BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005G05

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29212.1|  hypothetical protein JCGZ_16601                         192   3e-67   Jatropha curcas
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      187   3e-67   Vitis vinifera
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      183   1e-66   Nelumbo nucifera [Indian lotus]
emb|CDX95399.1|  BnaC04g27590D                                          189   3e-66   
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             184   3e-66   
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             191   4e-66   Capsella rubella
emb|CAN65776.1|  hypothetical protein VITISV_030414                     183   4e-66   Vitis vinifera
gb|KJB62320.1|  hypothetical protein B456_009G411600                    189   7e-66   Gossypium raimondii
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      182   9e-66   Populus euphratica
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      188   1e-65   Brassica rapa
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    191   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 180   1e-65   Morus notabilis
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              188   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    191   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    182   4e-65   Eucalyptus grandis [rose gum]
emb|CDY70033.1|  BnaCnng66420D                                          186   5e-65   Brassica napus [oilseed rape]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             186   5e-65   Eutrema salsugineum [saltwater cress]
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     182   5e-65   Eucalyptus grandis [rose gum]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             177   6e-65   Prunus persica
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    184   7e-65   Arabis alpina [alpine rockcress]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             187   8e-65   Eutrema salsugineum [saltwater cress]
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      177   8e-65   Prunus mume [ume]
ref|XP_002519426.1|  o-methyltransferase, putative                      187   1e-64   Ricinus communis
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     181   1e-64   Eucalyptus grandis [rose gum]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        187   1e-64   Tarenaya hassleriana [spider flower]
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      184   3e-64   Gossypium arboreum [tree cotton]
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    183   9e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    172   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    172   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_007027514.1|  O-methyltransferase family protein                 176   2e-63   
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    178   2e-63   Cicer arietinum [garbanzo]
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      172   2e-63   
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       173   2e-62   Cucumis sativus [cucumbers]
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      171   3e-62   Cucumis melo [Oriental melon]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   4e-62   Glycine max [soybeans]
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      176   5e-62   Glycine soja [wild soybean]
gb|KEH38506.1|  caffeic acid O-methyltransferase                        178   6e-62   Medicago truncatula
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    175   1e-61   
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    177   3e-61   Solanum lycopersicum
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    177   4e-61   Solanum tuberosum [potatoes]
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      169   4e-61   Fragaria vesca subsp. vesca
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    168   7e-61   
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        171   1e-60   Nicotiana tomentosiformis
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      174   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             168   4e-59   Phaseolus vulgaris [French bean]
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    161   3e-58   Sesamum indicum [beniseed]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             162   4e-58   
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    160   1e-57   Sesamum indicum [beniseed]
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             158   2e-57   Citrus clementina [clementine]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   158   3e-57   Citrus sinensis [apfelsine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    157   3e-57   Citrus sinensis [apfelsine]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    158   3e-55   Limonium latifolium
emb|CBI30187.3|  unnamed protein product                                185   6e-55   Vitis vinifera
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    157   1e-54   Limonium latifolium
gb|AAP03056.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    157   1e-54   Limonium latifolium
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    173   2e-54   Elaeis guineensis
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    151   3e-54   
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      170   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             148   1e-53   Citrus clementina [clementine]
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    153   2e-53   Solanum tuberosum [potatoes]
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   147   3e-52   Citrus sinensis [apfelsine]
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        166   1e-51   Medicago sativa subsp. x varia
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             137   2e-51   
gb|AES72848.2|  caffeic acid O-methyltransferase                        163   1e-50   Medicago truncatula
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 162   1e-50   
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   162   8e-50   Citrus sinensis [apfelsine]
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             162   2e-49   
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   129   5e-49   Citrus sinensis [apfelsine]
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   7e-49   Cicer arietinum [garbanzo]
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    172   7e-48   
gb|AAP03057.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    157   1e-47   Limonium latifolium
gb|AAP03051.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    150   3e-46   Limonium latifolium
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      167   1e-45   Brachypodium distachyon [annual false brome]
ref|NP_001048569.1|  Os02g0823400                                       166   4e-45   
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 166   4e-45   Medicago truncatula
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             115   1e-44   
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    162   1e-43   Setaria italica
ref|XP_009787879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    155   1e-43   Nicotiana sylvestris
gb|ACN25427.1|  unknown                                                 162   2e-43   Zea mays [maize]
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          161   4e-43   Sorghum bicolor [broomcorn]
gb|KJB62323.1|  hypothetical protein B456_009G411600                    159   9e-43   Gossypium raimondii
ref|NP_001149617.1|  LOC100283243                                       160   9e-43   
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg             154   1e-42   
dbj|BAJ96291.1|  predicted protein                                      158   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT14045.1|  Caffeic acid 3-O-methyltransferase                      152   2e-41   
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  92.0    3e-37   
ref|XP_006428523.1|  hypothetical protein CICLE_v10013676mg             132   4e-35   
gb|KFK45045.1|  hypothetical protein AALP_AA1G337000                    104   2e-31   Arabis alpina [alpine rockcress]
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   109   4e-31   Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   109   4e-31   Selaginella moellendorffii
gb|EEC74273.1|  hypothetical protein OsI_09508                          127   7e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    105   2e-30   
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          125   8e-30   Amborella trichopoda
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                      102   9e-30   Betula platyphylla [Asian white birch]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase               102   9e-30   Betula pendula [white birch]
gb|ACT87981.1|  caffeic acid O-methyltransferase                        102   1e-29   Jatropha curcas
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    104   1e-29   Cucumis melo [Oriental melon]
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    104   1e-29   Cucumis sativus [cucumbers]
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   1e-29   Malus domestica [apple tree]
gb|ABS57468.1|  caffeic acid O-methyl transferase                       103   1e-29   Leucaena leucocephala [cassie]
gb|ABI54118.1|  caffeic acid O-methyltransferase                        102   1e-29   Malus domestica [apple tree]
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)              103   2e-29   Clarkia breweri [fairy fans]
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   2e-29   
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...    103   2e-29   Clarkia breweri [fairy fans]
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         102   2e-29   Jatropha curcas
ref|XP_010478733.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  94.7    2e-29   Camelina sativa [gold-of-pleasure]
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                      103   2e-29   synthetic construct
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      103   2e-29   Prunus mume [ume]
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg             103   2e-29   Prunus persica
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    103   2e-29   Prunus dulcis [sweet almond]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase    99.8    2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg             103   2e-29   
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like      105   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    103   2e-29   Populus sieboldii x Populus grandidentata
gb|AID68566.1|  caffeic O-methyltransferase                             103   2e-29   Punica granatum [granado]
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    105   3e-29   Pyrus x bretschneideri [bai li]
gb|ABI54117.1|  caffeic acid O-methyltransferase                        101   3e-29   Malus domestica [apple tree]
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   3e-29   
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   3e-29   Elaeis guineensis
gb|KJB73218.1|  hypothetical protein B456_011G223000                    102   3e-29   Gossypium raimondii
gb|AAA80579.1|  3' flavonoid O-methyltransferase                        105   3e-29   Chrysosplenium americanum [water-carpet]
gb|KJB73217.1|  hypothetical protein B456_011G223000                    102   3e-29   Gossypium raimondii
gb|KJB73216.1|  hypothetical protein B456_011G223000                    102   3e-29   Gossypium raimondii
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   3e-29   Malus domestica [apple tree]
gb|AHM25237.1|  noraucuparin O-methyltransferase                        102   4e-29   Sorbus aucuparia [European mountain ash]
gb|KJB73213.1|  hypothetical protein B456_011G222800                    102   4e-29   Gossypium raimondii
ref|XP_002893750.1|  O-methyltransferase family 2 protein             95.9    4e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    104   5e-29   Citrus sinensis [apfelsine]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase               104   5e-29   Citrus aurantium [bitter orange]
ref|XP_010520934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    105   5e-29   Tarenaya hassleriana [spider flower]
gb|AFK40372.1|  unknown                                                 103   5e-29   Lotus japonicus
gb|EYU31472.1|  hypothetical protein MIMGU_mgv1a019059mg                103   6e-29   Erythranthe guttata [common monkey flower]
gb|ABI54120.1|  caffeic acid O-methyltransferase                        100   6e-29   Malus domestica [apple tree]
ref|XP_006305218.1|  hypothetical protein CARUB_v10009584mg           93.6    6e-29   Capsella rubella
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    105   6e-29   Medicago sativa [alfalfa]
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    105   6e-29   Medicago sativa [alfalfa]
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      103   7e-29   Glycine soja [wild soybean]
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        101   7e-29   Populus tomentosa [Chinese white poplar]
gb|AAY86361.1|  caffeic acid O-methyltransferase                        104   9e-29   Acacia auriculiformis x Acacia mangium
ref|NP_174579.1|  O-methyltransferase-like protein                    94.4    9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    107   9e-29   Elaeis guineensis
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.8    1e-28   Malus domestica [apple tree]
gb|AEW26161.1|  caffeic acid-O-methyltransferase                        105   1e-28   Medicago sativa subsp. x varia
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    103   1e-28   Glycine max [soybeans]
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    101   1e-28   Populus tremuloides
ref|XP_002317838.1|  Chain A family protein                             100   1e-28   Populus trichocarpa [western balsam poplar]
ref|NP_001240003.1|  uncharacterized protein LOC100780100               103   1e-28   Glycine max [soybeans]
ref|XP_008362842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   1e-28   
gb|ABI54119.1|  caffeic acid O-methyltransferase                      99.8    1e-28   Malus domestica [apple tree]
gb|AEW26209.1|  caffeic acid-O-methyltransferase                        105   1e-28   Medicago sativa subsp. caerulea
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                      102   1e-28   Mesembryanthemum crystallinum
gb|ADR31598.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    100   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006420931.1|  hypothetical protein CICLE_v10005230mg             103   1e-28   Citrus clementina [clementine]
gb|AFK39235.1|  unknown                                                 103   1e-28   Medicago truncatula
gb|ADR31595.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    100   1e-28   Populus trichocarpa [western balsam poplar]
gb|ADR31603.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    100   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             103   1e-28   Phaseolus vulgaris [French bean]
gb|AEW26163.1|  caffeic acid-O-methyltransferase                        104   2e-28   Medicago sativa subsp. x varia
