISVAGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+DLSVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDLSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY+YYPV    V+ EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYNYYPVTPTTVDQEM  266

Query  198  TEVPIA  181
            TEV  A
Sbjct  267  TEVTAA  272



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   357 bits (916),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFD+ VEE
Sbjct  148  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDMPVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGP+GWKKLSGDDVGELHY YYPV    VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPDGWKKLSGDDVGELHYKYYPVAPTPVEQEM  267

Query  198  TEVPIA  181
            T+ P A
Sbjct  268  TDAPAA  273



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   356 bits (913),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARRSIYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE EM
Sbjct  207  AAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   355 bits (911),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TE  193
             E
Sbjct  267  VE  268



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   352 bits (904),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  16   EKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  75

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVEE
Sbjct  76   GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDDGYRYDMSVEE  135

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV   AVE EM
Sbjct  136  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVEGAVEQEM  195

Query  198  TEVPIA  181
             EV  A
Sbjct  196  VEVAAA  201



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   355 bits (911),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TE  193
             E
Sbjct  267  VE  268



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   355 bits (911),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  148  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY VGPNGWKKLSGDDVGELHYHYYPV A +VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYXVGPNGWKKLSGDDVGELHYHYYPVVAGSVEQEM  267

Query  198  TEV  190
             EV
Sbjct  268  VEV  270



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   355 bits (910),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TE  193
             E
Sbjct  267  VE  268



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GYRFD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYRFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GWKKLSGDDVGELHYHYYPV     EHEM
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELHYHYYPVAPTTAEHEM  268

Query  198  TE  193
             E
Sbjct  269  AE  270



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+EE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+EE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  92   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  152  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV    VE EM
Sbjct  212  ASELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYEYYPVTPETVEQEM  271

Query  198  TEV  190
             EV
Sbjct  272  VEV  274



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+EE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   353 bits (907),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E EM
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVVPATAEQEM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLS+EE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   353 bits (906),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDSGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   350 bits (898),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  9    KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  68

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY+FD+S+EE
Sbjct  69   GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKFDMSIEE  128

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  129  AAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  188

Query  198  TEV  190
             EV
Sbjct  189  AEV  191



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   353 bits (905),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGT+AGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+DLSVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEM  266

Query  198  TE  193
             E
Sbjct  267  VE  268



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   353 bits (905),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLL NILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLTNILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELH+ YYPV    VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHFKYYPVTPGTVEQEM  266

Query  198  TEV  190
            +EV
Sbjct  267  SEV  269



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   352 bits (904),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVMPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   352 bits (904),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+EE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELH+ YYPV    VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHFKYYPVSPGTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   352 bits (903),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVG NGWKKLSGDDVGELHY YYPV   AVE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHYSYYPVVPGAVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   352 bits (903),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  87   KKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+EE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VG +GWKKLSGDDVGELHY YYPV  + VEHEM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGRDGWKKLSGDDVGELHYTYYPVAPSPVEHEM  266

Query  198  TEVP  187
             EVP
Sbjct  267  AEVP  270



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   352 bits (903),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDDGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVG NGWKKLSGDDVGELHY YYPV A AVE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHYSYYPVVAGAVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   352 bits (902),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGP GWKKLSGDDVGELHYHY+PV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYHVGPTGWKKLSGDDVGELHYHYHPVTPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   352 bits (902),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPATAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  87   KKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+EE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGV SVY+VG +GWKKLSGDDVGELHY YYPV  + VEHEM
Sbjct  207  AAELARRAIYHATFRDGASGGVVSVYYVGRDGWKKLSGDDVGELHYTYYPVAPSPVEHEM  266

Query  198  TEVPIA  181
             EVP A
Sbjct  267  AEVPPA  272



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + +E EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYRYYPVMPSTIEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   350 bits (899),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  +  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPSTAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   350 bits (899),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYRYYPVMPSTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   353 bits (905),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 174/182 (96%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  155  KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  214

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRL GNRFSVGSGSPYAYGVLD+GYRFD+SVEE
Sbjct  215  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLNGNRFSVGSGSPYAYGVLDSGYRFDMSVEE  274

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGV SVYHVGP+GWKKLSGDDVGELHY YYPVE   VEHEM
Sbjct  275  AAELARRAIYHATFRDGASGGVVSVYHVGPDGWKKLSGDDVGELHYAYYPVE-PTVEHEM  333

Query  198  TE  193
             E
Sbjct  334  AE  335



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   350 bits (899),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  +  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPSTAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   350 bits (898),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASK+LANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKMLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY PV  + VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYNPVVPSTVEQEM  266

Query  198  TE  193
             E
Sbjct  267  VE  268



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   350 bits (897),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+SV E
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDDGYRYDMSVHE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVY+VGP+GWKKLSGDDVGELHY YYPV A  VE EM
Sbjct  207  AAELARRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVGELHYKYYPVTAGTVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  90   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  149

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  150  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  209

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GWKKLSGDDVGELHYHYYPV     EH M
Sbjct  210  ASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELHYHYYPVTPVTAEHVM  269

Query  198  TE  193
             E
Sbjct  270  EE  271



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVAPATAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+S+EE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSIEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  EH M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPATAEHVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  87   KKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+SVEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRD ASGGVASVY+VGP+GWKKLSGDDVGELH+ YYPV  +  E EM
Sbjct  207  AAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHFRYYPVAPSPTEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+S+EE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSIEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  EH M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPATAEHVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  86   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  145

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  146  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVEE  205

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARR+IYHATFRDGASGGVASVY+VGP GWKKLSGDDVGELHYHY PV  + VE EM
Sbjct  206  ASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHYHYNPVTPSTVEQEM  265

Query  198  TE  193
             E
Sbjct  266  VE  267



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   348 bits (892),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  86   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  145

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  146  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVEE  205

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARR+IYHATFRDGASGGVASVY+VGP GWKKLSGDDVGELHYHY PV  + VE EM
Sbjct  206  ASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHYHYNPVTPSTVEQEM  265

Query  198  TE  193
             E
Sbjct  266  VE  267



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   348 bits (892),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV     EH M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPITAEHVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   348 bits (892),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+R SVGSGSPYAYGVLD+GY+FD++VEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRLSVGSGSPYAYGVLDSGYKFDMTVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLG+MAGG+ADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGSMAGGSADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+S+EE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSIEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  EH M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHYYPVAPATAEHVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILY+YR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGY++D++VEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYQYDMTVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARR+IYHAT+RDGASGGV SVYHVGP+GWKKL+GDDVGELHY YYPV  A VE EM
Sbjct  207  ASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKLTGDDVGELHYQYYPVVPATVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVG NGW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGSNGWTKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGR+KG+RFSVGSGSPYAYGVLD+GY++D++VEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRIKGDRFSVGSGSPYAYGVLDSGYKYDMTVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV  ++ E  M
Sbjct  209  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVTPSSAEQVM  268

Query  198  TE  193
            +E
Sbjct  269  SE  270



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   345 bits (885),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   345 bits (885),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPY++GT+AGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  92   KKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+S EE
Sbjct  152  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDMSCEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARRSIYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV    VE EM
Sbjct  212  AAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVPKGNVEQEM  271

Query  198  TE  193
             E
Sbjct  272  VE  273



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   345 bits (885),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   345 bits (885),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP+GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPDGWTKLSGDDVGELHYHYYPVAPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   346 bits (887),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  113  KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  172

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  173  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEE  232

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  233  ASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQVM  292

Query  198  TE  193
             E
Sbjct  293  EE  294



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHELANKRRIS+AG+SK+LANILYSYR
Sbjct  90   RKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELANKRRISIAGSSKMLANILYSYR  149

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAG+DE GPGLYYVDSEG RLKGNRFSVGSGS YAYG+LD GY+F++SVEE
Sbjct  150  GMGLSIGTMIAGFDETGPGLYYVDSEGARLKGNRFSVGSGSLYAYGILDEGYKFNMSVEE  209

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A ELARR+IYHATFRDGASGG  SVYHVGPNGWKKLSGDDVGELHYHYYPV+AA VE EM
Sbjct  210  AGELARRAIYHATFRDGASGGCVSVYHVGPNGWKKLSGDDVGELHYHYYPVQAAPVEQEM  269

Query  198  TEVPIA*T  175
             + P A T
Sbjct  270  ADAPSAST  277



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   344 bits (882),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR HEL NKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINSYMLGTMAGGAADCQFWHRNLGIKCRRHELENKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAY VLDNGY++DLSVEE
Sbjct  148  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYCVLDNGYQYDLSVEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV    VE EM
Sbjct  208  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVVHDTVEQEM  267

Query  198  TEVPI  184
             EV +
Sbjct  268  IEVTV  272



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  87   KKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE G GLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGYR+D+S+EE
Sbjct  147  GMGLSVGTMIAGWDETGAGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDNGYRYDMSIEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRD ASGGVASVY+VGP+GWKKLSGDDVGELH+ YYPV     E EM
Sbjct  207  AAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHFRYYPVAPNPTEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  AEV  269



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPY+LGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+ VEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRWDMPVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARRSIYHATFRDGASGGVASVY+VGP GWKKLSGDDV ELH++YYPV    VE EM
Sbjct  207  AAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVAELHFNYYPVTENVVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   344 bits (882),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR HEL NKRRISV GASKLLANILYSYR
Sbjct  104  KKIIEINSYMLGTMAGGAADCQFWHRNLGIKCRRHELENKRRISVTGASKLLANILYSYR  163

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAY VLDNGY++DLSVEE
Sbjct  164  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYCVLDNGYQYDLSVEE  223

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY YYPV    VE EM
Sbjct  224  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKYYPVVHDTVEQEM  283

Query  198  TEVPI  184
             EV +
Sbjct  284  IEVTV  288



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   342 bits (876),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYR
Sbjct  39   RKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYR  98

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEE
Sbjct  99   GMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEE  158

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM
Sbjct  159  AAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEM  218

Query  198  TEVPIA*T  175
             E P A T
Sbjct  219  AEAPSAST  226



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILY+YR
Sbjct  87   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLDNGY++D++VEE
Sbjct  147  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAYGVLDNGYKYDMTVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARR+IYHAT+RDGASGGV SVYHVGP+GWKK++GDDVG+LH+ YYPV  A VE EM
Sbjct  207  ASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKVTGDDVGDLHFQYYPVVPATVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   343 bits (879),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYR
Sbjct  92   RKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEE
Sbjct  152  GMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM
Sbjct  212  AAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEM  271

Query  198  TEVPIA*T  175
             E P A T
Sbjct  272  AEAPSAST  279



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++++SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYEMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++++SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYEMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   342 bits (878),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++++SVEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYEMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  209  ASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVPPAIAEQVM  268

Query  198  TE  193
             E
Sbjct  269  EE  270



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLAN+LYSYR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVPGASKLLANMLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGR+KG+RFSVGSGSPYAYGVLD+GY++D++VEE
Sbjct  149  GMGLSVGTMIAGWDETGPGLYYVDNEGGRIKGDRFSVGSGSPYAYGVLDSGYKYDMTVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARRSIYHATFRDGASGGVASVY+VGPNGWKKLSGDDVGELHY YYPV  +  E  M
Sbjct  209  AAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKYYPVAPSTAEQVM  268

Query  198  TE  193
             E
Sbjct  269  AE  270



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   342 bits (878),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYR
Sbjct  92   RKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEE
Sbjct  152  GMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM
Sbjct  212  AAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEM  271

Query  198  TEVPIA*T  175
             E P A T
Sbjct  272  AEAPSAST  279



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   342 bits (877),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINP++LGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  87   KKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYR+D+ VEE
Sbjct  147  GMGLSIGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRWDMPVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARRSIYHATFRDGASGGVASVY+VGP GWKKLSGDDVGELH+ YYPV    VE EM
Sbjct  207  AAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVGELHFKYYPVTENVVEQEM  266

Query  198  TEV  190
             EV
Sbjct  267  VEV  269



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   342 bits (876),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  86   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  145

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMG SVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  146  GMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVEE  205

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARR+IYHATFRDGASGGVASVY+VGP G KKLSGDDVGELHYHY PV  + VE EM
Sbjct  206  ASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHYHYNPVTPSTVEQEM  265

Query  198  TE  193
             E
Sbjct  266  VE  267



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   340 bits (873),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYR
Sbjct  93   RKIIEINPYMLGTMAGGAADCQFWHRNLGNKCRLHELSNKRRISIAGASKLLANILYSYR  152

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL GN+FSVGSGS YAYGVLD+GYRF++SVEE
Sbjct  153  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNKFSVGSGSLYAYGVLDDGYRFNMSVEE  212

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRD ASGG  SVYHVGP+GW KLSGDDVGELHYHYYPV+   VE EM
Sbjct  213  AAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHYYPVQKTPVEQEM  272

Query  198  TEVPIA  181
            T+ P A
Sbjct  273  TDAPTA  278



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   340 bits (872),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYR
Sbjct  93   RKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELSNKRRISIAGASKLLANILYSYR  152

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL GNRFSVGSGS YAYG+LD+GYRF +SVEE
Sbjct  153  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNRFSVGSGSLYAYGILDDGYRFSMSVEE  212

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRD ASGG  SVYHVGP+GW KLSGDDVGELHYHYYPV+   VE EM
Sbjct  213  AAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHYYPVQKTPVEQEM  272

Query  198  TEVPIA  181
             + P A
Sbjct  273  ADAPTA  278



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   337 bits (863),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  38   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  97

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+LD+GYR+DLSV+E
Sbjct  98   GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGILDSGYRYDLSVDE  157

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A EL RR+IYHATFRDGASGGV SVYHVGP GWKK +GDDVG+LHY YYPV  + VE EM
Sbjct  158  AVELGRRAIYHATFRDGASGGVVSVYHVGPEGWKKWTGDDVGDLHYQYYPVVPSTVEQEM  217

Query  198  TE  193
             E
Sbjct  218  AE  219



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   336 bits (862),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYR
Sbjct  39   RKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYR  98

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VEE
Sbjct  99   GMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVEE  158

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE EM
Sbjct  159  AAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQEM  218

Query  198  TEVPIA  181
             + P A
Sbjct  219  ADAPAA  224



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   338 bits (868),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYR
Sbjct  93   RKIIEINPYMLGTMAGGAADCQFWHRNLGNKCRLHELSNKRRISIAGASKLLANILYSYR  152

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL GNRFSVGSGS YAYG+LD GYRF++SVEE
Sbjct  153  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGNRFSVGSGSLYAYGILDEGYRFNMSVEE  212

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A ELARR+IY ATFRD ASGG  SVYHVGP+GWKKLSGDDVGELHYHYYPV+   VE EM
Sbjct  213  AGELARRAIYGATFRDAASGGCVSVYHVGPDGWKKLSGDDVGELHYHYYPVQKTPVEQEM  272

Query  198  TEVPIA  181
            T+ P A
Sbjct  273  TDAPSA  278



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   338 bits (866),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYR
Sbjct  92   RKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VEE
Sbjct  152  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE EM
Sbjct  212  AAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQEM  271

Query  198  TEVPIA  181
             + P A
Sbjct  272  ADAPAA  277



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   337 bits (864),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYR
Sbjct  92   RKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VEE
Sbjct  152  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE EM
Sbjct  212  AAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQEM  271

Query  198  TEVPIA  181
             + P A
Sbjct  272  ADAPAA  277



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   337 bits (863),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYR
Sbjct  92   RKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VEE
Sbjct  152  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE EM
Sbjct  212  AAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQEM  271

Query  198  TEVPIA  181
             + P A
Sbjct  272  ADAPAA  277



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   336 bits (862),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFD+S+EE
Sbjct  148  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDMSIEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  226
            AAEL RR+IYHATFRDGASGGVASVY+VGP+GWKKLSGDDV ELHY+YYPV
Sbjct  208  AAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHYNYYPV  258



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   336 bits (861),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  88   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+LD+GYRFD+S+EE
Sbjct  148  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGILDSGYRFDMSIEE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  226
            AAEL RR+IYHATFRDGASGGVASVY+VGP+GWKKLSGDDV ELHY+YYPV
Sbjct  208  AAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHYNYYPV  258



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   336 bits (861),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYR
Sbjct  92   RKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VEE
Sbjct  152  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRDGASGG  SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE EM
Sbjct  212  AAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKYYPVEAIPVEQEM  271

Query  198  TEVPIA  181
             + P A
Sbjct  272  ADAPAA  277



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   335 bits (860),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYR
Sbjct  91   RKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYR  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL G RFSVGSGS YAYG+LD GYR+ +SVEE
Sbjct  151  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLVGTRFSVGSGSLYAYGILDEGYRYVMSVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A ELARR+IYHATFRDGASGG  SVYHVG +GWKKLSGDDVGELHY YYPV+A  VE EM
Sbjct  211  AGELARRAIYHATFRDGASGGCVSVYHVGADGWKKLSGDDVGELHYKYYPVQATPVEQEM  270

Query  198  TEVPIA  181
             + P A
Sbjct  271  ADAPAA  276



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   334 bits (857),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR
Sbjct  86   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYR  145

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMG SVGTMIAGWDE GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GY++D+SVEE
Sbjct  146  GMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYKYDMSVEE  205

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  208
            A+ELARR+IYHATFRDGASGGVASVY+VGP G KKLSGDDVGELHYHY PV  + VE
Sbjct  206  ASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHYHYNPVTPSTVE  262



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   333 bits (854),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANIL+SYR
Sbjct  90   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILFSYR  149

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+LD+GYRFD+S+EE
Sbjct  150  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGILDSGYRFDMSIEE  209

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEH--  205
            AAEL RR+IYHATFRDGASGGVASVY+VG NGW KLSGDDV ELHY YYPV +A      
Sbjct  210  AAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHYKYYPVVSAETSEPD  269

Query  204  EMTE  193
            +M E
Sbjct  270  QMVE  273



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   332 bits (850),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGG ADCQFWHRNLG+KCRLHELANKRRISV GASKLLANIL+SYR
Sbjct  90   KKIIEINPYMLGTMAGGGADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILFSYR  149

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GYRFD+S+EE
Sbjct  150  GMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRFDMSIEE  209

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAA  217
            AAEL RR+IYHATFRDGASGGVASVY+VG NGW KLSGDDV ELHY YYPV +A
Sbjct  210  AAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHYKYYPVVSA  263



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   325 bits (834),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRR SVAGASKLLANILYSYR
Sbjct  13   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGASKLLANILYSYR  72

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD+GYRFDLSVEE
Sbjct  73   GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDSGYRFDLSVEE  132

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  253
            AAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG
Sbjct  133  AAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  174



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHEL NKRRISV GASKLLAN LYSYR
Sbjct  92   KKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELGNKRRISVTGASKLLANTLYSYR  151

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD G+R+D++VEE
Sbjct  152  GMGLSMGTMIAGWDETGPGLYYVDSEGGRVKGRRFSVGSGSTYAYGVLDTGFRWDMTVEE  211

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A ELARRSIYHATFRDGASGGVASVY+VGP+GWKK+SGDDVGELHY YYPV  A  E E+
Sbjct  212  AVELARRSIYHATFRDGASGGVASVYYVGPDGWKKMSGDDVGELHYKYYPVSDAPAEQEV  271

Query  198  T  196
             
Sbjct  272  V  272



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   321 bits (822),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISV GASKLLAN LYSYR
Sbjct  85   KKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSYR  144

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD G+ +D+S++E
Sbjct  145  GMGLSMGTMIAGWDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYGVLDTGFNWDMSIDE  204

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A ELARRSIYHATFRDGASGGV SVY+VGP GWKK+SGDDVGELHY YYPV+    E EM
Sbjct  205  AVELARRSIYHATFRDGASGGVVSVYYVGPGGWKKMSGDDVGELHYSYYPVQEVPAEAEM  264

Query  198  TE  193
             E
Sbjct  265  GE  266



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   343 bits (880),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  738   KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
             +KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYR
Sbjct  1333  RKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYR  1392

Query  558   GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
             GMGLS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEE
Sbjct  1393  GMGLSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEE  1452

Query  378   AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
             AAELARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM
Sbjct  1453  AAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEM  1512

Query  198   TEVPIA*T  175
              E P A T
Sbjct  1513  AEAPSAST  1520



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISVAGASKLLAN LYSYR
Sbjct  89   KKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVAGASKLLANTLYSYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDE GP L+YVDSEGGR KG  FSVGSGS YAYG+LD+GY+F++SVEE
Sbjct  149  GMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFSVGSGSTYAYGILDSGYKFEMSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A EL RR+IYHATFRDGASGGVASVYH+GP GWKK+SGDDV ELHY YYP E+ A   ++
Sbjct  209  AVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHYQYYPPESQASAPDV  268

Query  198  TE  193
             E
Sbjct  269  VE  270



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   314 bits (805),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISVAGASKLLAN LYSYR
Sbjct  87   KKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVAGASKLLANTLYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDE GP L+YVDSEGGR KG  FSVGSGS YAYG+LD+GY++++SVEE
Sbjct  147  GMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFSVGSGSTYAYGILDSGYKYEMSVEE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A EL RR+IYHATFRDGASGGVASVYH+GP GWKK+SGDDV ELHY YYP E+ A   ++
Sbjct  207  AVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHYQYYPPESQASAPDV  266

Query  198  TE  193
             E
Sbjct  267  VE  268



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = -3

Query  687  AADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKG  508
            AADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE G
Sbjct  70   AADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETG  129

Query  507  PGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDG  328
            PGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY++D+S+EEA+ELARR+IYHATFRDG
Sbjct  130  PGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKYDMSIEEASELARRAIYHATFRDG  189

Query  327  ASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  193
            ASGGVASVY+VGP GWKKLSGDDVGELHYHY PV  + VE EM E
Sbjct  190  ASGGVASVYYVGPTGWKKLSGDDVGELHYHYNPVTPSTVEQEMVE  234



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   309 bits (791),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKI+EINPYM+ T+AGGAADC FWHRNLG+KCRL+EL NKRRISVAGASKLL N+LYSYR
Sbjct  87   KKIVEINPYMIATVAGGAADCIFWHRNLGMKCRLYELENKRRISVAGASKLLTNMLYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+AG DE GP LYYVDSEGGRLKG+RFSVGSGSPYAY VLDNGYR+D+   E
Sbjct  147  GMGLSIGTMVAGCDEMGPSLYYVDSEGGRLKGSRFSVGSGSPYAYAVLDNGYRYDMPTGE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVA VYHVGP+GWKK+SGDDV ELH  YYP      E EM
Sbjct  207  AAELARRAIYHATFRDGASGGVAVVYHVGPDGWKKISGDDVRELHDKYYPAVQVPPEQEM  266

Query  198  TEVP  187
             +VP
Sbjct  267  MQVP  270



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKI+EINP+M+ T+AGGAADC FWHRNLGVKCRL+EL NKRRISVAGASKLL N+LYSYR
Sbjct  87   KKIVEINPHMIATVAGGAADCIFWHRNLGVKCRLYELENKRRISVAGASKLLTNMLYSYR  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GM LSVGTMIAGWDE GP LYYVDSEGGRLKG+RFSVGSGSPYAY VLDNGYR+D+ + E
Sbjct  147  GMELSVGTMIAGWDEMGPSLYYVDSEGGRLKGSRFSVGSGSPYAYAVLDNGYRYDMPLGE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IYHATFRDGASGGVA V HVGP+GWKKLSGDDV ELH  YYP      E EM
Sbjct  207  AAELARRAIYHATFRDGASGGVAIVCHVGPDGWKKLSGDDVKELHDKYYPAVQVPAEQEM  266

Query  198  TEV  190
             ++
Sbjct  267  MQI  269



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 152/186 (82%), Gaps = 17/186 (9%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            +KIIEINPYMLGTMAGGAADCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYR
Sbjct  93   RKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRLHELSNKRRISIAGASKLLANILYSYR  152

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWDEKGPGLYYVDSEG RL G                 N YRF +SVEE
Sbjct  153  GMGLSIGTMIAGWDEKGPGLYYVDSEGARLVG-----------------NSYRFSMSVEE  195

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            AAELARR+IY ATFRD ASGG  SVYHVGP+GW KLSGDDVGELHYHYYPV+   VE EM
Sbjct  196  AAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHYYPVQKTPVEQEM  255

Query  198  TEVPIA  181
             + P A
Sbjct  256  ADAPTA  261



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   295 bits (756),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 3/188 (2%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSYR
Sbjct  49   KKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSYR  108

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGL +GTMIAGWDE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD  ++ D+S++E
Sbjct  109  GMGLFMGTMIAGWDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYGVLDTVFKQDMSIDE  168

Query  378  AAELARRSIYHATFRDGASGGVASV---YHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  208
            A ELARRSIYHAT RDGASGGV  +      GP+GWKK+SGDD GELH+ YYPV+    E
Sbjct  169  AVELARRSIYHATLRDGASGGVTLLKCSLLCGPSGWKKMSGDDGGELHHSYYPVQETPAE  228

Query  207  HEMTEVPI  184
             EM+E  +
Sbjct  229  AEMSEASV  236



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   289 bits (740),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQFW RNLG++CRLHEL N +RISV+GASKLL+N LY YR
Sbjct  91   KKVIEINPYLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRISVSGASKLLSNTLYGYR  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTM+AGWD  GPGLYYVDS+G RLKG RFSVGSGS +AYGVLD GYR+DLSVE+
Sbjct  151  GQGLSMGTMVAGWDLNGPGLYYVDSDGTRLKGKRFSVGSGSLFAYGVLDQGYRWDLSVED  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  223
            A EL RR+IYHATFRD  SGG  SVYHVGP+GW K+SG DVGELHY YYP +
Sbjct  211  ACELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHYEYYPAD  262



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   290 bits (741),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINP++LGTMAGGAADCQFW RNLG++CRLHEL N +RI+V  ASKLLAN LYSY+
Sbjct  95   KKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRITVRAASKLLANTLYSYK  154

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTMIAGWD  GPGLYYVDSEG RLKG RFSVGSGS +AYGVLD GYR+DLSV+E
Sbjct  155  GRGLSMGTMIAGWDLNGPGLYYVDSEGTRLKGQRFSVGSGSLFAYGVLDQGYRWDLSVKE  214

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  223
            A EL RR+IYHATFRD  SGG  SVYHVG NGW K++GDDVGELH+HYYP E
Sbjct  215  ACELGRRAIYHATFRDAFSGGTVSVYHVGKNGWTKVTGDDVGELHFHYYPSE  266



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   287 bits (735),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQFW RNLG++CRLHEL N +RISVAGASKLLAN LY YR
Sbjct  94   KKVIEINPYLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRISVAGASKLLANTLYGYR  153

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTM+AGWD KGPGLYYVDS+G RLKG RFSVGSGS +AYGVLD GYR+DLSVEE
Sbjct  154  GQGLSMGTMVAGWDLKGPGLYYVDSDGTRLKGQRFSVGSGSLFAYGVLDQGYRWDLSVEE  213

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  223
            A EL RR+IYHATFRD  SGG  SVYHV  NGW K+SG DVGELH+ YYP +
Sbjct  214  ACELGRRAIYHATFRDAFSGGTISVYHVNENGWTKVSGTDVGELHFEYYPAD  265



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   286 bits (731),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINP++LGTMAGGAADCQFW RNLG++CRLHEL   +RI+V GASKLLAN LY YR
Sbjct  97   KKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGYR  156

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTM+AGWD  GPGL+YVDS+G RLKG RFSVGSGS +AYGVLD G+R DLS++E
Sbjct  157  GRGLSMGTMVAGWDTTGPGLFYVDSDGTRLKGKRFSVGSGSLFAYGVLDQGFRHDLSIKE  216

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAA  217
            AAEL RR+IYHATFRD  SGG  SVYHVGP+GW K+SG DVGELHY YYP +A 
Sbjct  217  AAELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHYEYYPADAV  270



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   283 bits (724),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINP++LGTMAGGAADCQFW RNLG++CRLHEL N +RI+V  ASKLLAN LYSY+
Sbjct  96   KKVIEINPFLLGTMAGGAADCQFWQRNLGIQCRLHELENGKRITVRAASKLLANTLYSYK  155

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTM+AGWD  GPGLYYVDSEG RLKG RFSVGSGS +AYGVLD GY++DL+VEE
Sbjct  156  GKGLSMGTMVAGWDLNGPGLYYVDSEGTRLKGQRFSVGSGSLFAYGVLDQGYKWDLTVEE  215

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  229
            A EL RR+IYHATFRD  SGG  SVYHVG NGW K++GDDVGELH+ YYP
Sbjct  216  ACELGRRAIYHATFRDAFSGGTVSVYHVGANGWTKVTGDDVGELHFSYYP  265



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   278 bits (711),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 144/183 (79%), Gaps = 25/183 (14%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLLANILY+YR
Sbjct  89   KKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNYR  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTM+AGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+G         
Sbjct  149  GMGLSVGTMVAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSG---------  199

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
                            G +     VY+VGPNGWKKLSGDDVGELHYHYYPV  + VE EM
Sbjct  200  ----------------GLTKFYVLVYYVGPNGWKKLSGDDVGELHYHYYPVMPSTVEQEM  243

Query  198  TEV  190
             EV
Sbjct  244  VEV  246



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 153/191 (80%), Gaps = 8/191 (4%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINP++LGTMAGGAADCQFW RNLG +CRL+ELAN +RI+V GASKLLAN ++SYR
Sbjct  91   KKVIEINPHLLGTMAGGAADCQFWERNLGRQCRLYELANGKRITVRGASKLLANTMFSYR  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+AGWDE GPGLYYVDS+G R KG  FSVGSGS YAYGVLD GYR+DLSVEE
Sbjct  151  GMGLSMGTMVAGWDEAGPGLYYVDSDGQRTKGKLFSVGSGSLYAYGVLDEGYRWDLSVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A EL +RSIYHATFRD ASGG  S YHV   GW K+ G+DVG+LH++YYP   A  EH  
Sbjct  211  AVELGQRSIYHATFRDAASGGTVSAYHVTQEGWTKVRGEDVGQLHFNYYP---APEEH--  265

Query  198  TEVPIA*TDPF  166
               P    DP 
Sbjct  266  ---PCNSKDPL  273



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQFW RNLG +CRL+EL N +RISV  ASKLLAN+++SY+
Sbjct  91   KKVIEINPYLLGTMAGGAADCQFWQRNLGQQCRLYELNNGKRISVRAASKLLANVMFSYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTM+AG+D  GPGLYYVDS+G R KG  FSVGSGS YAYGVLDNGY++D+ VE+
Sbjct  151  GYGLSMGTMVAGYDPTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYGVLDNGYKWDMDVED  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A EL RRSIYHATFRD  SGG  SVYHV  +GWKK+ GDDVGELHY YYP   A   H  
Sbjct  211  AIELGRRSIYHATFRDAVSGGTVSVYHVTADGWKKVRGDDVGELHYEYYPTPEAHPCHRA  270

Query  198  TEVPIA  181
              +  A
Sbjct  271  DPLETA  276



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   266 bits (680),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAAD QFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYR
Sbjct  13   KKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYR  72

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  73   GMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  132

Query  378  AAELARRSIYHATFRDGA  325
            A+ELARRSIYHATFRDGA
Sbjct  133  ASELARRSIYHATFRDGA  150



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 149/185 (81%), Gaps = 3/185 (2%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEIN +++GTMAGGAADCQFW RNLG++CRL+EL N +RI+V  ASKLLAN ++SYR
Sbjct  90   KKVIEINKHLIGTMAGGAADCQFWQRNLGMRCRLYELNNGKRITVCAASKLLANTMFSYR  149