gb|ADR31604.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    100   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002864307.1|  O-methyltransferase 1                            99.8    2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_002525818.1|  o-methyltransferase, putative                      101   2e-28   Ricinus communis
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase                 100   2e-28   Medicago truncatula
gb|KJB23954.1|  hypothetical protein B456_004G125600                  98.2    2e-28   Gossypium raimondii
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   103   2e-28   Medicago truncatula
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...    105   2e-28   Clarkia breweri [fairy fans]
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                    98.2    2e-28   Gossypium hirsutum [American cotton]
gb|AFK42771.1|  unknown                                                 100   2e-28   Medicago truncatula
ref|XP_011084579.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  97.8    2e-28   
gb|AIJ28474.1|  O-methyltransferase                                     100   2e-28   Vaccinium corymbosum [American blueberry]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   2e-28   Glycine max [soybeans]
gb|KDP36008.1|  hypothetical protein JCGZ_10407                         100   2e-28   Jatropha curcas
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    104   2e-28   Cicer arietinum [garbanzo]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...  99.8    2e-28   Rosa chinensis [China rose]
gb|KDP32876.1|  hypothetical protein JCGZ_12168                       99.4    3e-28   Jatropha curcas
gb|KJB52492.1|  hypothetical protein B456_008G264900                  98.6    3e-28   Gossypium raimondii
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   3e-28   Citrus sinensis [apfelsine]
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    105   3e-28   
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase    97.4    3e-28   Vitis vinifera
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                    98.6    3e-28   Gossypium arboreum [tree cotton]
gb|AEV93478.1|  caffeic acid O-methyltransferase                        102   3e-28   Caragana korshinskii
gb|KDP32878.1|  hypothetical protein JCGZ_12170                       99.4    3e-28   Jatropha curcas
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   3e-28   Pyrus x bretschneideri [bai li]
gb|ADN27527.1|  caffeic acid O-methyltransferase                      98.6    3e-28   Camellia sinensis [black tea]
ref|XP_004494877.1|  PREDICTED: anthranilate N-methyltransferase-...    102   3e-28   Cicer arietinum [garbanzo]
gb|AGO50639.1|  caffeic acid O-methyltransferase                        101   3e-28   Linum usitatissimum
ref|XP_008382714.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.8    4e-28   
ref|XP_003528760.1|  PREDICTED: anthranilate N-methyltransferase        100   4e-28   Glycine max [soybeans]
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   4e-28   Tarenaya hassleriana [spider flower]
gb|KHN06374.1|  Anthranilate N-methyltransferase                        100   4e-28   Glycine soja [wild soybean]
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  98.6    4e-28   Chrysosplenium americanum [water-carpet]
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   5e-28   Phoenix dactylifera
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   5e-28   
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  98.6    5e-28   Chrysosplenium americanum [water-carpet]
gb|AAF60951.1|  O-methyltransferase                                   98.6    5e-28   Populus trichocarpa x Populus deltoides
prf||1906376A  O-methyltransferase                                    98.6    5e-28
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  99.0    6e-28   Populus euphratica
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 102   6e-28   Anthriscus sylvestris
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase               99.4    6e-28   Pyrus x bretschneideri [bai li]
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase             98.2    7e-28   Hibiscus cannabinus [bimli-jute]
ref|XP_010461123.1|  PREDICTED: quercetin 3-O-methyltransferase 1     90.5    8e-28   Camelina sativa [gold-of-pleasure]
gb|KDP35860.1|  hypothetical protein JCGZ_10599                       96.3    8e-28   Jatropha curcas
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                    98.2    8e-28   Populus deltoides
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                    97.8    9e-28   Gossypium arboreum [tree cotton]
dbj|BAO79385.1|  hypothetical plant O-methyltransferase               99.4    1e-27   Anthriscus sylvestris
dbj|BAC78827.1|  caffeic acid O-methyltransferase                     97.8    1e-27   Rosa chinensis var. spontanea
ref|XP_008382917.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.4    1e-27   
ref|NP_001242325.1|  uncharacterized protein LOC100805999             99.8    1e-27   
ref|XP_006442372.1|  hypothetical protein CICLE_v10020761mg             101   1e-27   Citrus clementina [clementine]
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg             103   1e-27   Citrus clementina [clementine]
gb|AEW26176.1|  caffeic acid-O-methyltransferase                        101   1e-27   Medicago sativa subsp. x varia
gb|ADB82906.1|  caffeic O-methyltransferase1                            100   1e-27   Eucalyptus camaldulensis
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   1e-27   
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3    100   1e-27   Populus euphratica
gb|ACY66932.1|  caffeic O-methyltransferase 1                           100   1e-27   Eucalyptus camaldulensis
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase    97.1    1e-27   
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      100   1e-27   Eucalyptus grandis [rose gum]
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                     100   1e-27   Eucalyptus grandis [rose gum]
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.9    1e-27   Sesamum indicum [beniseed]
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase    96.7    1e-27   Eucalyptus grandis [rose gum]
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                    97.1    2e-27   Populus tomentosa [Chinese white poplar]
dbj|BAO31651.1|  O-methyltransferase                                  95.1    2e-27   Sesamum radiatum
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.7    2e-27   Eucalyptus grandis [rose gum]
gb|ABG27066.1|  caffeic acid O-methyltransferase                      99.4    2e-27   Boehmeria nivea [Chinese silk-plant]
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg             100   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase    97.8    2e-27   
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                   96.7    2e-27   Eucalyptus grandis [rose gum]
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                   102   2e-27   Citrus sinensis [apfelsine]
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.9    2e-27   Eucalyptus grandis [rose gum]
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase    97.8    2e-27   
gb|AEO14871.1|  caffeic acid O-methyltransferase                      95.9    2e-27   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.0    2e-27   Eucalyptus grandis [rose gum]
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase    99.0    2e-27   Fragaria vesca subsp. vesca
ref|XP_002963026.1|  hypothetical protein SELMODRAFT_78541            97.4    2e-27   Selaginella moellendorffii
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.3    3e-27   Pyrus x bretschneideri [bai li]
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   3e-27   Glycine max [soybeans]
gb|AGS49198.1|  O-methyltransferase                                     102   3e-27   Zea mays [maize]
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1      99.0    3e-27   Tarenaya hassleriana [spider flower]
ref|XP_002864309.1|  O-methyltransferase 1                            95.1    3e-27   
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...  99.0    3e-27   Eucalyptus gunnii
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...  95.9    3e-27   Glehnia littoralis
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   3e-27   Citrus sinensis [apfelsine]
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                  95.1    3e-27   Arabis alpina [alpine rockcress]
ref|XP_002980303.1|  hypothetical protein SELMODRAFT_112597           97.1    3e-27   
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg             100   3e-27   Citrus clementina [clementine]
gb|AAF28353.1|AF220491_1  O-methyltransferase                         98.2    3e-27   Fragaria x ananassa
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    104   3e-27   Elaeis guineensis
ref|XP_002869549.1|  hypothetical protein ARALYDRAFT_354029             100   3e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_002321948.1|  Chain A family protein                           97.8    4e-27   Populus trichocarpa [western balsam poplar]
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                  98.2    4e-27   Populus trichocarpa [western balsam poplar]
gb|EPS64988.1|  hypothetical protein M569_09791                         102   4e-27   Genlisea aurea
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...  97.4    4e-27   Vitis vinifera
ref|NP_001268100.1|  caffeic acid O-methyltransferase                 97.4    4e-27   Vitis vinifera
gb|ABR18103.1|  unknown                                               98.6    4e-27   Picea sitchensis
emb|CBI23095.3|  unnamed protein product                              97.4    4e-27   Vitis vinifera
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          100   4e-27   Amborella trichopoda
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase    97.8    5e-27   Nicotiana sylvestris
gb|AEO14870.1|  caffeic acid O-methyltransferase                      94.7    5e-27   Salvia miltiorrhiza [Chinese salvia]
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  98.2    5e-27   Populus sieboldii x Populus grandidentata
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1             94.7    5e-27   
ref|XP_010934981.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    104   5e-27   
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  97.4    6e-27   Ocimum basilicum [basil]
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  96.7    6e-27   Brassica rapa
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  93.6    6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010660322.1|  PREDICTED: caffeic acid 3-O-methyltransferase      103   6e-27   Vitis vinifera
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...  94.0    6e-27   Arabidopsis thaliana [mouse-ear cress]
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  99.4    7e-27   Populus tremuloides
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase         95.9    7e-27   Carthamus tinctorius
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                   95.5    7e-27   Ipomoea nil [qian niu]
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1      93.6    8e-27   Camelina sativa [gold-of-pleasure]
emb|CDY18302.1|  BnaC09g30520D                                        96.3    8e-27   Brassica napus [oilseed rape]
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  94.7    8e-27   Camelina sativa [gold-of-pleasure]
gb|KHG02243.1|  Caffeic acid 3-O-methyltransferase                    99.8    9e-27   Gossypium arboreum [tree cotton]
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                     97.8    9e-27   Populus tomentosa [Chinese white poplar]
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   9e-27   Tarenaya hassleriana [spider flower]
ref|XP_002513089.1|  o-methyltransferase, putative                    95.5    1e-26   Ricinus communis
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g           96.3    1e-26   Phaseolus vulgaris [French bean]
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase       97.8    1e-26   Anthriscus sylvestris
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg             101   1e-26   Citrus clementina [clementine]
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...  97.8    1e-26   Ginkgo biloba [ginkgo]
emb|CDY18306.1|  BnaC09g30560D                                        93.2    1e-26   
gb|ABY74431.1|  inositol methyl transferase                           98.6    1e-26   
ref|XP_003620226.1|  Caffeic acid 3-O-methyltransferase               95.5    1e-26   
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg           99.0    1e-26   
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g           96.7    1e-26   
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  99.8    1e-26   
emb|CDY19037.1|  BnaC01g20310D                                        97.4    1e-26   
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      97.4    1e-26   
gb|AES69074.2|  caffeic acid O-methyltransferase                        102   1e-26   
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                   94.7    1e-26   
sp|P45986.1|IMT1_MESCR  RecName: Full=Inositol 4-methyltransferase    98.2    1e-26   
gb|KHG25006.1|  Caffeic acid 3-O-methyltransferase                    99.8    2e-26   
gb|AEO21927.1|  bergaptol-O-methyltransferase                         94.0    2e-26   
emb|CDP18417.1|  unnamed protein product                                102   2e-26   
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...  93.6    2e-26   
gb|AAB96879.1|  O-methyltransferase 1                                 94.0    2e-26   
gb|ABK23414.1|  unknown                                               96.3    2e-26   
gb|ABK25932.1|  unknown                                               94.4    2e-26   
dbj|BAJ34520.1|  unnamed protein product                              93.2    2e-26   
ref|XP_006591156.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  90.5    2e-26   
gb|KHN13697.1|  Isoliquiritigenin 2'-O-methyltransferase              90.5    2e-26   
emb|CAA52462.1|  catechol O-methyltransferase                         92.4    2e-26   
gb|KEH20132.1|  caffeic acid O-methyltransferase                      96.7    3e-26   
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.1    3e-26   
ref|XP_003539225.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  90.5    3e-26   
ref|XP_010418164.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  92.0    3e-26   
ref|XP_011097031.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  93.6    3e-26   
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  93.6    3e-26   
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg           93.2    3e-26   
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.0    3e-26   
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  91.7    4e-26   
gb|AFK39562.1|  unknown                                               95.5    4e-26   
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.0    4e-26   
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                97.8    4e-26   
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase            97.8    4e-26   
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg           92.4    4e-26   
gb|ACN40509.1|  unknown                                               95.9    4e-26   
ref|XP_003626617.1|  Caffeic acid 3-O-methyltransferase               99.4    4e-26   