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+AGWD  GPGLYYVDS+G R KG  FSVGSGS YAYGVLD+GYR+DLSVEE
Sbjct  150  GMGLSMGTMVAGWDSTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYGVLDSGYRWDLSVEE  209

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A EL RRSIYHA FRD ASGG  SVYHV  +GW K+ GDDV ELHY YYP  A   +H  
Sbjct  210  AIELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDVTELHYQYYPDPA---QHPA  266

Query  198  TEVPI  184
            T   +
Sbjct  267  TATSV  271



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEIN ++LGTMAGGAADCQFW RNLG++CRL+EL N +RI+V  ASKLL+N+++SYR
Sbjct  91   KKVIEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSYR  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+AGWD  GPGLYYVDS+G R KG  FSVGSGS YAYGVLD GYR+D+ VEE
Sbjct  151  GMGLSMGTMVAGWDPTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYGVLDAGYRWDMPVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  229
            A EL RRSIYHA FRD ASGG  SVYHV  +GW K+ GDD+ ELHY YYP
Sbjct  211  AVELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDISELHYQYYP  260



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLG---VKCRLHELANKRRISVAGASKLLANILY  568
            KK+IEINP++LGTMAGGAADCQFW RNLG   V CRL+EL N +RI+V GASKLLAN ++
Sbjct  90   KKVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRITVRGASKLLANTMF  149

Query  567  SYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLS  388
            SYRGMGLS+GTM+AGWD  GPGLYYVDS+G R KG RFSVGSGS YAYGVLD GY +D+S
Sbjct  150  SYRGMGLSMGTMVAGWDVAGPGLYYVDSDGQRTKGQRFSVGSGSLYAYGVLDAGYSWDMS  209

Query  387  VEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  229
            VE+A EL +R+IYHAT RD ASGG ASVYHV   GW K+ G+ VGELHY YYP
Sbjct  210  VEDAVELGQRAIYHATARDAASGGTASVYHVTEAGWTKVRGESVGELHYKYYP  262



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQFW RNLG +CRL+EL   RRI+V  ASKLLAN ++SYR
Sbjct  57   KKVIEINPYLLGTMAGGAADCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSYR  116

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWD  GPGLYYVDS+G R  G RFSVGSGS YAYGVLD GY +D+SVE+
Sbjct  117  GMGLSMGTMIAGWDIGGPGLYYVDSDGQRTGGQRFSVGSGSLYAYGVLDTGYSWDMSVED  176

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  229
            A EL +R+I+HAT RD ASGG ASVYHV  +GW K+ GD VG+L+Y Y P
Sbjct  177  AVELGQRAIFHATSRDAASGGTASVYHVTESGWTKVRGDAVGDLYYKYNP  226



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  KCRL+EL NK RISVA ASKLLANILY Y+
Sbjct  73   KKVIEINPYLLGTMAGGAADCSFWQRFLAEKCRLYELRNKERISVAAASKLLANILYGYK  132

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMI GWD++GPGLYYVDS+G RL    FSVGSGS YAYGVLD+GYR+DLS +E
Sbjct  133  GMGLSVGTMIVGWDKRGPGLYYVDSDGTRLSSVMFSVGSGSTYAYGVLDSGYRYDLSDDE  192

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L RR+IYHAT+RD  SGG+ S+YH+  +GW K+S DDV +LHY Y
Sbjct  193  AYDLGRRAIYHATYRDAYSGGIVSLYHMKESGWVKISQDDVSDLHYTY  240



>gb|EIE87710.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=187

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+
Sbjct  11   KKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYK  70

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY +DLSV++
Sbjct  71   GMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDYDLSVKD  130

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  208
            A EL RRSIYHAT RD  SGG  ++YHV  NGW      DVGELH+ Y    A  ++
Sbjct  131  ALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHWEYQDENAKGMQ  187



>ref|XP_792356.3| PREDICTED: proteasome subunit beta type-5-like [Strongylocentrotus 
purpuratus]
Length=187

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN+LY+Y+
Sbjct  15   KKVIEINPYLLGTMAGGAADCAFWERVLAEQCRIYELRNKERISVAAASKLLANMLYNYK  74

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMI GWD++GPGLYYVDS+G RL  N FSVGSGSPYAYGVLD GY+++LSVE+
Sbjct  75   GMGLSVGTMICGWDKRGPGLYYVDSDGNRLTNNIFSVGSGSPYAYGVLDEGYKWELSVED  134

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L +R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  135  ALDLGQRAIYHATHRDAYSGGVVNLYHMQETGWVKISSTDVKDLHYRY  182



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+
Sbjct  101  KKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY +DLSV++
Sbjct  161  GMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYNYDLSVKD  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  208
            A EL RRSIYHAT RD  SGG  ++YHV  NGW      DVGELH+ Y    A  ++
Sbjct  221  ALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHWEYQDENAKGMQ  277



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+
Sbjct  101  KKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY FDLSV++
Sbjct  161  GMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDFDLSVKD  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  208
            A EL RRSIYHAT RD  SGG  ++YHV  NGW+     DVG+LH+ Y    A +++
Sbjct  221  ALELGRRSIYHATHRDAMSGGSVNLYHVTENGWEYHGNHDVGQLHWDYQDENAKSMQ  277



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R+L  +CRL+EL NK RISVA ASKLLAN +Y+Y+
Sbjct  88   KKVIEINPYLLGTMAGGAADCSFWERHLAKECRLYELRNKERISVAAASKLLANTVYNYK  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGPGLYYVDS+G RL  N FSVGSGS YAYGVLD+GY +DLSVE+
Sbjct  148  GMGLSMGTMIVGWDKKGPGLYYVDSDGERLTNNMFSVGSGSTYAYGVLDSGYSWDLSVED  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  220
            A EL +RSIYHAT RD  SGGV ++YH+   GW K+S  DV ELHY Y   +A
Sbjct  208  AYELGKRSIYHATHRDAYSGGVVNLYHMKQTGWIKVSQTDVKELHYKYQEEKA  260



>ref|XP_005110562.1| PREDICTED: proteasome subunit beta type-5-like [Aplysia californica]
Length=281

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLANI+Y Y+
Sbjct  105  KKVIEINPYLLGTMAGGAADCMFWERALARQCRIYELRNKERISVAAASKLLANIVYDYK  164

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGPGLYYVD++G RL+G  FSVGSGS YAYGVLD+GY++DLSVEE
Sbjct  165  GMGLSMGTMIIGWDKKGPGLYYVDNDGERLEGKLFSVGSGSVYAYGVLDSGYKWDLSVEE  224

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L RR+IYHAT RD  SGGV ++YH+   GW+K+S  D  ELHY Y
Sbjct  225  AQDLGRRAIYHATHRDAYSGGVVNLYHMKQTGWEKISQTDTMELHYQY  272



>ref|XP_005994469.1| PREDICTED: proteasome subunit beta type-5-like [Latimeria chalumnae]
Length=260

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  89   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLY+VDSEG R+ G+ FSVGSGS YAYGVLD GY FDLSVEE
Sbjct  149  GMGLSMGTMICGWDKRGPGLYFVDSEGNRITGDNFSVGSGSVYAYGVLDRGYHFDLSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IYHAT+RD  SGGV ++YHV  +GW ++  DDV ELH  +
Sbjct  209  AYDLARRAIYHATYRDAYSGGVVNIYHVREDGWFRVFQDDVLELHEEF  256



>gb|AAI55951.1| LOC100127332 protein [Xenopus laevis]
Length=253

 Score =   249 bits (637),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  81   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  140

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G+ FSVGSGS YAYGVLD+GY ++L VEE
Sbjct  141  GMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYGVLDSGYNYELEVEE  200

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A ELARRSIY AT+RD  SGGV ++YHV  +GW ++S DDV ELH  Y
Sbjct  201  AQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVLELHQKY  248



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R LG +CRL+EL NK RISVA ASKLLAN++Y+Y+
Sbjct  101  KKVIEINPYLLGTMAGGAADCIFWQRELGRRCRLYELRNKERISVAAASKLLANMVYAYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+AGWD+ GP ++Y+DS+G RLKG+ FSVGSGSP+AYGV+D+G+ +DLSV+E
Sbjct  161  GMGLSMGTMVAGWDKTGPSIFYIDSDGTRLKGDLFSVGSGSPFAYGVVDSGFDYDLSVQE  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RRSIYHA  RD ASGG  +VYHV  +GW+ +   DVG+LH+ Y
Sbjct  221  AIELGRRSIYHAAHRDSASGGSINVYHVKQDGWEFIGNYDVGDLHWEY  268



>ref|XP_002941560.1| PREDICTED: proteasome subunit beta type-5 [Xenopus (Silurana) 
tropicalis]
Length=257

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  85   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  144

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G+ FSVGSGS YAYGVLD GY +++ VEE
Sbjct  145  GMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYGVLDRGYNYEMEVEE  204

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A ELARRSIY AT+RD  SGGV ++YHV  +GW ++S DDV +LH  Y
Sbjct  205  AQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVADLHQKY  252



>ref|XP_011441202.1| PREDICTED: proteasome subunit beta type-5-like [Crassostrea gigas]
Length=275

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK RISVA ASKLLANI+Y+Y+
Sbjct  101  KKVIEINPYLLGTMAGGAADCAYWERVLARQCRIYELRNKERISVAAASKLLANIVYNYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDS+G R+  N +SVGSGS YAYGVLD+GYR+DLSVEE
Sbjct  161  GMGLSMGTMICGWDKRGPGLYYVDSDGERMSNNIYSVGSGSVYAYGVLDSGYRYDLSVEE  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L RRSIYHAT RD  SGGV ++YH+  +GW+ +S  DV +LHY Y
Sbjct  221  AIDLGRRSIYHATHRDAYSGGVVNLYHMKESGWEFISQTDVFDLHYQY  268



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQFW R LG++CRL+EL NKRRISVA ASKLL+NI+Y Y+
Sbjct  116  KKVIEINPYLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQYK  175

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
              GLS+GTMIAGWD  GP L+ VD++G RLKG RFSVGSGS YAYGVLD GYR DL+ EE
Sbjct  176  DHGLSMGTMIAGWDHTGPNLFMVDNDGTRLKGTRFSVGSGSLYAYGVLDQGYRADLTEEE  235

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEH  205
            A EL RR+IYHAT RD  SGG+ +VY +  +GW K+S  D+ ELHY  Y  E   +++
Sbjct  236  ACELGRRAIYHATHRDAYSGGIINVYLIRSDGWTKISSTDMNELHYGKYAPEKGILDN  293



>ref|XP_007439509.1| PREDICTED: proteasome subunit beta type-5 [Python bivittatus]
Length=265

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  89   KKIIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  148

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY  DLSVEE
Sbjct  149  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYGVMDRGYSHDLSVEE  208

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  211
            A +LARR+IY AT+RD  SGG  +VYHVGP+GW ++S DDV  L   +    + AV
Sbjct  209  AYDLARRAIYQATYRDAYSGGSVNVYHVGPDGWIRVSSDDVSNLRELFRDTASEAV  264



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASK+L+N++Y Y+
Sbjct  102  KKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKILSNMVYDYK  161

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+ GP L+YVDS+G R++G RFSVGSGS +AYGVLD GY F+LSV +
Sbjct  162  GMGLSMGTMITGWDKTGPALFYVDSDGTRMRGERFSVGSGSTFAYGVLDTGYDFNLSVPD  221

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  211
            A EL RR+IYHAT RD  SGG  +V+HV   GW+ +   DVGELH+HY+     A+
Sbjct  222  AIELGRRAIYHATHRDAYSGGSVNVFHVKETGWEFIGNYDVGELHWHYHAQPKGAI  277



>gb|AAL74417.1| proteosome PSMB5/8 protein [Branchiostoma lanceolatum]
Length=194

 Score =   245 bits (625),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLANI+Y+Y+
Sbjct  31   KKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISVAAASKLLANIVYNYK  90

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDS+G RL  N FSVGSGS YAYGVLD+GY++D+SVEE
Sbjct  91   GMGLSMGTMIVGWDKRGPGLYYVDSDGTRLSNNMFSVGSGSTYAYGVLDSGYKWDMSVEE  150

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGEL  247
            A EL +RSIYHAT RD  SGGV ++YH+   GW K+S  DV +L
Sbjct  151  AYELGKRSIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVMDL  194



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score =   248 bits (632),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R LG + RL+EL NK RISVA ASKLL+N++Y Y+
Sbjct  38   KKVIEINPYLLGTMAGGAADCSFWERELGRRARLYELRNKERISVAAASKLLSNMVYGYK  97

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGL+YVDS+G RLK + FSVGSGS YAYGVLD GY +DLSV +
Sbjct  98   GMGLSMGTMITGWDKQGPGLFYVDSDGQRLKNHMFSVGSGSTYAYGVLDAGYDYDLSVND  157

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYH  238
            A +LARRSIYHATFRD  SGG  +VYHV  +GWK +S  DV +LHY 
Sbjct  158  AIDLARRSIYHATFRDAYSGGSVNVYHVQQDGWKFISNTDVMDLHYE  204



>gb|AAY98499.1| LMP X [Swiftia exserta]
Length=268

 Score =   248 bits (632),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK RISVA ASKLLAN++Y YR
Sbjct  96   KKVIEINPYLLGTMAGGAADCSYWERVLAKQCRIYELRNKERISVAAASKLLANMVYYYR  155

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDS+G RL  N FSVGSGS +AYGVLD+GYR DLSV+E
Sbjct  156  GMGLSMGTMICGWDKRGPGLYYVDSDGSRLSNNIFSVGSGSTFAYGVLDSGYRPDLSVQE  215

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L  R+IYHAT RD  SGGV ++YH+   GW K+S +DVG+LHY Y
Sbjct  216  AYDLGERAIYHATHRDAYSGGVVNMYHMQETGWVKVSQNDVGQLHYKY  263



>pdb|3UNB|K Chain K, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|Y Chain Y, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|MM Chain m, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|1 Chain 1, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|K Chain K, Mouse Constitutive 20s Proteasome
 pdb|3UNE|Y Chain Y, Mouse Constitutive 20s Proteasome
 pdb|3UNE|MM Chain m, Mouse Constitutive 20s Proteasome
 pdb|3UNE|1 Chain 1, Mouse Constitutive 20s Proteasome
Length=205

 Score =   245 bits (626),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  32   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  91

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  92   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEE  151

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  226
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  152  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSV  202



>ref|XP_005825075.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
 gb|EKX38095.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
Length=290

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK IEI PY+LGTMAGGAADC FW R+LG  CRL+EL NK RI+ A ASKLL NI+YSY+
Sbjct  108  KKCIEITPYLLGTMAGGAADCMFWERHLGRLCRLYELRNKERITTAAASKLLHNIMYSYK  167

Query  558  GMGLSVGTMIAGWDEK-GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  382
            G GLS+GTMIAGWD+  GP LYY DSEG R+KG +FSVGSGSPYAYGVLD GY+FD+S++
Sbjct  168  GYGLSMGTMIAGWDKDIGPNLYYCDSEGTRVKGQKFSVGSGSPYAYGVLDEGYKFDMSID  227

Query  381  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            +A EL RR+IYHATFRD  SGG  SVYHV  NGW K+S DDV  LH  Y
Sbjct  228  DACELGRRAIYHATFRDAMSGGRVSVYHVHENGWTKISMDDVQLLHEKY  276



>gb|ADQ00176.1| 20S proteasome beta subunit E type beta 5 [Chlamydomonas sp. 
ICE-L]
Length=170

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  699  MAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGW  520
            MAGGAADCQFW RNLG +CRL+EL N +RI+V  ASKLLAN ++SYRGMGLS+GTM+AG+
Sbjct  1    MAGGAADCQFWQRNLGKQCRLYELNNGKRITVCAASKLLANTMFSYRGMGLSMGTMVAGF  60

Query  519  DEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHAT  340
            D  GPGLYYVDS+G R KG RFSVGSGS YAYG+LD+GY++D+ V+EA EL RR+IYHAT
Sbjct  61   DATGPGLYYVDSDGQRTKGQRFSVGSGSLYAYGILDSGYKWDMPVDEAIELGRRAIYHAT  120

Query  339  FRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  229
            FRD ASGG  SVYHV  +GWKK+ GDDV ELHY YYP
Sbjct  121  FRDCASGGTVSVYHVTKDGWKKVHGDDVSELHYKYYP  157



>ref|XP_007258118.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Astyanax 
mexicanus]
 ref|XP_007258119.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Astyanax 
mexicanus]
Length=269

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  97   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  156

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G++F+VGSGS YAYGVLD+G R DL+VEE
Sbjct  157  GMGLSMGTMICGWDKRGPGLYYVDSEGNRVCGDQFAVGSGSMYAYGVLDSGLRQDLTVEE  216

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  220
            A +L RR+IY AT+RD  SGG  ++YHV   GWK++S +DV +LH+ Y   +A
Sbjct  217  ACDLGRRAIYQATYRDAYSGGQVNLYHVHSEGWKRVSQEDVLQLHHQYQSQKA  269



>ref|XP_008332973.1| PREDICTED: proteasome subunit beta type-5 [Cynoglossus semilaevis]
Length=278

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R+DLSV+E
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVSGDLFAVGSGSMYAYGVMDSGLRYDLSVDE  219

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  202
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV +LH  Y   E      E
Sbjct  220  ACELGRRAIYQATYRDAYSGGQVNLYHVQSEGWTRVSQDDVLKLHQKYNDQEKLETAQE  278



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y+Y+
Sbjct  103  KKVIEINPYLLGTMAGGAADCSFWERVLSQQCRIYELRNKERISVAAASKLLANMVYNYK  162

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDS+G R+    FSVGSGS YAYGVLD+GYR++LSV+E
Sbjct  163  GMGLSMGTMICGWDKRGPGLYYVDSDGTRITNYMFSVGSGSTYAYGVLDSGYRYELSVQE  222

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L +R+IYHAT RD  SGGV ++YH+   GW K+S +DV ELHY Y
Sbjct  223  AYDLGQRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQNDVKELHYKY  270



>ref|XP_004994692.1| LMP X protein [Salpingoeca rosetta]
 gb|EGD72869.1| LMP X protein [Salpingoeca rosetta]
Length=292

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R L  +CRL EL N  RISVA ASK+LANI+Y YR
Sbjct  111  KKVIEINPYLLGTMAGGAADCSYWERVLAKECRLFELRNGERISVAAASKILANIVYHYR  170

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGPGL+YVDS+G RL  N FSVGSGS YAYGVLD GYR+DLSVEE
Sbjct  171  GMGLSMGTMICGWDKKGPGLFYVDSDGTRLTNNLFSVGSGSTYAYGVLDAGYRWDLSVEE  230

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKK-LSGDDVGELHYHY  235
            A ELARR+IYHATFRD  SGG  ++YH+   GW++ L+  DVG LHY Y
Sbjct  231  AHELARRAIYHATFRDAYSGGHINLYHMKETGWERILNMQDVGPLHYEY  279



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLANI+Y+Y+
Sbjct  103  KKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISVAAASKLLANIVYNYK  162

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDS+G RL  N FSVGSGS YAYGVLD+GY +D+ VEE
Sbjct  163  GMGLSMGTMIVGWDKRGPGLYYVDSDGTRLSNNMFSVGSGSTYAYGVLDSGYSWDMGVEE  222

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL +R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  223  AYELGKRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVMDLHYKY  270



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASK+LAN++Y+Y+
Sbjct  88   KKVIEINPYLLGTMAGGAADCMFWERVLAKQCRIYELRNKERISVAAASKILANMVYNYK  147

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+ GPGL+YVDS+G RLKGN FSVGSGS YAYGV+D+GYR+DLSV E
Sbjct  148  GMGLSMGTMICGWDKHGPGLFYVDSDGQRLKGNMFSVGSGSTYAYGVMDSGYRYDLSVAE  207

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  241
            A +L +RSIYHAT RD  SGGV ++YH+   GW+ +S  DV ++HY
Sbjct  208  ALDLGKRSIYHATHRDAYSGGVVNLYHMKETGWEFISQTDVLDIHY  253



>pdb|4R3O|L Chain L, Human Constitutive 20s Proteasome
 pdb|4R3O|Z Chain Z, Human Constitutive 20s Proteasome
 pdb|4R67|L Chain L, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|Z Chain Z, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|NN Chain n, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|3 Chain 3, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=201

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  32   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  91

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  92   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  151

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  152  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  199



>pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|Z Chain Z, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
Length=204

 Score =   243 bits (621),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  32   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  91

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  92   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  151

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  152  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  199



>emb|CAA66312.1| LMP7-like protein [Geodia cydonium]
Length=280

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R L   CR++EL NK RISVA ASK+L+N++Y Y+
Sbjct  106  KKVIEINPYLLGTMAGGAADCAYWERQLAFSCRVYELRNKERISVAAASKILSNMVYRYK  165