gb|AFM73597.1|  caffeate O-methyltransferase                          97.8    5e-26   
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    103   5e-26   
gb|AFK35470.1|  unknown                                               99.4    5e-26   
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...  99.0    5e-26   
ref|XP_006302438.1|  hypothetical protein CARUB_v10020520mg           91.3    5e-26   
gb|AAQ01670.1|  catechol O-methyltransferase                          95.5    5e-26   
gb|KJB73215.1|  hypothetical protein B456_011G222900                  99.0    6e-26   
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg           92.8    6e-26   
gb|AFK41218.1|  unknown                                               95.9    6e-26   
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase               95.9    6e-26   
gb|AAN03726.1|  caffeic acid O-methyltransferase                      96.7    6e-26   
dbj|BAM05579.1|  caffeic acid O-methyltransferase 1                   91.3    6e-26   
ref|XP_010473409.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  94.0    6e-26   
gb|AET00984.2|  caffeic acid O-methyltransferase                      95.9    6e-26   
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like      102   7e-26   
emb|CDX84055.1|  BnaC08g07320D                                        87.0    7e-26   
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                   92.4    7e-26   
gb|ADX98508.1|  caffeic acid 3-O-methyltransferase                      101   7e-26   
gb|ADO16247.1|  caffeic acid O-methyltransferase                      93.6    7e-26   
ref|XP_009802353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  98.2    8e-26   
gb|KDO42947.1|  hypothetical protein CISIN_1g030025mg                 99.0    8e-26   
emb|CAA52461.1|  catechol O-methyltransferase                         93.2    9e-26   
emb|CDY43839.1|  BnaC03g14720D                                        90.9    9e-26   
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1      90.9    1e-25   
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                   94.7    1e-25   
gb|AAZ32409.1|  S-methyltransferase                                     106   1e-25   
emb|CAI30878.1|  caffeate O-methyltransferase                         91.3    1e-25   
gb|ABK22490.1|  unknown                                               91.3    1e-25   
gb|ABK21417.1|  unknown                                               87.4    1e-25   
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1               103   1e-25   
gb|ABK23795.1|  unknown                                               93.6    1e-25   
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  99.4    1e-25   
gb|AFX98069.1|  caffeic acid O-methyltransferase                      93.2    1e-25   
ref|XP_007135330.1|  hypothetical protein PHAVU_010G120200g           94.7    1e-25   
gb|KDO54338.1|  hypothetical protein CISIN_1g032721mg                 92.4    1e-25   
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.4    2e-25   
ref|XP_010062009.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  82.4    2e-25   
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               99.0    2e-25   
ref|XP_011038013.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  92.4    2e-25   
dbj|BAK42963.1|  caffeic acid O-methylltransferase                    92.4    2e-25   
ref|XP_003598824.1|  O-methyltransferase                              87.8    2e-25   
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             96.7    2e-25   
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                93.2    2e-25   
gb|KJB73214.1|  hypothetical protein B456_011G222900                  97.1    2e-25   
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                92.8    2e-25   
gb|AFK44249.1|  unknown                                               95.1    2e-25   
gb|KJB62324.1|  hypothetical protein B456_009G411600                  89.7    2e-25   
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...  95.9    3e-25   
sp|Q6T1F6.1|BMT_AMMMJ  RecName: Full=Bergaptol O-methyltransferas...  89.7    3e-25   
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  93.2    3e-25   
ref|XP_011070409.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.7    3e-25   
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase    94.7    3e-25   
emb|CDP15753.1|  unnamed protein product                              95.9    3e-25   
gb|EMT30204.1|  Caffeic acid 3-O-methyltransferase                    99.0    3e-25   
gb|KHN19569.1|  Caffeic acid 3-O-methyltransferase                      100   3e-25   
gb|AFK34973.1|  unknown                                               94.4    4e-25   
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...  94.4    4e-25   
ref|XP_003621334.1|  O-methyltransferase                              83.6    4e-25   
gb|KDP37670.1|  hypothetical protein JCGZ_06898                       88.6    4e-25   
ref|XP_003621340.1|  Caffeate O-methyltransferase-1                   82.8    4e-25   
gb|ABI54121.1|  caffeic acid O-methyltransferase                      90.5    4e-25   
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    102   4e-25   
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg           94.0    4e-25   
gb|AID69230.1|  caffeic acid O-methyltransferase                      92.8    4e-25   
emb|CDX76223.1|  BnaA04g04870D                                        90.5    4e-25   
ref|XP_003621331.1|  Isoliquiritigenin 2'-O-methyltransferase         85.1    4e-25   
ref|XP_010696333.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   4e-25   
ref|XP_009107965.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  82.8    5e-25   
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  91.3    5e-25   
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...  94.0    5e-25   
ref|XP_006401615.1|  hypothetical protein EUTSA_v10013908mg           89.4    5e-25   
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase              97.4    5e-25   
sp|Q9SWC2.1|COMT1_EUCGL  RecName: Full=Caffeic acid 3-O-methyltra...  88.2    5e-25   
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.8    5e-25   
ref|XP_010538869.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  95.9    5e-25   
gb|KEH20127.1|  caffeic acid O-methyltransferase                      90.5    5e-25   
gb|EPS67212.1|  hypothetical protein M569_07558                         108   5e-25   
ref|XP_006434352.1|  hypothetical protein CICLE_v10001555mg           97.4    5e-25   
ref|XP_007030041.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   90.5    6e-25   
gb|EPS64727.1|  hypothetical protein M569_10055                       86.3    6e-25   
ref|XP_010671879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  82.4    6e-25   
ref|XP_002302676.2|  eugenol O-methyltransferase family protein         101   6e-25   
gb|ABR18380.1|  unknown                                               85.5    6e-25   
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g             101   6e-25   
gb|KCW69074.1|  hypothetical protein EUGRSUZ_F02625                   85.1    7e-25   
ref|XP_007149003.1|  hypothetical protein PHAVU_005G0323000g          91.3    7e-25   
ref|XP_010062011.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  85.1    8e-25   
ref|XP_009384328.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.9    9e-25   
ref|XP_002300513.1|  eugenol O-methyltransferase family protein       90.1    9e-25   
ref|XP_007143664.1|  hypothetical protein PHAVU_007G091000g           91.3    9e-25   
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g             100   1e-24   
emb|CDP20700.1|  unnamed protein product                                101   1e-24   
ref|XP_007163881.1|  hypothetical protein PHAVU_L008600g              90.1    1e-24   
emb|CDP15755.1|  unnamed protein product                              94.7    1e-24   
gb|EAY85717.1|  hypothetical protein OsI_07085                        97.1    1e-24   
ref|XP_002302677.1|  eugenol O-methyltransferase family protein       99.4    1e-24   
gb|AAL57301.1|AF387790_1  O-methyltransferase                           101   1e-24   
ref|XP_004499845.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  85.1    1e-24   
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860          101   1e-24   
gb|KEH38013.1|  caffeic acid O-methyltransferase                      93.6    1e-24   
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    101   1e-24   
ref|XP_010677637.1|  PREDICTED: inositol 4-methyltransferase-like     97.4    2e-24   
gb|ADR31594.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  87.0    2e-24   
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    101   2e-24   
gb|ADR31597.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    100   2e-24   
gb|EPS58611.1|  hypothetical protein M569_16202                       86.7    2e-24   
ref|XP_006401618.1|  hypothetical protein EUTSA_v10013896mg           87.8    2e-24   
gb|AFK45226.1|  unknown                                               89.4    2e-24   
ref|XP_009386324.1|  PREDICTED: flavone O-methyltransferase 1-lik...  94.7    2e-24   
gb|KJB82414.1|  hypothetical protein B456_013G194900                  92.8    2e-24   
ref|XP_006492698.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  98.6    2e-24   
ref|XP_004148286.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.0    2e-24   
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...  91.7    2e-24   
ref|XP_002515087.1|  o-methyltransferase, putative                    97.4    3e-24   
dbj|BAM05581.1|  caffeic acid O-methyltransferase 1                   85.9    3e-24   
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                    95.9    3e-24   
ref|XP_003552548.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  84.3    3e-24   
gb|KHN17090.1|  Isoliquiritigenin 2'-O-methyltransferase              90.9    3e-24   
ref|XP_003621343.1|  O-methyltransferase                              79.7    3e-24   
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                88.6    3e-24   
ref|XP_007139031.1|  hypothetical protein PHAVU_009G259200g           91.3    3e-24   
gb|AAL91506.1|AF484252_1  caffeic acid O-methyltransferase II         92.4    3e-24   
ref|XP_006494834.1|  PREDICTED: anthranilate N-methyltransferase-...  90.5    3e-24   
gb|EYU45322.1|  hypothetical protein MIMGU_mgv1a009747mg              88.6    4e-24   
dbj|BAM05580.1|  caffeic acid O-methyltransferase 1                   85.9    4e-24   
ref|XP_007139032.1|  hypothetical protein PHAVU_009G259300g           92.8    4e-24   
emb|CAA50561.1|  catechol O-methyltransferase                         92.4    4e-24   
ref|XP_003559686.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  93.2    4e-24   
ref|XP_011025357.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  98.6    4e-24   
ref|XP_007010743.1|  O-methyltransferase, putative                    92.0    4e-24   
emb|CDM87233.1|  unnamed protein product                              95.5    4e-24   
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...  95.1    5e-24   
ref|XP_004509702.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  98.6    5e-24   
ref|XP_002518944.1|  o-methyltransferase, putative                    92.0    5e-24   
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    5e-24   
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.1    5e-24   
ref|XP_004248417.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.0    5e-24   
emb|CDY44972.1|  BnaA08g06720D                                        80.5    5e-24   
sp|A9X7L0.1|ANMT_RUTGR  RecName: Full=Anthranilate N-methyltransf...  86.3    5e-24   
ref|XP_004148264.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    5e-24   
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                   86.7    5e-24   
dbj|BAJ95117.1|  predicted protein                                    95.5    5e-24   
ref|XP_004509701.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  98.6    5e-24   
gb|AAK68910.1|  caffeic acid O-methyltransferase                      94.0    6e-24   
ref|XP_004494876.1|  PREDICTED: anthranilate N-methyltransferase-...  96.3    6e-24   
ref|XP_007139027.1|  hypothetical protein PHAVU_009G258800g           94.4    6e-24   
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  98.6    6e-24   
ref|XP_010665117.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  81.3    6e-24   
ref|XP_006482560.1|  PREDICTED: anthranilate N-methyltransferase-...  95.9    6e-24   
ref|XP_006441607.1|  hypothetical protein CICLE_v10020880mg           89.0    6e-24   
emb|CBI18183.3|  unnamed protein product                              81.3    6e-24   
ref|XP_010062010.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  85.5    6e-24   
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                   86.7    7e-24   
ref|XP_004169229.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.4    8e-24   
gb|KCW74447.1|  hypothetical protein EUGRSUZ_E03148                   91.3    9e-24   
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                 90.1    9e-24   
ref|XP_007139030.1|  hypothetical protein PHAVU_009G259100g           90.1    9e-24   
ref|XP_009621174.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.3    9e-24   
ref|XP_009597864.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  91.3    9e-24   
gb|AFK48989.1|  unknown                                               80.5    1e-23   
gb|ACJ84475.1|  unknown                                               80.5    1e-23   
ref|XP_006431111.1|  hypothetical protein CICLE_v10012042mg           95.5    1e-23   
ref|XP_006494837.1|  PREDICTED: anthranilate N-methyltransferase-...  90.5    1e-23   
gb|AAD29845.1|AF064697_1  O-methyltransferase                         86.3    1e-23   
ref|XP_007219351.1|  hypothetical protein PRUPE_ppa019437mg             100   1e-23   
gb|EMT16763.1|  Caffeic acid 3-O-methyltransferase                    95.5    1e-23   
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  89.0    1e-23   
ref|XP_010100665.1|  Anthranilate N-methyltransferase                 94.0    1e-23   
ref|XP_009385332.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    107   1e-23   
ref|XP_008370024.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.0    1e-23   
ref|XP_004491872.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  76.6    1e-23   
ref|XP_007030042.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   85.9    1e-23   
ref|XP_006352624.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.5    1e-23   
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase            86.7    1e-23   
ref|XP_007139024.1|  hypothetical protein PHAVU_009G2586001g          83.6    1e-23   
gb|KEH15746.1|  caffeic acid O-methyltransferase                      90.9    1e-23   
dbj|BAO31650.1|  O-methyltransferase                                  82.8    1e-23   
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase    95.5    2e-23   
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                    94.7    2e-23   
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                   86.7    2e-23   
ref|XP_009387259.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  89.7    2e-23   
gb|KEH18560.1|  caffeic acid O-methyltransferase                      90.9    2e-23   
ref|XP_009335247.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.0    2e-23   



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   192 bits (487),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  APNIPGVTHVGGD+F S IP+ D IFMK VLT W+DEECK IM NCY AL  G
Sbjct  225  LPEVVAKAPNIPGVTHVGGDMFKS-IPSADGIFMKWVLTTWTDEECKQIMENCYKALPVG  283

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP Q+DD+ RTR LL  DIF+M +YRAK KH T E ++ LG SVGF  F+A
Sbjct  284  GKLIACEPVLPKQSDDSHRTRALLEGDIFVMTIYRAKGKHRTAEEFKLLGQSVGFSHFQA  343

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  VLEFHK
Sbjct  344  FYIDYFYTVLEFHK  357


 Score = 91.7 bits (226),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  + Y GF+G+ +LVDVGGSAGDCLRMI++K+ +I + INFD P
Sbjct  168  MQKAMSGVSVPFMKAILNGYDGFQGMEKLVDVGGSAGDCLRMILKKYPNIREGINFDLP  226



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   187 bits (474),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  APNIPGVTHVGGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  226  LPEVVAKAPNIPGVTHVGGDMFKS-VPDGDAIFMKWVLTTWTDEECKLIMKNCYNALPVG  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I CEPVLP ++D++ RTR LL  DIF+M +YRAK KH TEE +RQLGLS GF   +A
Sbjct  285  GKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKHRTEEEFRQLGLSAGFPHLRA  344

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F  VLEF K
Sbjct  345  FYIDHFYTVLEFQK  358


 Score = 96.7 bits (239),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  + Y GF GV RLVDVGGSAGDCLRMI++KH +I + INFD P
Sbjct  169  MQRAMSGVSVPFMKAILNGYNGFDGVQRLVDVGGSAGDCLRMILQKHTNIKEGINFDLP  227



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   183 bits (465),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  APNIPGVTHVGGD+F S IP  DAIFMK VLT W+D+ECK IM NCY AL  G
Sbjct  222  LPEVVAKAPNIPGVTHVGGDMFES-IPAGDAIFMKWVLTTWTDDECKLIMRNCYEALPPG  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I CEPVLP ++D + RTR LL  DIF+M +YRAK KH TEE ++QLGL+ GF  F+A
Sbjct  281  GKMIACEPVLPKESDRSHRTRALLEGDIFVMAIYRAKGKHRTEEEFKQLGLASGFPHFRA  340

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F  VLEF K
Sbjct  341  FYIDQFYTVLEFQK  354


 Score = 97.8 bits (242),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  + Y GFKGV RLVDVGGSAGDCLRMI+ KH  + + INFD P
Sbjct  165  MQKAMSGVSVPFMKAILEGYNGFKGVERLVDVGGSAGDCLRMILHKHPHVREGINFDLP  223



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   189 bits (481),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTH+GGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  227  LPEVVAKAPKIPGVTHMGGDMFQS-VPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVG  285

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKL+ CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE Y++LGLS GF TF+ 
Sbjct  286  GKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEYKELGLSAGFSTFRP  345

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  346  FYIDYFYTILEFQK  359


 Score = 90.1 bits (222),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GFK V  LVDVGGSAGDCLRMI+++  ++ Q INFD P
Sbjct  170  MQKAMSGVSVPFMKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLP  228



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   184 bits (467),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVT+VGGD+F S IP+ DAIFMK +LT W+D ECK IM NCY AL  G
Sbjct  232  LPEVVAKAPIIPGVTNVGGDMFKS-IPDGDAIFMKWILTTWTDNECKLIMENCYKALPVG  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK KH TEE ++QLG SVGF  F+A
Sbjct  291  GKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRAKGKHRTEEEFKQLGQSVGFSYFRA  350

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  VLEF K
Sbjct  351  FYVDYFYTVLEFQK  364


 Score = 95.9 bits (237),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFM+A  D Y GFKGV RLVDVGGSAGDCLRMI++KH  + Q INFD P
Sbjct  175  MLKAMSGVSVPFMEAMLDGYDGFKGVERLVDVGGSAGDCLRMILKKHPGVRQGINFDLP  233



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   191 bits (484),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  APNIPGV+HVGGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  227  LPEVVAKAPNIPGVSHVGGDMFQS-VPSGDAIFMKWVLTTWTDEECKEIMKNCYNALPVG  285

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ 
Sbjct  286  GKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFPTFRP  345

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  346  FYIDYFYTILEFQK  359


 Score = 88.6 bits (218),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFMKA  + Y+GFK V RLVDVGGSAGDCLRMI++   ++ + INFD P
Sbjct  170  MLKAMSGVSVPFMKAILEGYEGFKSVERLVDVGGSAGDCLRMILQHFPNVREGINFDLP  228



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   183 bits (464),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  226  LPEVVAKAPTIPGVTHVGGDMFKS-VPDGDAIFMKWVLTTWTDEECKLIMKNCYNALPVG  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I CEPVLP ++D++ RTR LL  DIF+M +YRAK KH TEE +RQLGLS GF    A
Sbjct  285  GKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKHRTEEEFRQLGLSAGFPHLXA  344

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F  VLEF K
Sbjct  345  FYIDXFYTVLEFQK  358


 Score = 96.3 bits (238),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  + Y GF GV RLVDVGGSAGDCLRMI++KH +I + INFD P
Sbjct  169  MQRAMSGVSVPFMKAILNGYSGFDGVQRLVDVGGSAGDCLRMILQKHTNIKEGINFDLP  227



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   189 bits (480),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTHVGGD+F S IP  DAIFMK VLT W+D+ECKAIM NCY AL  G
Sbjct  229  LPEVVAKAPSIPGVTHVGGDMFES-IPAADAIFMKWVLTTWTDDECKAIMENCYKALPVG  287

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP ++DD+ RTR LL  DIF+M +YRAK KH T++ ++QLGLS GF  F+A
Sbjct  288  GKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAKGKHRTQDEFKQLGLSAGFPHFRA  347

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  VLEF K
Sbjct  348  FYIDYFYTVLEFQK  361


 Score = 89.4 bits (220),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFM+A  D Y G KGV RLVDVGGSAGDCLRMI++K+  + + INFD P
Sbjct  173  MQKAMSGVSVPFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLP  230



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   182 bits (462),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVT+VGGD+F S IP+ DAIFMK +LT W+D ECK IM NCY AL  G
Sbjct  232  LPEVVAKAPIIPGVTNVGGDMFKS-IPDGDAIFMKWILTTWTDNECKLIMENCYKALPMG  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKL+ CEPVLP  +DD+ RTR LL  DIF+M +YR K KH TEE ++QLG SVGF  F+A
Sbjct  291  GKLVACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKQLGQSVGFSHFRA  350

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  VLEF K
Sbjct  351  FYVDYFYTVLEFQK  364


 Score = 95.9 bits (237),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFM+A  D Y GFKGV RLVDVGGSAGDCLRMI++KH  + Q INFD P
Sbjct  175  MLKAMSGVSVPFMEAMLDGYDGFKGVERLVDVGGSAGDCLRMILKKHPGVRQGINFDLP  233



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   188 bits (477),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTH+GGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  227  LPEVVAKAPKIPGVTHMGGDMFQS-VPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVG  285

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKL+ CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ 
Sbjct  286  GKLVACEPVLPQETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRP  345

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  346  FYIDYFYTILEFQK  359


 Score = 90.5 bits (223),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GFK V  LVDVGGSAGDCLRMI+++  ++ Q INFD P
Sbjct  170  MQKAMSGVSVPFMKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLP  228



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   191 bits (484),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTHVGGD+F S IP+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  223  LPEVVAKAPSIPGVTHVGGDMFQS-IPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVG  281

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ 
Sbjct  282  GKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFTTFRP  341

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  342  FYIDYFYTILEFQK  355


 Score = 87.0 bits (214),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFMKA  + Y GFK V +L+DVGGSAGDCLRMI+E+  ++ + INFD P
Sbjct  166  MLKAMSGVSVPFMKAILEGYDGFKSVEQLIDVGGSAGDCLRMILEQFPNVREGINFDLP  224



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   180 bits (457),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP++PGVTHVGGD+F   IP  DAIFMK +LT W+D+EC+AIM +C  A+  G
Sbjct  227  LPEVVARAPHVPGVTHVGGDMF-KLIPEADAIFMKWILTTWTDDECQAIMESCCKAVPGG  285

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TDD+ RTR LL  DIF+M +YRAK KH TE+ YR+LGL+ GF  F+A
Sbjct  286  GKLIACEPVLPKETDDSHRTRALLSGDIFVMTIYRAKGKHRTEDEYRKLGLAAGFPHFQA  345

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  VLEF K
Sbjct  346  FYIDYFHTVLEFTK  359


 Score = 97.4 bits (241),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  + Y GF+GV RLVDVGGSAGDCLRMI++K+ ++T+AINFD P
Sbjct  170  MQRAMSGVSVPFMKAILNGYDGFEGVRRLVDVGGSAGDCLRMILQKYPNVTEAINFDLP  228



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   188 bits (478),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  APNIPGVTHVGGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  227  LPEVVAKAPNIPGVTHVGGDMFQS-VPSADAIFMKWVLTTWTDEECKQIMKNCYNALPVG  285

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TD++ RTR LL  DIF+M +YR K KH TEE + +LGLS GF TF+ 
Sbjct  286  GKLIACEPVLPKETDESHRTRALLEGDIFVMTIYRTKGKHRTEEEFIELGLSAGFPTFRP  345

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  346  FYIDYFYTILEFQK  359


 Score = 88.6 bits (218),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GFK V  LVDVGGSAGDCLRMI+++  ++ + INFD P
Sbjct  170  MQKAMSGVSVPFMKAILDGYDGFKSVDILVDVGGSAGDCLRMILQQFPNVREGINFDLP  228



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   191 bits (485),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTHVGGD+F S IP+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  253  LPEVVAKAPSIPGVTHVGGDMFQS-IPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVG  311

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ 
Sbjct  312  GKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFTTFRP  371

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  372  FYIDYFYTILEFQK  385


 Score = 85.9 bits (211),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFMKA  + Y GFK V RLVDVGGSAG CLRMI+E+  ++ + INFD P
Sbjct  196  MLKAMSGVSVPFMKAILEGYDGFKSVERLVDVGGSAGVCLRMILEQFPNVREGINFDLP  254



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   182 bits (462),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F S IP  DAIFM+ +LT W+D+ECK I+ NC+ AL  G
Sbjct  228  LPEVVAKAPPIPGVTHVGGDMFKS-IPAGDAIFMRWILTTWTDDECKQILENCFKALPAG  286

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK KH TE+ ++QLGLS GF  F+A
Sbjct  287  GKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAKGKHRTEQEFQQLGLSTGFPRFQA  346

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F AVLEF K
Sbjct  347  FYIDHFYAVLEFQK  360


 Score = 94.0 bits (232),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  D Y GF GV RLVDVGGSAGDCLRMI+ KH  + + INFD P
Sbjct  171  MQRAMSGVSVPFMKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLP  229



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   186 bits (473),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTH+GGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  98   LPEVVAKAPKIPGVTHMGGDMFQS-VPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVG  156

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKL+ CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ 
Sbjct  157  GKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRP  216

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  217  FYIDYFYTILEFQK  230


 Score = 89.7 bits (221),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GFK V  LVDVGGSAGDCLRMI+++  ++ Q INFD P
Sbjct  41   MQKAMSGVSVPFMKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLP  99



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   186 bits (472),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  231  LPEVVAKAPKIPGVTHVGGDMFLS-VPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVG  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TDD+ RTR LL  +IF+M +YR K KH TEE +++LGLS GF +F+ 
Sbjct  290  GKLIACEPVLPKETDDSHRTRALLEGNIFVMTIYRTKGKHRTEEEFKELGLSAGFPSFRP  349