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGPGLYYVDS+G RL  + FSVGSGS YAYGVLD+GY +DLSVEE
Sbjct  166  GMGLSMGTMICGWDKKGPGLYYVDSDGSRLTHHMFSVGSGSTYAYGVLDSGYSYDLSVEE  225

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L +R+IYHAT RD  SGGV ++YH+   GW K+S  DV ELHY Y
Sbjct  226  ARDLGKRAIYHATHRDAYSGGVVNLYHMMETGWVKVSQTDVKELHYQY  273



>gb|EPY87607.1| proteasome subunit beta type-5-like isoform 1 [Camelus ferus]
Length=198

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  26   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  85

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  86   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLEVEE  145

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  146  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  193



>dbj|BAA08204.1| proteasome subunit RCX [Rattus rattus]
Length=208

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  36   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  95

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VEE
Sbjct  96   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEE  155

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  156  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  203



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  132  KKVIEINPYLLGTMAGGAADCSFWERELARRCRIYELRNKERISVAAASKLLANMVYGYK  191

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
             MGLS+GTMI GWD++GP LYYVDS+G RL G+ FSVGSGS YAYGVLD G+R+D++ EE
Sbjct  192  NMGLSMGTMITGWDKRGPELYYVDSDGTRLHGDMFSVGSGSTYAYGVLDAGFRYDMTPEE  251

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RRSIYHAT RD  SGG  +VYHV   GW K+S  DV +LHY Y
Sbjct  252  ACELGRRSIYHATHRDAYSGGFVNVYHVREEGWVKISSTDVNQLHYGY  299



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYTYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>gb|AAP36588.1| Homo sapiens proteasome (prosome, macropain) subunit, beta type, 
5 [synthetic construct]
Length=209

 Score =   243 bits (620),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  36   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  95

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  96   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  155

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  156  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  203



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   245 bits (626),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASKLL N++YSY+
Sbjct  101  KKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKLLGNMVYSYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY FDLSV +
Sbjct  161  GMGLSMGTMITGWDKTGPNLFYVDSDGQRLKGDLFSVGSGSTFAYGVLDSGYDFDLSVSD  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL +RSIYHAT RD  SGG  ++YHV  +GW+     DVG LHY Y
Sbjct  221  ALELGKRSIYHATHRDAMSGGSVNLYHVTESGWEYHGNHDVGPLHYEY  268



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   246 bits (627),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINP++LGTMAGGAADC FW RNLG++CRL+EL N RRI+VA ASKLLAN++ +YR
Sbjct  106  KKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVAAASKLLANVMSAYR  165

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTMI GWDE GP LYYVD++G RLKG  FSVGSGS YAYGVLDN +R DLSVEE
Sbjct  166  GYGLSMGTMITGWDETGPQLYYVDNDGTRLKGKYFSVGSGSMYAYGVLDNHWREDLSVEE  225

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L +R+IYHAT RD ASGG+ ++YHV  +GWK + G DV ++HY +
Sbjct  226  AIDLGKRAIYHATHRDAASGGINNLYHVTADGWKYIHGIDVNDMHYEF  273



>ref|XP_008292170.1| PREDICTED: proteasome subunit beta type-5 [Stegastes partitus]
Length=271

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G RFDL+VEE
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGLRFDLTVEE  219

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A ELARR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH  Y
Sbjct  220  ACELARRAIYQATYRDAYSGGQVNLYHVHGKGWTRVSQDDVLMLHQQY  267



>dbj|BAA06097.1| proteasome subunit X [Homo sapiens]
 gb|AAP35423.1| proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|AIC59195.1| hypothetical protein, partial [synthetic construct]
Length=208

 Score =   243 bits (619),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  36   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  95

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  96   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  155

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  156  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  203



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQ+W R +  +CR++EL NK RISVA ASKLLANI+Y+Y+
Sbjct  103  KKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVAAASKLLANIVYNYK  162

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGPGLYYVDS+G R+    FSVGSGS YAYGVLD+ YR+DLSVEE
Sbjct  163  GMGLSMGTMICGWDKKGPGLYYVDSDGTRMTNAMFSVGSGSTYAYGVLDSSYRWDLSVEE  222

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A  L  R+IYHA  RD  +GGV ++YH+  +GW K+S +D+GELHY +
Sbjct  223  AYALGERAIYHAAHRDAFTGGVVNMYHMKESGWVKVSQNDIGELHYKF  270



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+
Sbjct  93   KKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYK  152

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+ GP +YYVDSEG R+KG+ FSVGSGS +AYGVLD GY +DLS EE
Sbjct  153  GMGLSMGTMICGWDKSGPAIYYVDSEGSRMKGDLFSVGSGSTFAYGVLDQGYHWDLSEEE  212

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  241
            A +L RRSIY AT RD  SG   ++YH+GPNGW+ ++  DV +LHY
Sbjct  213  ALDLGRRSIYAATHRDAYSGNTINLYHMGPNGWRFIANYDVMQLHY  258



>ref|XP_004694702.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Condylura 
cristata]
Length=208

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  36   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  95

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  96   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVEE  155

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  156  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  203



>gb|ADL27419.1| proteasome subunit beta type [Pheronema raphanus]
Length=279

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R L  +CRL+EL NK RISVA ASK+L+N LY Y+
Sbjct  107  KKVIEINPYLLGTMAGGAADCSYWERRLAQECRLYELRNKERISVAAASKVLSNFLYYYK  166

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMI GWD+KGPGLYYVDS+G R+  + FSVGSGS YAYGVLD+GY++DLS +E
Sbjct  167  GMGLSVGTMICGWDKKGPGLYYVDSDGTRMTHHMFSVGSGSVYAYGVLDSGYKWDLSDDE  226

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RRSIYHAT RD  SGGV ++YH+   GW K+S DDV  LHY Y
Sbjct  227  ARELGRRSIYHATHRDAYSGGVVNLYHMKETGWIKISQDDVMTLHYKY  274



>dbj|GAM19629.1| hypothetical protein SAMD00019534_028040 [Acytostelium subglobosum 
LB1]
Length=280

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEI P +LGTMAGGAADC FW R LG +CRL++L NK  ISV+ ASK+LANI+YSY+
Sbjct  95   KKVIEITPNLLGTMAGGAADCSFWERELGRRCRLYQLRNKELISVSAASKILANIVYSYK  154

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTM+ GWD+ GP LYYVD++G RLKG RFSVGSGS YAYGVLD+G+++++S EE
Sbjct  155  GYGLSMGTMVTGWDKTGPCLYYVDNDGTRLKGQRFSVGSGSTYAYGVLDSGFKWEMSNEE  214

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  208
            A EL RRS+YHAT RD  SGG  +VYHV  +GWKK+S DD  +L+  YY V AA V+
Sbjct  215  AYELGRRSVYHATNRDAMSGGFINVYHVQKDGWKKISSDDCFQLYQKYYNVRAAGVD  271



>dbj|BAE93066.1| low molecular mass polypeptide [Lethenteron camtschaticum]
Length=204

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  33   KKVIEINPYLLGTMAGGAADCMYWERVLAKQCRIYELRNKERISVAAASKLLANMVYQYK  92

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGPGLYYVD EG RL G+ F+VGSGSPYA+GVLD+GYR DLS EE
Sbjct  93   GMGLSMGTMICGWDKKGPGLYYVDDEGMRLPGSMFAVGSGSPYAFGVLDSGYREDLSKEE  152

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L RR+I  AT RD  SGGV ++YH+   GW K+S DDV EL Y +
Sbjct  153  AYDLGRRAIASATHRDAYSGGVVNLYHMCQTGWIKVSQDDVSELQYKF  200



>ref|XP_006835507.1| PREDICTED: proteasome subunit beta type-5 [Chrysochloris asiatica]
Length=263

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V ELH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVAELHDKY  258



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y+
Sbjct  101  KKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY +DLS++E
Sbjct  161  GMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDYDLSIKE  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  221  ALELGRRSIYHATHRDAMSGGSVNLYHVTEKGWTYHGNHDVGSLHWEY  268



>gb|EWM22648.1| proteasome subunit beta type 5 [Nannochloropsis gaditana]
Length=278

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW RNLG++CRL+EL +K RISVA ASKLLAN +  YR
Sbjct  101  KKVIEINPYLLGTMAGGAADCSFWERNLGIQCRLYELRHKERISVAAASKLLANTVMQYR  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTMI GWD+ GP L+YVD++G RLKGN FSVGSGS YAYGVLD  YR DLS +E
Sbjct  161  GYGLSMGTMITGWDKTGPQLFYVDNDGMRLKGNLFSVGSGSTYAYGVLDAHYRKDLSADE  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  211
            A EL RR+IYHAT RD  SGG+ +VYHV   GW K+   D  ELHY Y   + A++
Sbjct  221  AIELGRRAIYHATHRDAYSGGIINVYHVQEQGWVKVFSGDCNELHYKYQEEKTASM  276



>ref|XP_004698955.1| PREDICTED: proteasome subunit beta type-5 [Echinops telfairi]
Length=263

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_001626004.1| predicted protein [Nematostella vectensis]
 gb|EDO33904.1| predicted protein [Nematostella vectensis]
Length=279

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASK+LAN++Y Y+
Sbjct  106  KKVIEINPYLLGTMAGGAADCSFWERLLAKQCRIYELRNKERISVAAASKILANMVYYYK  165

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGPGLYYVDS+G RL    FSVGSGS YAYGV+D+GY++D+S EE
Sbjct  166  GMGLSMGTMICGWDKKGPGLYYVDSDGTRLSNQMFSVGSGSTYAYGVMDSGYKYDMSPEE  225

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L  RSIYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  226  AYDLGVRSIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVAKLHYQY  273



>ref|XP_003421032.1| PREDICTED: proteasome subunit beta type-5 [Loxodonta africana]
Length=263

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004313402.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Tursiops 
truncatus]
Length=208

 Score =   241 bits (615),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  36   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  95

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  96   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  155

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S ++V +LH  Y
Sbjct  156  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSNNVADLHDKY  203



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CRL++L NK RISVA ASKLLAN++Y Y+
Sbjct  104  KKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVAAASKLLANMVYQYK  163

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDS+G RLKG+ FSVGSGS YAYGVLD  +++DL++EE
Sbjct  164  GMGLSMGTMICGWDKRGPGLYYVDSDGSRLKGDLFSVGSGSTYAYGVLDADHKWDLTLEE  223

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L  R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  224  AYDLGNRAIYHATHRDAGSGGVCNLYHMQETGWIKVSQTDVTDLHYKY  271