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  +LEF K
Sbjct  350  FYIDYFYTILEFQK  363


 Score = 89.7 bits (221),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GFK V  LVDVGGSAGDCLRMI+++  ++ + INFD P
Sbjct  174  MQKAMSGVSVPFMKAILDGYDGFKSVEHLVDVGGSAGDCLRMILKQFPNVREGINFDLP  232



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   182 bits (462),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F S IP  DAIFM+ +LT W+D+ECK I+ NC+ AL  G
Sbjct  213  LPEVVAKAPPIPGVTHVGGDMFKS-IPAGDAIFMRWILTTWTDDECKQILENCFKALPAG  271

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK KH TE+ ++QLGLS GF  F+A
Sbjct  272  GKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAKGKHRTEQEFQQLGLSTGFPRFQA  331

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F AVLEF K
Sbjct  332  FYIDHFYAVLEFQK  345


 Score = 93.6 bits (231),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  D Y GF GV RLVDVGGSAGDCLRMI+ KH  + + INFD P
Sbjct  156  MQRAMSGVSVPFMKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLP  214



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   177 bits (450),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP I GV+HVGGD+F S IP+ DAIFMK VL+ W+D ECK IM NCY AL  G
Sbjct  236  LPEVVAKAPTIAGVSHVGGDMFKS-IPSGDAIFMKWVLSTWTDSECKLIMENCYKALPVG  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP ++DD+ RTR LL +DIF+M +YRAK K+ TE+  RQLGLS GF  FK 
Sbjct  295  GKLIACEPVLPTKSDDSPRTRALLENDIFVMTIYRAKGKNRTEDELRQLGLSAGFSHFKP  354

Query  225  YYMDFFLAVLEFHK  184
             Y+D+F  VLEF K
Sbjct  355  IYIDYFYTVLEFQK  368


 Score = 98.2 bits (243),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  D Y GF+GV RLVDVGGSAGDCLRMI++KH S+ + INFD P
Sbjct  179  MQRAMSGVSVPFMKAILDGYDGFEGVGRLVDVGGSAGDCLRMILQKHPSVREGINFDLP  237



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   184 bits (467),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGV H+GGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  228  LPEVVAKAPKIPGVIHMGGDMFQS-VPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVG  286

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ 
Sbjct  287  GKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRP  346

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  + EF K
Sbjct  347  FYIDYFYTIFEFQK  360


 Score = 91.3 bits (225),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GFK V  LVDVGGSAGDCLRMI+E+  ++ + INFD P
Sbjct  171  MQKAMSGVSVPFMKAILDGYDGFKSVDHLVDVGGSAGDCLRMILEQFPNVREGINFDLP  229



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   187 bits (476),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -1

Query  579  EVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQGGK  400
            EVV  AP IPGVTH+GGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  GGK
Sbjct  231  EVVAKAPKIPGVTHIGGDMFQS-VPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPAGGK  289

Query  399  LIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKAYY  220
            LI CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ +Y
Sbjct  290  LIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRPFY  349

Query  219  MDFFLAVLEFHK  184
            +D+F  +LEF K
Sbjct  350  IDYFYTILEFQK  361


 Score = 87.8 bits (216),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDF  584
            MQKAMSG+S PFMKA  D Y GFK V  LVDVGGSAGDCLRMI+E+  ++ + INFD 
Sbjct  172  MQKAMSGVSAPFMKAILDGYDGFKSVEHLVDVGGSAGDCLRMIIEQFPNVRRGINFDL  229



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   177 bits (448),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP I GV+HVGGD+F S IP+ DAIFMK VL+ W+D ECK IM NCY AL  G
Sbjct  236  LPEVVAKAPTIAGVSHVGGDMFKS-IPSGDAIFMKWVLSTWTDSECKLIMENCYKALPVG  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP ++DD+ RTR LL +D+F+M +YRAK K+ TEE  RQLGLS GF  F+ 
Sbjct  295  GKLIACEPVLPTKSDDSSRTRALLENDVFVMTIYRAKGKNRTEEELRQLGLSAGFSHFRP  354

Query  225  YYMDFFLAVLEFHK  184
             Y+D+F  +LEF K
Sbjct  355  IYIDYFYTLLEFQK  368


 Score = 98.6 bits (244),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  D Y GF+GV RLVDVGGSAGDCLRMI++KH S+ + INFD P
Sbjct  179  MQRAMSGVSVPFMKAILDGYDGFEGVGRLVDVGGSAGDCLRMILQKHPSVREGINFDLP  237



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   187 bits (475),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  APNIPGVTHVGGD+F S +P+ DAIFMK +LT W+D+ECK IM NCY AL  G
Sbjct  225  LPEVVAKAPNIPGVTHVGGDMFKS-VPSADAIFMKWILTTWTDDECKVIMENCYKALPVG  283

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP QTDD+ RTR LL  DIF+M +YRAK KH TEE +++LG SVGF  F+ 
Sbjct  284  GKLIACEPVLPNQTDDSHRTRALLEGDIFVMTIYRAKGKHRTEEEFKKLGHSVGFSHFRP  343

Query  225  YYMDFFLAVLEFHK  184
             Y D F  VLEF K
Sbjct  344  LYFDHFHTVLEFQK  357


 Score = 87.8 bits (216),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  + Y GF+GV ++VDVGGSAGDCL+ I++K+ ++ + INFD P
Sbjct  168  MQKAMSGLSVPFMKAVLNGYDGFQGVEKIVDVGGSAGDCLKTILQKYPNVREGINFDLP  226



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   181 bits (459),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F S IP  DAIFM+ +LT W+D+ECK I+ NC+ AL  G
Sbjct  153  LPEVVAKAPPIPGVTHVGGDMFKS-IPAGDAIFMRWILTTWTDDECKQILENCFKALPAG  211

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK KH TE+ ++QLGLS GF  F+A
Sbjct  212  GKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAKGKHRTEQEFQQLGLSTGFPRFQA  271

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F AVLEF K
Sbjct  272  FYIDHFYAVLEFQK  285


 Score = 93.6 bits (231),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AMSG+SVPFMKA  D Y GF GV RLVDVGGSAGDCLRMI+ KH  + + INFD P
Sbjct  96   MQRAMSGVSVPFMKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLP  154



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   187 bits (476),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F S IP+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  222  LPEVVSKAPPIPGVTHVGGDMFKS-IPSGDAIFMKWVLTTWTDEECKQIMRNCYNALPPG  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP +TDD+ RTR LL  DIF+M +YR+K KH TEE ++QLGL+ GF  F+ 
Sbjct  281  GKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRSKGKHRTEEEFKQLGLASGFSLFRP  340

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  VLEF K
Sbjct  341  FYIDYFYTVLEFQK  354


 Score = 86.7 bits (213),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AMSG+SVPFM+A  D Y GFK V  LVDVGGSAGDCLRMI+ K  ++ Q INFD P
Sbjct  165  MLRAMSGVSVPFMRAILDGYDGFKSVEHLVDVGGSAGDCLRMILRKFPNVRQGINFDLP  223



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   184 bits (466),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVT+VGGD+  S IP  DAIFMK VLT W+D+ECKAIM NCY AL  G
Sbjct  229  LPEVVAKAPSIPGVTYVGGDMLES-IPVADAIFMKWVLTTWTDDECKAIMENCYKALPVG  287

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP ++DD+ RTR LL  DIF+M +YRAK KH T++ ++QLGLS GF  F+A
Sbjct  288  GKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAKGKHRTQDEFKQLGLSAGFPHFRA  347

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  VLEF K
Sbjct  348  FYIDYFYTVLEFQK  361


 Score = 89.4 bits (220),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFM+A  D Y G KGV RLVDVGGSAGDCLRMI++K+  + + INFD P
Sbjct  173  MQKAMSGVSVPFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLP  230



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   183 bits (464),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = -1

Query  579  EVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQGGK  400
            EVV  AP IPGV HVGGD+F S IP  +AIFMK VLT W+DEECK IM NCY AL  GGK
Sbjct  226  EVVAKAPTIPGVIHVGGDMFQS-IPTGEAIFMKWVLTTWTDEECKQIMKNCYNALPVGGK  284

Query  399  LIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKAYY  220
            LI CEPVLP +TDD+ RTR LL  DIF+M +YR K KH TEE +++LGLS GF TF+ +Y
Sbjct  285  LIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFTTFRPFY  344

Query  219  MDFFLAVLEFHK  184
            +D+F  +LEF K
Sbjct  345  IDYFYTILEFQK  356


 Score = 88.6 bits (218),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDF  584
            M KAMSG+SVPFMKA  D Y GFK V RLVDVGGSAGDCLRMI+E+  ++ + INFD 
Sbjct  167  MLKAMSGVSVPFMKAILDGYDGFKSVERLVDVGGSAGDCLRMILEQFPNVREGINFDL  224



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   172 bits (437),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP I GV+HVGGD+F S IP  DAIF K +L+ W+D ECK I+ NCY AL +G
Sbjct  237  LPEVVAKAPTIAGVSHVGGDMFKS-IPRGDAIFFKWILSTWTDSECKVILENCYKALPEG  295

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP ++D++ RTR LL +DIF+M +YRAK K+ +E+  RQLGLS GF  FK 
Sbjct  296  GKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAKGKNRSEDELRQLGLSAGFSHFKP  355

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  V+EF K
Sbjct  356  FYIDYFYTVIEFQK  369


 Score = 98.6 bits (244),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GF+GV RLVDVGGSAGDCLRMI++KH ++ + INFD P
Sbjct  180  MQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVKEGINFDLP  238



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   172 bits (437),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP I GV+HVGGD+F S IP  DAIF K +L+ W+D ECK I+ NCY AL +G
Sbjct  240  LPEVVAKAPTIAGVSHVGGDMFKS-IPRGDAIFFKWILSTWTDSECKVILENCYKALPEG  298

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP ++D++ RTR LL +DIF+M +YRAK K+ +E+  RQLGLS GF  FK 
Sbjct  299  GKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAKGKNRSEDELRQLGLSAGFSHFKP  358

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  V+EF K
Sbjct  359  FYIDYFYTVIEFQK  372


 Score = 98.6 bits (244),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GF+GV RLVDVGGSAGDCLRMI++KH ++ + INFD P
Sbjct  183  MQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVKEGINFDLP  241



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   176 bits (446),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGV+HVGGD+F S IP+ D IFMK VL  W+D+ECK IM NCY AL  G
Sbjct  224  LPEVVAKAPTIPGVSHVGGDMFKS-IPSGDGIFMKWVLVTWTDDECKLIMENCYKALPVG  282

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR LL  DIF+M +YR K KH TEE ++QLGLS GF  F+A
Sbjct  283  GKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTKGKHRTEEEFKQLGLSAGFPHFRA  342

Query  225  YYMDFFLAVLEFHK  184
            +  D F +VLEF K
Sbjct  343  FCFDDFYSVLEFQK  356


 Score = 94.7 bits (234),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFM+A  +SY GFKGV RLVDVGGS G+CLRMI++KH  + + INFD P
Sbjct  167  MQKAMSGVSVPFMRAILNSYDGFKGVKRLVDVGGSVGECLRMILQKHPHVEEGINFDLP  225



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   178 bits (452),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P+VV  AP IPGVTHVGGD+F   +P  DAIFMK VL  W+D+E K IM NCY AL  G
Sbjct  221  LPQVVAKAPQIPGVTHVGGDMF-KYVPQGDAIFMKWVLITWTDKEIKHIMQNCYKALPAG  279

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK KH TEE ++QLG+S GF  FKA
Sbjct  280  GKLIACEPVLPEDSDDSHRTRALLQGDIFVMTIYRAKGKHRTEEQFKQLGISAGFNLFKA  339

Query  225  YYMDFFLAVLEFHK  184
            +++D F AVLEF K
Sbjct  340  FHVDHFYAVLEFQK  353


 Score = 92.0 bits (227),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFMKA   SY GF+GV +LVDVGGS GDCLRMI+ K+ SI +AINFD P
Sbjct  164  MLKAMSGVSVPFMKALLASYNGFQGVEKLVDVGGSGGDCLRMILHKYPSIKEAINFDLP  222



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   172 bits (437),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP I GV+HVGGD+F S IP  DAIF+K +L+ W+D ECK I+ NCY AL +G
Sbjct  152  LPEVVAKAPTIAGVSHVGGDMFKS-IPRGDAIFLKWILSTWTDSECKVILENCYKALPEG  210

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP ++D++ RTR LL +DIF+M +YRAK K+ +E+  RQLGLS GF  FK 
Sbjct  211  GKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAKGKNRSEDELRQLGLSAGFSHFKP  270

Query  225  YYMDFFLAVLEFHK  184
            +Y+D+F  V+EF K
Sbjct  271  FYIDYFYTVIEFQK  284


 Score = 97.8 bits (242),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKA  D Y GF+GV RLVDVGGSAGDCLRMI++KH ++ + INFD P
Sbjct  95   MQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVREGINFDLP  153



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   173 bits (438),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGV+HVGGD+F S IP  DAIFMK VL+ W+D+ECK I+ NC  +L  G
Sbjct  238  LPEVVARAPTIPGVSHVGGDMFKS-IPTGDAIFMKWVLSTWTDDECKIILENCCKSLPVG  296

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEP LP +TD++ RTR LL SD+FIM +Y+AK K  TEE +RQLGLS GF   + 
Sbjct  297  GKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAKSKQRTEEQFRQLGLSAGFSALRP  356

Query  225  YYMDFFLAVLEFHK  184
            +++D+F  +LEF K
Sbjct  357  FHIDYFYCLLEFQK  370


 Score = 94.0 bits (232),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AM+G+SVPFMKA  D Y GFKGV +LVDVGGSAGDCLRMI++K+  I + INFD P
Sbjct  181  MQRAMAGVSVPFMKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPHIKEGINFDLP  239



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   171 bits (432),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGV+HVGGD+F S IP  DA+FMK VL+ W+D+ECK I+ NC  +L  G
Sbjct  239  LPEVVARAPPIPGVSHVGGDMFKS-IPTADAMFMKWVLSTWTDDECKIILENCCKSLPVG  297

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEP LP +TD++ RTR LL SD+FIM +Y+AK K  TEE +RQLGLS GF   + 
Sbjct  298  GKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAKSKQRTEEQFRQLGLSAGFSALRP  357

Query  225  YYMDFFLAVLEFHK  184
            +++D+F  +LEF K
Sbjct  358  FHIDYFYCLLEFTK  371


 Score = 95.9 bits (237),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AM+G+SVPFMKA  D Y GFKGV +LVDVGGSAGDCLRMI++K+ SI + INFD P
Sbjct  182  MQRAMAGVSVPFMKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPSIKEGINFDLP  240



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   176 bits (446),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IP VTHVGGD+F S IP  DAIFMK VLT W+DEECK IM +C+ AL +G
Sbjct  224  LPEVVAKAPQIPCVTHVGGDMFKS-IPQGDAIFMKWVLTTWTDEECKHIMQSCHKALPEG  282

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK KH TEE +RQL +  GF  F+A
Sbjct  283  GKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLAIDAGFPRFRA  342

Query  225  YYMDFFLAVLEFHK  184
            +++D F  VLEF K
Sbjct  343  FHVDHFYTVLEFQK  356


 Score = 89.7 bits (221),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AMSG+SVPFM+A  + Y GF+GV +LVDVGGS GDCLRMI++KH +I + INFD P
Sbjct  167  MVRAMSGVSVPFMRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILQKHPTIKEGINFDLP  225



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   176 bits (446),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IP VTHVGGD+F S IP  DAIFMK VLT W+DEECK IM +C+ AL +G
Sbjct  205  LPEVVAKAPQIPCVTHVGGDMFKS-IPQGDAIFMKWVLTTWTDEECKHIMQSCHKALPEG  263

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK KH TEE +RQL +  GF  F+A
Sbjct  264  GKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLAIDAGFPRFRA  323

Query  225  YYMDFFLAVLEFHK  184
            +++D F  VLEF K
Sbjct  324  FHVDHFYTVLEFQK  337


 Score = 89.7 bits (221),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AMSG+SVPFM+A  + Y GF+GV +LVDVGGS GDCLRMI++KH +I + INFD P
Sbjct  148  MVRAMSGVSVPFMRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILQKHPTIKEGINFDLP  206



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   178 bits (451),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F   IP  DAIFMK VLT W+DEE K IM NCY AL  G
Sbjct  222  LPEVVAKAPQIPGVTHVGGDMFKY-IPQADAIFMKWVLTTWTDEEIKHIMLNCYKALPAG  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR  L  DIF+M +YRAK KH TEE +RQL +S GF  FK+
Sbjct  281  GKLIACEPVLPETSDDSHRTRASLAGDIFVMTIYRAKGKHRTEEQFRQLAISAGFNLFKS  340

Query  225  YYMDFFLAVLEFHK  184
            +++D+F  VLEF K
Sbjct  341  FHVDYFHIVLEFQK  354


 Score = 87.4 bits (215),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAM+G+SVPFMKA  +SY GF+ V +LVDVGGS GDCLRMI++K+ +I Q  NFD P
Sbjct  165  MLKAMAGVSVPFMKALFESYHGFQNVEKLVDVGGSGGDCLRMILQKYPNIKQGFNFDLP  223



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   175 bits (443),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IP VTHVGGD+F   IP  DAIFMK VLT W+DEECK IM NC+ AL +G
Sbjct  223  LPEVVAKAPQIPFVTHVGGDMF-KFIPQGDAIFMKWVLTTWTDEECKHIMQNCHKALPEG  281

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK KH TEE +RQL +  GF  F+A
Sbjct  282  GKLIACEPVLPEDSDESHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLAIDAGFPRFRA  341

Query  225  YYMDFFLAVLEFHK  184
            +++D F  VLEF K
Sbjct  342  FHVDHFYTVLEFQK  355


 Score = 89.4 bits (220),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AMSG+SVPF++A  + Y GF+GV +LVDVGGS GDCLRMI+EKH +I + INFD P
Sbjct  166  MVRAMSGVSVPFIRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILEKHPTIKEGINFDLP  224



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   177 bits (450),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV+ AP IP + HVGGD+F   IP  DAIFMK VLT W+D+ECK IM +CY AL + 
Sbjct  228  LPEVVEKAPQIPSIKHVGGDMF-DYIPKGDAIFMKWVLTTWTDDECKEIMKSCYNALPEK  286

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK I CEPVLP  TDD++RTR LL  DIF+M +YRAK KH TEE YRQLG + GF   K 
Sbjct  287  GKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAKGKHRTEEEYRQLGRAAGFNECKG  346

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F  +LEFHK
Sbjct  347  FYIDHFFTILEFHK  360


 Score = 85.5 bits (210),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M  AMSG+SVPFMKA    Y GF+GV  LVDVGGS GDCL+MI+EKH  I   INFD P
Sbjct  171  MLNAMSGVSVPFMKAILQGYDGFQGVKTLVDVGGSGGDCLKMILEKHTDIELGINFDLP  229



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   177 bits (449),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV+ AP IP + HVGGD+F   IP  DAIFMK VLT W+D+ECK IM +CY AL + 
Sbjct  228  LPEVVEKAPQIPSIKHVGGDMF-DYIPKGDAIFMKWVLTTWTDDECKEIMKSCYIALPEK  286

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK I CEPVLP  TDD++RTR LL  DIF+M +YRAK KH TEE YRQLG + GF   K 
Sbjct  287  GKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAKGKHRTEEEYRQLGRAAGFNDCKG  346

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F  +LEFHK
Sbjct  347  FYIDHFFTILEFHK  360


 Score = 85.5 bits (210),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M  AMSG+SVPFMKA  + Y GF+GV  LVDVGGS GDCL+MI++KH +I   INFD P
Sbjct  171  MLNAMSGVSVPFMKAILEGYDGFQGVKTLVDVGGSGGDCLKMILDKHTNIELGINFDLP  229



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   169 bits (428),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP I GVTHVGGD+F S IP+ D IFMK +L+ W+D ECK I+ NCY AL  G
Sbjct  226  LPEVVAKAPTIAGVTHVGGDMFKS-IPSADVIFMKWILSTWTDCECKLILENCYKALPAG  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPV+P ++DD+ RTR LL +DIF+M +YR K K+ TEE  RQLG S GF  F+ 
Sbjct  285  GKLIACEPVVPRKSDDSHRTRALLENDIFVMTIYRTKGKNRTEEELRQLGHSAGFSHFRP  344

Query  225  YYMDFFLAVLEFHK  184
             Y+D+F  VLEF K
Sbjct  345  IYIDYFYTVLEFQK  358


 Score = 93.6 bits (231),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPF+KA  D Y GF+GVTRLVDVGGSAGDCL+MI++++ ++ + INFD P
Sbjct  169  MQKAMSGVSVPFIKAVLDGYDGFQGVTRLVDVGGSAGDCLKMIMDRYPNVREGINFDLP  227



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   168 bits (425),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIP--GVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALS  412
             PEVV  AP IP  GV+HVGGD+F S IP  DAIFMK VL+ W+D+ECK I+ NC  +L 
Sbjct  275  LPEVVARAPTIPETGVSHVGGDMFKS-IPTGDAIFMKWVLSTWTDDECKIILENCCKSLP  333

Query  411  QGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTF  232
             GGKLI CEP LP +TD++ RTR LL SD+FIM +Y+AK K  TEE +RQLGLS GF   
Sbjct  334  VGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAKSKQRTEEQFRQLGLSAGFSAL  393

Query  231  KAYYMDFFLAVLEFHK  184
            + +++D+F  +LEF K
Sbjct  394  RPFHIDYFYCLLEFQK  409


 Score = 94.0 bits (232),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AM+G+SVPFMKA  D Y GFKGV +LVDVGGSAGDCLRMI++K+  I + INFD P
Sbjct  218  MQRAMAGVSVPFMKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPHIKEGINFDLP  276



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   171 bits (434),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IP + H+GGD+F   +P  DAIFMK VLT W+D+ECK IM +CY AL + 
Sbjct  233  LPEVVGKAPKIPRINHIGGDMF-KYVPKGDAIFMKWVLTTWTDDECKQIMKSCYNALPEK  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  TDD++RTR LL  DIF+M +YRAK KH TE+ YRQLG S GF   + 
Sbjct  292  GKLIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAKGKHRTEDEYRQLGRSAGFADCRG  351

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F  +LEF K
Sbjct  352  FYIDHFFTILEFQK  365


 Score = 90.1 bits (222),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M  AMSG+SVPFMKA  +SY+GF+GV  LVDVGGS GDCL+MI+EKH SI   INFD P
Sbjct  176  MLNAMSGVSVPFMKAILESYEGFQGVKILVDVGGSGGDCLKMILEKHQSIQLGINFDLP  234



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   174 bits (441),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPGVTHVGGD+F S IP  DAIFMK VLT W+D+E K IM NCY +L  G
Sbjct  251  LPEVVAQAPQIPGVTHVGGDMFKS-IPCGDAIFMKWVLTTWTDDEIKLIMKNCYDSLPAG  309