>gb|EFA82937.1| proteasome subunit beta type 5 [Polysphondylium pallidum PN500]
Length=277

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEI PY+LGTMAGGAADC +W R LG +CRL EL NK  ISVA ASK+LANI+Y Y+
Sbjct  94   KKVIEITPYLLGTMAGGAADCSYWERELGRQCRLFELRNKEMISVAAASKILANIVYGYK  153

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            G GLS+GTM+ GWD+ GP LYYVDSEG RLKG RF+VGSGS YAYGVLD+G+ ++++ E+
Sbjct  154  GYGLSMGTMVTGWDKTGPCLYYVDSEGTRLKGLRFAVGSGSTYAYGVLDSGFDWNMTDEQ  213

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  208
            A EL RRS+YHAT RD  SGG  +VYHV  +GWKK+S DD  +L+  YY V+A  V+
Sbjct  214  ACELGRRSVYHATHRDAMSGGFINVYHVQKDGWKKISSDDCFQLYQKYYNVKATGVD  270



>ref|XP_004389982.1| PREDICTED: proteasome subunit beta type-5 [Trichechus manatus 
latirostris]
Length=263

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_003755883.1| PREDICTED: proteasome subunit beta type-5 [Sarcophilus harrisii]
Length=263

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY FDL+VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSFDLTVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +L+  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLNDKY  258



>ref|XP_005338834.1| PREDICTED: proteasome subunit beta type-5 [Ictidomys tridecemlineatus]
Length=208

 Score =   241 bits (614),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  36   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  95

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  96   GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLDVEQ  155

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW  +S D+V +LH  Y
Sbjct  156  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIHVSSDNVADLHDKY  203



>ref|XP_008121563.1| PREDICTED: proteasome subunit beta type-5 [Anolis carolinensis]
Length=279

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  103  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  162

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY  +LSVEE
Sbjct  163  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYGVMDRGYSHNLSVEE  222

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH  244
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S DDV +LH
Sbjct  223  AYDLARRAIYQATYRDAYSGGTVNLYHVRQDGWIRVSSDDVSKLH  267



>gb|ELR56586.1| Proteasome subunit beta type-5, partial [Bos mutus]
Length=266

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  94   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  153

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  154  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  213

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  214  AYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  261



>ref|XP_005978061.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Pantholops 
hodgsonii]
Length=263

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004010385.1| PREDICTED: proteasome subunit beta type-5 [Ovis aries]
 ref|XP_005685312.1| PREDICTED: proteasome subunit beta type-5 [Capra hircus]
Length=263

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004421295.1| PREDICTED: proteasome subunit beta type-5 [Ceratotherium simum 
simum]
Length=263

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_005933706.1| PREDICTED: proteasome subunit beta type-5-like [Haplochromis 
burtoni]
Length=281

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLMLHHQY  277



>ref|NP_001032701.1| proteasome subunit beta type-5 [Bos taurus]
 ref|XP_005895501.1| PREDICTED: proteasome subunit beta type-5 [Bos mutus]
 ref|XP_010829574.1| PREDICTED: proteasome subunit beta type-5 [Bison bison bison]
 sp|Q32KL2.1|PSB5_BOVIN RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Bos taurus]
 gb|AAI10040.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Bos taurus]
 tpg|DAA25764.1| TPA: proteasome subunit beta type-5 precursor [Bos taurus]
Length=263

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006066544.1| PREDICTED: proteasome subunit beta type-5 [Bubalus bubalis]
Length=263

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVSLYHVREDGWVRVSSDNVADLHDKY  258



>ref|XP_001745267.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89845.1| predicted protein [Monosiga brevicollis MX1]
Length=247

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R L ++CRL+EL N  RISVA ASK+LANI+++YR
Sbjct  71   KKVIEINPYLLGTMAGGAADCSYWERYLAMQCRLYELRNGERISVAAASKVLANIVWNYR  130

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
             MGLS+GTM+ GWD+KGPGL+YVDS+G RL  N FSVGSGS YAYGVLD GY++DLS EE
Sbjct  131  NMGLSMGTMVCGWDKKGPGLFYVDSDGTRLTNNMFSVGSGSTYAYGVLDAGYKWDLSDEE  190

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +L RR+IYHATFRD  SGG  ++YH+   GW K+S D V +LHY Y
Sbjct  191  AQDLGRRAIYHATFRDAYSGGTVNLYHMRQTGWVKISADSVHDLHYRY  238



>ref|XP_007949373.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Orycteropus 
afer afer]
Length=263

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_005740284.1| PREDICTED: proteasome subunit beta type-5-like [Pundamilia nyererei]
Length=281

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>ref|XP_004565403.1| PREDICTED: proteasome subunit beta type-5-like [Maylandia zebra]
Length=271

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  219

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  220  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  267



>ref|XP_006988553.1| PREDICTED: proteasome subunit beta type-5 [Peromyscus maniculatus 
bairdii]
Length=263

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLEVED  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  NGW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVRENGWIRVSSDNVADLHDKY  258



>ref|XP_003457456.2| PREDICTED: proteasome subunit beta type-5-like [Oreochromis niloticus]
Length=281

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>ref|NP_035316.1| proteasome subunit beta type-5 [Mus musculus]
 sp|O55234.3|PSB5_MOUSE RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Mus musculus]
 gb|AAD50536.1|AF060091_1 proteasome subunit X [Mus musculus]
 dbj|BAA24916.1| PSMB5 [Mus musculus]
 dbj|BAA24917.1| PSMB5 [Mus musculus]
 dbj|BAE21876.1| unnamed protein product [Mus musculus]
 gb|AAI06145.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
 gb|EDL36339.1| mCG8712, isoform CRA_b [Mus musculus]
Length=264

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  226
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSV  261



>gb|AAH12246.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
Length=264

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  226
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSNDNVADLHDKYSSV  261



>ref|XP_002753673.3| PREDICTED: proteasome subunit beta type-5 [Callithrix jacchus]
Length=268

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  96   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  155

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  156  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  215

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  216  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  263



>ref|XP_003924370.1| PREDICTED: proteasome subunit beta type-5 [Saimiri boliviensis 
boliviensis]
Length=263

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|ABQ50544.1| hypothetical protein [Brassica rapa]
Length=218

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 129/182 (71%), Gaps = 45/182 (25%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPYMLGTMAGGAADCQFWHRNLG+K                             
Sbjct  78   KKIIEINPYMLGTMAGGAADCQFWHRNLGIK-----------------------------  108

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
                            GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY+FD+SVEE
Sbjct  109  ----------------GPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEE  152

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A+ELARRSIYHATFRDGASGGVASVYHVGPNGW KLSGDDVGELHYHYYPV  A  E  M
Sbjct  153  ASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHYYPVPPAIAEQVM  212

Query  198  TE  193
             E
Sbjct  213  EE  214



>ref|XP_005875924.1| PREDICTED: proteasome subunit beta type-5-like [Myotis brandtii]
 gb|EPQ13719.1| Proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLL N+LY Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLVNMLYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLSVGTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSVGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>gb|ADO27969.1| proteasome subunit beta type-5 [Ictalurus furcatus]
Length=266

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  94   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  153

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGVLD+G+R DL++EE
Sbjct  154  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDMFAVGSGSMYAYGVLDSGHRTDLTIEE  213

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  220
            A +L RR+IY ATFRD  SGG  ++Y V   GW+++S DDV  LH+ +   +A
Sbjct  214  ACDLGRRAIYQATFRDAYSGGQVNLYRVHSEGWERVSQDDVLALHHQFQSQKA  266



>ref|XP_002926051.1| PREDICTED: proteasome subunit beta type-5 [Ailuropoda melanoleuca]
 gb|EFB18962.1| hypothetical protein PANDA_015661 [Ailuropoda melanoleuca]
Length=263

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDEY  258



>ref|XP_001379940.1| PREDICTED: proteasome subunit beta type-5 [Monodelphis domestica]
Length=263

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY FDLSVE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSFDLSVED  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +L+  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLNDKY  258



>ref|XP_008708757.1| PREDICTED: proteasome subunit beta type-5 [Ursus maritimus]
Length=263

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +L   Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWTRVSSDNVADLQDKY  258



>gb|EFX81688.1| hypothetical protein DAPPUDRAFT_303318 [Daphnia pulex]
Length=277

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEIN ++LGTMAGGAADC +W R L  +CRL+EL NK RISVA ASKLL N++Y+Y+
Sbjct  102  KKIIEINDFLLGTMAGGAADCTYWERVLSKQCRLYELRNKERISVAAASKLLVNMVYNYK  161

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+G MIAGWD+KGPGLYYVD++G R  G  FSVGSGS YAYGVLD+GYR DLS EE
Sbjct  162  GMGLSMGVMIAGWDKKGPGLYYVDNDGTRTPGQVFSVGSGSLYAYGVLDSGYRNDLSDEE  221

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  223
            A EL RR+IYHAT+RD +SGG+  VYH+   GW K+S  D  ELHY Y   E
Sbjct  222  AYELGRRAIYHATYRDASSGGIIRVYHIKSTGWVKISEQDCTELHYQYEEAE  273



>ref|XP_003987515.1| PREDICTED: proteasome subunit beta type-5 [Felis catus]
 ref|XP_007098030.1| PREDICTED: proteasome subunit beta type-5 [Panthera tigris altaica]
Length=263

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPY+LGTMAGGAADC FW R LG++CRLHEL ++ RISVA ASKLLANI+Y Y+
Sbjct  102  KKIIEINPYLLGTMAGGAADCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVYEYK  161

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMIAGWD+ GP L+YVDS+G RL+G RFSVGSGS +AYGVLD  YR+D+   E
Sbjct  162  GMGLSMGTMIAGWDKTGPQLFYVDSDGVRLRGTRFSVGSGSTFAYGVLDQFYRWDMDAAE  221

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYY--------PVE  223
            AAEL RR+I+HAT RD  SGG  +VYHV  +GW  LS DD G   Y  Y        P  
Sbjct  222  AAELGRRAIFHATHRDAYSGGYINVYHVKADGWVNLSHDDSGITKYAEYMGFRAQTAPTT  281

Query  222  AAAVE  208
            A+ V+
Sbjct  282  ASTVD  286



>ref|XP_004694701.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Condylura 
cristata]
Length=263

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_010376681.1| PREDICTED: proteasome subunit beta type-5 [Rhinopithecus roxellana]
Length=271

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  99   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  158

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  159  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  218

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  219  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  266



>ref|NP_001099197.2| proteasome subunit beta type-5 [Rattus norvegicus]
 gb|EDM14180.1| proteasome (prosome, macropain) subunit, beta type 5, isoform 
CRA_a [Rattus norvegicus]
Length=263