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +DD+ RTR LL  DIF+M +Y AK +H  EE YRQLG S GF  F+A
Sbjct  310  GKLIACEPVLPETSDDSHRTRALLSGDIFVMTIYGAKGRHRMEEEYRQLGNSAGFPHFRA  369

Query  225  YYMDFFLAVLEFHK  184
             ++D+F  VLEF K
Sbjct  370  VHIDYFFTVLEFQK  383


 Score = 82.8 bits (203),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDS-YQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AM+G+SVPFMKA  +  Y GF GV +LVDVGGSAGDCL+MI+ K+  I + INFD P
Sbjct  193  MQRAMAGVSVPFMKAVVEGGYDGFDGVVKLVDVGGSAGDCLKMIMSKYGGIKEGINFDLP  252



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   168 bits (426),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP  P VTHVGGD+F S IP  DAIFMK VLT W+DEE K IM NC+ AL +G
Sbjct  222  LPEVVAKAPPTPCVTHVGGDMFKS-IPQGDAIFMKWVLTTWTDEEIKQIMQNCHKALPEG  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK KH TEE +RQL    GF  F+A
Sbjct  281  GKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLANDAGFPRFRA  340

Query  225  YYMDFFLAVLEFHK  184
            + +D F  VLEF K
Sbjct  341  FNVDHFYTVLEFQK  354


 Score = 87.8 bits (216),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFM+A  + Y GF+GV RLVDVGGS GDCLRMI+ K+ +I + INFD P
Sbjct  165  MVKAMSGVSVPFMRAMLEGYDGFQGVERLVDVGGSGGDCLRMILLKYPNIKEGINFDLP  223



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   161 bits (408),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV+ AP IPGV HVGGD+  + IP+   IFMK +LT W+D+ECK I+ NC+ AL  G
Sbjct  221  LPEVVEKAPKIPGVEHVGGDLLKT-IPSAVDIFMKWILTTWTDDECKHILKNCHDALPPG  279

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK++ CEPVLP  TD++ R+R LL  DIF+M +YR+K KH TE  YR+LG++ GFR FKA
Sbjct  280  GKVVACEPVLPNHTDNSHRSRALLEGDIFVMTIYRSKGKHRTEMEYRELGIAAGFRYFKA  339

Query  225  -YYMDFFLAVLEFHK  184
               +D F  VLEF K
Sbjct  340  KILLDQFYTVLEFQK  354


 Score = 92.0 bits (227),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M KAMSG+SVPFMKAF +SY GF+GV  LVDVGGSAGDCLRMI+ K+ SI + +NFD P
Sbjct  164  MLKAMSGVSVPFMKAFLNSYDGFQGVGTLVDVGGSAGDCLRMIMSKNPSIKKGVNFDLP  222



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   162 bits (409),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK VLT W+D+ECK IM NCY AL  G
Sbjct  181  LPEVVGEAPSIPGVTHIGGDMFKS-IPATDAIFMKWVLTTWTDDECKLIMENCYKALPTG  239

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  ++++QRTR LL  DIF M +YRAK KH TE+ ++QLG S GF   + 
Sbjct  240  GKLIACEPVLPDDSNESQRTRALLEGDIFFMTIYRAKGKHMTEQEFKQLGFSTGFPHLRL  299

Query  225  Y  223
            Y
Sbjct  300  Y  300


 Score = 90.9 bits (224),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  D Y GFKGV RLV+VGGSAGDCLRMI++KH  I + +NFD P
Sbjct  124  MRKAMSGVSVPFMTSVLDGYNGFKGVKRLVEVGGSAGDCLRMILQKHRFICEGMNFDLP  182



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   160 bits (406),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV+ AP IPG+ HVGGD+  S IP  DAIFMK +L   +DEECK I+ NC  AL  G
Sbjct  221  LPEVVEKAPKIPGIEHVGGDLLKSNIPPGDAIFMKWLLVTCTDEECKHILKNCSDALPSG  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI+C+P+LP  TDD+ R+R +L +DI+IM MYR K KH TE  YR LG++ GF   KA
Sbjct  281  GKLIICDPLLPNHTDDSHRSRAILEADIYIMTMYRTKGKHRTETEYRALGVAAGFTNLKA  340

Query  225  -YYMDFFLAVLEFHK  184
             + +D +  VLEF K
Sbjct  341  NFKIDNYFTVLEFEK  355


 Score = 90.1 bits (222),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFM+ F D Y GF+GV  LVDVGG++GDCLR+I+ K+ SI + INFD P
Sbjct  164  MQKAMSGVSVPFMETFLDRYDGFQGVETLVDVGGNSGDCLRLIMNKYKSIKKGINFDLP  222



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   158 bits (399),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK VLT W+D+ECK IM NCY AL  G
Sbjct  193  LPEVVAEAPSIPGVTHIGGDMFKS-IPAADAIFMKWVLTTWTDDECKLIMENCYKALPAG  251

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK  H TE+ ++QLG   GF   + 
Sbjct  252  GKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGNHRTEQEFKQLGFFAGFPHLRL  311

Query  225  Y  223
            Y
Sbjct  312  Y  312


 Score = 92.0 bits (227),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  + Y GFKGV RLVDVGGSAGDCLRMI++KH  I + INFD P
Sbjct  136  MRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLP  194



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   158 bits (399),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK VLT W+D+ECK IM NCY AL  G
Sbjct  130  LPEVVAEAPSIPGVTHIGGDMFKS-IPAADAIFMKWVLTTWTDDECKLIMENCYKALPAG  188

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK  H TE+ ++QLG   GF   + 
Sbjct  189  GKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGNHRTEQEFKQLGFFAGFPHLRL  248

Query  225  Y  223
            Y
Sbjct  249  Y  249


 Score = 92.0 bits (227),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  + Y GFKGV RLVDVGGSAGDCLRMI++KH  I + INFD P
Sbjct  73   MRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLP  131



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   157 bits (398),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK VLT W+D+ECK IM NCY AL  G
Sbjct  193  LPEVVAEAPSIPGVTHIGGDMFKS-IPAADAIFMKWVLTTWTDDECKLIMENCYKALPAG  251

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSV  247
            GKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK KH TE+ ++QLG S+
Sbjct  252  GKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSL  304


 Score = 92.4 bits (228),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  + Y GFKGV RLVDVGGSAGDCLRMI++KH  I + INFD P
Sbjct  136  MRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLP  194



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   158 bits (400),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPG+THVGG++F S +P+ DAIF+K VLT ++DEE   +M NC  AL  G
Sbjct  243  LPEVVAKAPKIPGITHVGGNMFES-VPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVG  301

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI  EP LP  +D++ RTR LL +DIFIM  YRAK KH TEE YRQLGL  GF  F+ 
Sbjct  302  GKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRV  361

Query  225  YYMDFFLAVLEFHK  184
             ++D+F  V+EF K
Sbjct  362  IHVDYFFPVVEFQK  375


 Score = 85.1 bits (209),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDS-YQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ AMSG+SVP+MKA   S Y GF+GV  LVDVGGS+GDCLRMI+ K+  I +AINFD P
Sbjct  185  MQYAMSGVSVPYMKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLP  244



>emb|CBI30187.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   185 bits (469),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  APNIPGVTHVGGD+F S +P+ DAIFMK VLT W+DEECK IM NCY AL  G
Sbjct  17   LPEVVAKAPNIPGVTHVGGDMFKS-VPDGDAIFMKWVLTTWTDEECKLIMKNCYNALPVG  75

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I CEPVLP ++D++ RTR LL  DIF+M +YRAK KH TEE +RQLGLS GF   +A
Sbjct  76   GKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKHRTEEEFRQLGLSAGFPHLRA  135

Query  225  YYMDFFLAVLEFHK  184
            +Y+D F  VLEF K
Sbjct  136  FYIDHFYTVLEFQK  149



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score =   157 bits (397),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    PEVV  AP IPG+THVGG++F S +P+ DAIF+K VLT ++DEE   +M NC 
Sbjct  96   KAINFDLPEVVAKAPKIPGITHVGGNMFES-VPSGDAIFVKWVLTCFTDEEVITLMRNCN  154

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK KH TEE YRQLGL  G
Sbjct  155  KALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAG  214

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F  F+  ++D+F  V+EF K
Sbjct  215  FPKFRVIHVDYFFPVVEFQK  234


 Score = 84.3 bits (207),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDS-YQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ AMSG+SVP+MKA   S Y GF+GV  LVDVGGS+GDCLRMI+ K+  I +AINFD P
Sbjct  44   MQYAMSGVSVPYMKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLP  103



>gb|AAP03056.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=206

 Score =   157 bits (397),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    PEVV  AP IPG+THVGG++F S +P+ DAIF+K VLT ++DEE   +M NC 
Sbjct  68   KAINFDLPEVVAKAPKIPGITHVGGNMFES-VPSGDAIFVKWVLTCFTDEEVITLMRNCN  126

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK KH TEE YRQLGL  G
Sbjct  127  KALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAG  186

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F  F+  ++D+F  V+EF K
Sbjct  187  FPKFRVIHVDYFFPVVEFQK  206


 Score = 84.0 bits (206),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDS-YQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ AMSG+SVP+MKA   S Y GF+GV  LVDVGGS+GDCLRMI+ K+  I +AINFD P
Sbjct  16   MQYAMSGVSVPYMKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLP  75



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   173 bits (439),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP  PG+THVGGD+F  AIP  DAIFMK VL  W+DEEC  I+ NCY AL + 
Sbjct  277  LPEVVAKAPKYPGMTHVGGDMF-KAIPAGDAIFMKWVLMTWTDEECMLILKNCYKALPEK  335

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I CEPVLP +TD++QRTR LL +DIF+M +YR + +  TEE +RQ+GLSVGF  FKA
Sbjct  336  GKVIACEPVLPEETDNSQRTRALLENDIFVMTIYRVQGRGRTEEEFRQIGLSVGFSNFKA  395

Query  225  YYMDFFLAVLEFHK  184
            +Y D F  +LEF K
Sbjct  396  FYSDHFYTILEFQK  409


 Score = 67.4 bits (163),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQG-FKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQ+AM G+S PFM AF + +   F GV  +VDVGGS+GDCLR I+++  ++ + +NFD P
Sbjct  219  MQRAMWGVSKPFMDAFLNGHAAAFAGVRTVVDVGGSSGDCLRAIMQRVPTVQRGVNFDLP  278



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   151 bits (381),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV+ AP IPG+ HVGGDV  S +P  DAIFMK +L A +D+ECK I  NC+ AL  G
Sbjct  227  LPEVVEKAPKIPGIEHVGGDVLKS-VPPGDAIFMKWILVACTDDECKQIFKNCFDALPPG  285

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLIVC+P+LP + DD + +R +L +DI+IM MYR K KH TE   R+LGL+ GF   K 
Sbjct  286  GKLIVCDPLLPDRADDNRSSRAILEADIYIMTMYRTKGKHRTETECRELGLAAGFHNLKP  345

Query  225  YY-MDFFLAVLEFHK  184
             + +D +  VLEF K
Sbjct  346  KFNVDHYFTVLEFQK  360


 Score = 88.6 bits (218),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFMKAF D Y GF+GV  LVDVGG++G+CLRMI+ K+ SI + + FD P
Sbjct  170  MQKAMSGVSVPFMKAFLDGYDGFQGVETLVDVGGNSGECLRMIMSKYQSIKKGVKFDLP  228