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006883201.1| PREDICTED: proteasome subunit beta type-5 [Elephantulus edwardii]
Length=263

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTM GGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMTGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYSYDLEVEK  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_005707411.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
 gb|EME30891.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
Length=275

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 146/184 (79%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEIN Y+LGTMAGGAADC FW R LG++CR+ EL NK RISVA ASK+L N +Y Y+
Sbjct  90   KKVIEINKYLLGTMAGGAADCTFWERYLGMRCRIFELKNKERISVAAASKILCNTVYQYK  149

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD+KGP +YYVDSEG RLKG++FSVGSGS +A GVLD GY++++SVEE
Sbjct  150  GMGLSMGTMIMGWDKKGPHIYYVDSEGTRLKGSKFSVGSGSTHALGVLDQGYKWNMSVEE  209

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG-ELHYHYYPVEA--AAVE  208
            A EL RRSIYHAT RD  SGG  +VY++GP+GWK +S +D G + HY Y   +A  A  +
Sbjct  210  ACELGRRSIYHATHRDAFSGGYINVYYIGPDGWKFISHEDSGFDKHYQYAADKATEAQTQ  269

Query  207  HEMT  196
             +M+
Sbjct  270  QQMS  273



>ref|XP_007449602.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Lipotes 
vexillifer]
Length=263

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>gb|AAW24786.1| SJCHGC05978 protein [Schistosoma japonicum]
 emb|CAX70716.1| proteasome (prosome, macropain) subunit, beta type 5 [Schistosoma 
japonicum]
 emb|CAX75728.1| proteasome (prosome, macropain) subunit, beta type 5 [Schistosoma 
japonicum]
 emb|CAX75729.1| proteasome (prosome, macropain) subunit, beta type 5 [Schistosoma 
japonicum]
 emb|CAX75730.1| proteasome (prosome, macropain) subunit, beta type 5 [Schistosoma 
japonicum]
Length=264

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEIN Y+LGTMAGGAADCQFW R L   CRL EL NK RISVA ASKLLAN++Y+Y+
Sbjct  94   KKIIEINKYLLGTMAGGAADCQFWERVLAKHCRLFELRNKERISVAAASKLLANMVYNYK  153

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GT I GWD+ GPG+YYVD++G R  GN FSVGSGSPYAYGVLD GY++++S E+
Sbjct  154  GMGLSIGTTIVGWDKNGPGVYYVDTDGNRTPGNLFSVGSGSPYAYGVLDAGYKYEMSDED  213

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A ELA+RSI+HAT RD ASGG  ++YH+  +GWK +   DVGEL+Y Y
Sbjct  214  AYELAKRSIFHATHRDAASGGFVNLYHMKEDGWKFIGIFDVGELYYKY  261



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006217298.1| PREDICTED: proteasome subunit beta type-5 [Vicugna pacos]
 ref|XP_010953019.1| PREDICTED: proteasome subunit beta type-5 [Camelus bactrianus]
 ref|XP_010987732.1| PREDICTED: proteasome subunit beta type-5 [Camelus dromedarius]
Length=263

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006100131.1| PREDICTED: proteasome subunit beta type-5 [Myotis lucifugus]
Length=263

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004054982.1| PREDICTED: proteasome subunit beta type-5 isoform 3 [Gorilla 
gorilla gorilla]
Length=268

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  96   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  155

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  156  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  215

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  216  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  263



>dbj|BAA10935.1| nurse shark LMPX [Ginglymostoma cirratum]
Length=259

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  87   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  146

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGVLD  YR D+S  E
Sbjct  147  GMGLSMGTMICGWDKRGPGLYYVDSEGNRVSGQIFSVGSGSVYAYGVLDRAYRHDMSPTE  206

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A ELA+++IYHAT+RD  SGG+ S+YHV   GW ++  DDV +LH  Y
Sbjct  207  AYELAKQAIYHATYRDAYSGGIVSLYHVKETGWVRICRDDVMDLHQKY  254



>ref|XP_004402154.1| PREDICTED: proteasome subunit beta type-5 [Odobenus rosmarus 
divergens]
Length=263

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>sp|P28075.3|PSB5_RAT RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Rattus norvegicus]
Length=263

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_010744420.1| PREDICTED: proteasome subunit beta type-5 [Larimichthys crocea]
Length=273

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DLSVEE
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGLRHDLSVEE  219

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S +DV  LH+ Y
Sbjct  220  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRVSQEDVLMLHHQY  267



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  105  KKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVAAASKLLANMVYYYK  164

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDS+G R+    FSVGSGS YAYG+LD+G++ DL  EE
Sbjct  165  GMGLSMGTMICGWDKRGPGLYYVDSDGTRMTNYMFSVGSGSTYAYGILDSGFKHDLEDEE  224

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+I+HAT RD  SGG  ++YHV   GW K+S DDVG L+Y Y
Sbjct  225  AYDLARRAIFHATHRDAYSGGSVNLYHVKETGWVKISRDDVGPLYYQY  272



>ref|XP_008156742.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Eptesicus 
fuscus]
Length=263

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006802789.1| PREDICTED: proteasome subunit beta type-5-like [Neolamprologus 
brichardi]
Length=281

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>ref|XP_006776843.1| PREDICTED: proteasome subunit beta type-5 [Myotis davidii]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLDVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|NP_002788.1| proteasome subunit beta type-5 isoform 1 [Homo sapiens]
 ref|NP_001126063.1| proteasome subunit beta type-5 precursor [Pongo abelii]
 ref|XP_003808166.1| PREDICTED: proteasome subunit beta type-5 [Pan paniscus]
 sp|P28074.3|PSB5_HUMAN RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit MB1; AltName: Full=Proteasome subunit X; Flags: 
Precursor [Homo sapiens]
 sp|Q5R8S2.3|PSB5_PONAB RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Pongo abelii]
 emb|CAA64838.1| proteasome [Homo sapiens]
 gb|AAH57840.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 emb|CAH91838.1| hypothetical protein [Pongo abelii]
 gb|AAI07721.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|EAW66193.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 gb|EAW66195.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 dbj|BAG34836.1| unnamed protein product [Homo sapiens]
 dbj|BAI47149.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
 gb|ADQ33015.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|ETE64662.1| Proteasome subunit beta type-5, partial [Ophiophagus hannah]
Length=290

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KKIIEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  70   KKIIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  129

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY  DLSVE+
Sbjct  130  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTVFSVGSGSVYAYGVMDRGYSHDLSVED  189

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  199
            A +LARR+IY AT+RD  SGG  ++YHV  +GW  +S +DV +L   +    A A E E 
Sbjct  190  AYDLARRAIYQATYRDAYSGGSVNLYHVRSDGWIHVSSNDVSDLRELFLDTSAKAKESER  249

Query  198  TE  193
             E
Sbjct  250  GE  251



>ref|XP_004283228.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Orcinus 
orca]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_006175925.1| PREDICTED: proteasome subunit beta type-5 [Camelus ferus]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|NP_001247774.1| proteasome subunit beta type-5 [Macaca mulatta]
 ref|XP_003901626.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Papio anubis]
 gb|EHH27742.1| hypothetical protein EGK_18013 [Macaca mulatta]
 gb|EHH63472.1| hypothetical protein EGM_16445 [Macaca fascicularis]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>emb|CAD97956.1| hypothetical protein [Homo sapiens]
Length=266

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  94   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  153

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  154  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  213

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  214  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  261



>ref|XP_007180616.1| PREDICTED: proteasome subunit beta type-5 [Balaenoptera acutorostrata 
scammoni]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004054980.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004054981.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004054983.1| PREDICTED: proteasome subunit beta type-5 isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004054984.1| PREDICTED: proteasome subunit beta type-5 isoform 5 [Gorilla 
gorilla gorilla]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|EPY26658.1| 20S proteasome subunit beta 5 [Angomonas deanei]
Length=207

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -3

Query  735  KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRG  556
            K++EIN Y+LGTMAGGAADCQ+W R LG++CRL EL N  RISVA ASK+L+NI YSYR 
Sbjct  37   KVLEINEYLLGTMAGGAADCQYWERVLGMECRLWELRNGSRISVAAASKILSNITYSYRN  96

Query  555  MGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEA  376
             GLS+GTM+AGWD+ GP LYYVD +G R+K N FSVGSGS YAYGVLD GYR +L+VEEA
Sbjct  97   HGLSMGTMVAGWDQFGPSLYYVDDKGSRVKQNLFSVGSGSIYAYGVLDAGYRKNLTVEEA  156

Query  375  AELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  229
             +LARRSI+HAT+RDGASGG+ +VYHV  +G+ ++S D+  +L Y Y+P
Sbjct  157  CDLARRSIFHATYRDGASGGIVTVYHVHKDGYTRISRDNQTDLFYRYFP  205



>ref|XP_003474544.1| PREDICTED: proteasome subunit beta type-5 [Cavia porcellus]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEE
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLQVEE  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_007989004.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Chlorocebus 
sabaeus]
Length=263

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y+
Sbjct  101  KKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY  DLSV++
Sbjct  161  GMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDHDLSVKD  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  221  ALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGSLHWDY  268



>emb|CAF97719.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=268

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DLSVEE
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGLRHDLSVEE  219

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH  Y
Sbjct  220  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRVSQDDVLMLHQRY  267



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y+
Sbjct  101  KKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAYK  160

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY  DLSV++
Sbjct  161  GMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDHDLSVKD  220

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  221  ALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGNLHWDY  268



>ref|XP_006144566.1| PREDICTED: proteasome subunit beta type-5 [Tupaia chinensis]
 gb|ELW69249.1| Proteasome subunit beta type-5 [Tupaia chinensis]
Length=263

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_003260670.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Nomascus 
leucogenys]
 ref|XP_004091952.1| PREDICTED: proteasome subunit beta type-5 [Nomascus leucogenys]
Length=263

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>ref|XP_006913661.1| PREDICTED: proteasome subunit beta type-5 [Pteropus alecto]
 ref|XP_011371095.1| PREDICTED: proteasome subunit beta type-5 [Pteropus vampyrus]
 gb|ELK11254.1| Proteasome subunit beta type-5 [Pteropus alecto]
Length=263

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_008527207.1| PREDICTED: proteasome subunit beta type-5 [Equus przewalskii]
Length=263

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_001494538.2| PREDICTED: proteasome subunit beta type-5 isoform 1 [Equus caballus]
Length=263

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  738  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  559
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  91   KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  150

Query  558  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  379
            GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+
Sbjct  151  GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ  210

Query  378  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  235
            A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  211  AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515