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   170 bits (430),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP + GVTHVGG++F S IP  DAIFMK VLT W+DEEC AI+ NCY AL +G
Sbjct  238  LPEVVAEAPPLAGVTHVGGNMFES-IPTGDAIFMKWVLTTWTDEECTAILRNCYNALPEG  296

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I CEPVLP++TD+++RTR LL  DIF+M +YR   +  TEE +RQLG  VGF  F+A
Sbjct  297  GKVIACEPVLPVETDNSRRTRALLEGDIFVMAIYRTLGRERTEEEFRQLGGVVGFTAFRA  356

Query  225  YYMDFFLAVLEFHK  184
             Y+D F AV+E+ K
Sbjct  357  IYLDPFYAVVEYQK  370


 Score = 68.6 bits (166),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSY--QGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDF  584
            MQ+AM G+S PFM+A  D Y   GF  V  LVDVGGS+G CL MI+ +  S+ + INFD 
Sbjct  179  MQRAMWGVSEPFMEALLDGYGSAGFGSVETLVDVGGSSGACLDMIMRRFPSVKRGINFDL  238

Query  583  P  581
            P
Sbjct  239  P  239



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   148 bits (373),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = -1

Query  582  PEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQGG  403
            PEVV  AP+I GVTH+GGD F S IP  DAIFMK VLT W+D+E K IM NCY AL  GG
Sbjct  99   PEVVGEAPSILGVTHIGGDTFKS-IPAADAIFMKWVLTTWTDDEYKLIMENCYKALPAGG  157

Query  402  KLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKAY  223
            KLI C+PVL   ++++QRTR LL  DIF+M +YRAK KH TE+ ++QLG S GF   + Y
Sbjct  158  KLIACKPVLLDDSNESQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGFSAGFLHLRLY  217


 Score = 89.7 bits (221),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  DSY  FKGV +LVDVGGSAGDCLRMI++KH  I + INFD P
Sbjct  41   MRKAMSGVSVPFMTSVLDSYNRFKGVKQLVDVGGSAGDCLRMILQKHRFIYEGINFDVP  99



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   153 bits (386),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P+VV+ AP IP + HVGGD+    IP  DAIFMK +L  ++++ECK IM +CY AL + 
Sbjct  228  LPKVVEKAPQIPRIKHVGGDML-DYIPKGDAIFMKWILAIFTEDECKQIMKSCYNALPEK  286

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK I+C+PVLP  TDD++RTR LL  DI+ M +YRA+ KH TEE YRQLG + GF   K 
Sbjct  287  GKFIICDPVLPHHTDDSKRTRALLEIDIYGMAIYRAQGKHRTEEEYRQLGRAAGFTDCKG  346

Query  225  YYMDFFLAVLEFHK  184
             Y+D F  +LEF+K
Sbjct  347  VYIDHFFTILEFYK  360


 Score = 83.6 bits (205),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M  AMSG+S+PFMK   + Y GF+GV  LVDVGGS GDCL+MI+EKH SI   INFD P
Sbjct  171  MFNAMSGVSMPFMKVMLERYDGFEGVKTLVDVGGSVGDCLKMILEKHPSIELGINFDLP  229



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   147 bits (372),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IP VTH+GGD+F S I   DAIFMK VLT W+D+ECK IM N Y AL  G
Sbjct  98   LPEVVAKAPSIPEVTHIGGDMFKS-IHVVDAIFMKWVLTTWTDDECKLIMENYYKALLAG  156

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
             KLI CEPVLP  ++++QRTR LL  DIF+M +YRAK KH TE+ ++QLG S GF   +A
Sbjct  157  RKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHKTEQEFKQLGFSTGFPHLRA  216

Query  225  Y  223
            +
Sbjct  217  F  217


 Score = 85.9 bits (211),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMS + VPFM +  D Y GFKGV RLVDVGGSAGDCLR+I++KH  I + INFD P
Sbjct  41   MRKAMSRVFVPFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRIILQKHCFICEGINFDLP  99



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   166 bits (420),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P+++  AP +PG+THVGGD   S +P  DAIF K  +  W+DEECK ++ NCY AL   
Sbjct  226  LPDMISSAPQLPGITHVGGDALES-VPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVN  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLIVCEPV P  TD++QRTR LL  DIFIM MYR K KH TEE ++QLG+S GF  F+A
Sbjct  285  GKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYRTKGKHRTEEQFKQLGISTGFLRFRA  344

Query  225  YYMDFFLAVLEFHK  184
            +++D +  VLEF K
Sbjct  345  FHIDPYFPVLEFQK  358


 Score = 65.1 bits (157),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            +MSG+S+P M    + Y GFKGV  LVDVGG++G  L MI+ K+ +I + INFD P
Sbjct  172  SMSGLSMPHMNEMLEKYDGFKGVETLVDVGGNSGVILNMIMNKYPNILKGINFDLP  227



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   137 bits (344),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  +AIFMK VL  W+D+ECK IM NCY AL  G
Sbjct  193  LPEVVGEAPSIPGVTHIGGDMFNS-IPAANAIFMKWVLATWTDDECKLIMENCYKALLAG  251

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTE  277
            GKLI CEPVL   ++++QRTR LL  DIF+M +YRAK KH TE
Sbjct  252  GKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAKGKHRTE  294


 Score = 93.2 bits (230),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M++A+SG+SVPFM +  DSY GFKGV RLVDVGGSAGDCLRMI++KH  I + INFD P
Sbjct  136  MRRAISGVSVPFMTSVLDSYNGFKGVKRLVDVGGSAGDCLRMILQKHHFICEGINFDLP  194



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   163 bits (412),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P+++  AP +PG+THVGGD     +P  DAIF K  +  W+DEECK ++ NCY AL   
Sbjct  203  LPDMISSAPQLPGITHVGGDAL-ELVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVN  261

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLIVCEPV P  TD++QRTR LL  DIFIM MY+ K KH TEE ++QLG+S GF  F+A
Sbjct  262  GKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTKGKHRTEEQFKQLGISAGFLRFRA  321

Query  225  YYMDFFLAVLEFHK  184
            +++D +  VLEF K
Sbjct  322  FHIDPYFPVLEFQK  335


 Score = 64.7 bits (156),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            +MSG+S+P M    + Y GFKGV  LVDVGG++G  L MI+ K+ +I + INFD P
Sbjct  149  SMSGMSMPHMNEMLEKYDGFKGVESLVDVGGNSGVILNMIMNKYPNILKGINFDLP  204



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   162 bits (411),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P+++  AP +PG+THVGGD     +P  DAIF K  +  W+DEECK ++ NCY AL   
Sbjct  226  LPDMISSAPQLPGITHVGGDAL-ELVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVN  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLIVCEPV P  TD++QRTR LL  DIFIM MY+ K KH TEE ++QLG+S GF  F+A
Sbjct  285  GKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTKGKHRTEEQFKQLGISAGFLRFRA  344

Query  225  YYMDFFLAVLEFHK  184
            +++D +  VLEF K
Sbjct  345  FHIDPYFPVLEFQK  358


 Score = 64.7 bits (156),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            +MSG+S+P M    + Y GFKGV  LVDVGG++G  L MI+ K+ +I + INFD P
Sbjct  172  SMSGMSMPHMNEMLEKYDGFKGVESLVDVGGNSGVILNMIMNKYPNILKGINFDLP  227



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   162 bits (411),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK VLT W+D+ECK IM NCY A+  G
Sbjct  177  LPEVVAEAPSIPGVTHIGGDMFKS-IPAADAIFMKWVLTTWTDDECKLIMENCYKAIPAG  235

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK KH TE+ ++QLG S GF   + 
Sbjct  236  GKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSAGFPHLRL  295

Query  225  Y  223
            Y
Sbjct  296  Y  296


 Score = 62.4 bits (150),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 36/59 (61%), Gaps = 16/59 (27%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  D Y GFKGV RLVDVGGSAG                INFD P
Sbjct  136  MRKAMSGVSVPFMTSILDGYDGFKGVKRLVDVGGSAG----------------INFDLP  178



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   162 bits (409),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK VLT W+D+ECK IM NCY A+  G
Sbjct  82   LPEVVAEAPSIPGVTHIGGDMFKS-IPAADAIFMKWVLTTWTDDECKLIMENCYKAIPAG  140

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK KH TE+ ++QLG S GF   + 
Sbjct  141  GKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSAGFPHLRL  200

Query  225  Y  223
            Y
Sbjct  201  Y  201


 Score = 62.4 bits (150),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 36/59 (61%), Gaps = 16/59 (27%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  D Y GFKGV RLVDVGGSAG                INFD P
Sbjct  41   MRKAMSGVSVPFMTSILDGYDGFKGVKRLVDVGGSAG----------------INFDLP  83



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   129 bits (325),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  +AIFMK VL  W+D+ECK IM NCY AL  G
Sbjct  193  LPEVVGEAPSIPGVTHIGGDMFNS-IPAANAIFMKWVLATWTDDECKLIMENCYKALLAG  251

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  295
            GKLI CEPVL   ++++QRTR LL  DIF+M +YRAK
Sbjct  252  GKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAK  288


 Score = 92.8 bits (229),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M++A+SG+SVPFM +  DSY GFKGV RLVDVGGSAGDCLRMI++KH  I + INFD P
Sbjct  136  MRRAISGVSVPFMTSVLDSYNGFKGVKRLVDVGGSAGDCLRMILQKHHFICEGINFDLP  194



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = -1

Query  609  LHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNN  430
            + K +   FP +V  AP  P +TH+GGD   S +P  DAIFMK +  AW+DEECK  + N
Sbjct  221  IRKGINYDFPAMVSSAPEFPDITHIGGDALQS-VPAGDAIFMKWIFLAWTDEECKKTLQN  279

Query  429  CYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLS  250
            CY AL   GKLIVCEPVLP  TD++QRTR LLG DIFIM MYR K KH TEE ++QLG S
Sbjct  280  CYKALPVDGKLIVCEPVLPELTDESQRTRALLGGDIFIMTMYRTKGKHRTEEQFKQLGAS  339

Query  249  VGFRTFKAYYMDFFLAVLEFHK  184
             GF  F+A+Y+D +LAVLEF K
Sbjct  340  TGFFRFRAFYIDPYLAVLEFQK  361


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            +++G+SVPFM+   ++Y GF+GV  L DVGG++G CL MI+ K+ +I + IN+DFP
Sbjct  175  SLAGMSVPFMREMLENYDGFQGVETLADVGGNSGVCLNMIMNKYPNIRKGINYDFP  230



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  + + L    P+VV  AP IPGV HVGGD+F S IP+ DAIFMK VLT W+++EC 
Sbjct  168  RRVRTIREGLNFDLPDVVAAAPPIPGVKHVGGDMFKS-IPSGDAIFMKWVLTTWTNDECT  226

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI+ NCYAAL  GGKL+ CEPV+P  TD + RTR LL +DIF+M  YR + +  +EE +R
Sbjct  227  AILRNCYAALPAGGKLVACEPVVPDTTDGSTRTRALLENDIFVMTTYRTQGRERSEEEFR  286

Query  264  QLGLSVGFRTFKAYYMDFFLAVLEFHK  184
            QLGL+VGF  F+A Y+D F A+LE+ K
Sbjct  287  QLGLAVGFTFFRAIYLDPFYALLEYTK  313


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVT-RLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AM+G+S PFM+A  D Y G       LVDVGGS+G CL MI+ +  +I + +NFD P
Sbjct  123  MLRAMTGVSEPFMEALLDGYGGGFEGVGTLVDVGGSSGACLEMIMRRVRTIREGLNFDLP  182



>gb|AAP03057.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=188

 Score =   157 bits (397),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP IPG+THVGG++F S +P+ DAIF+K VLT ++DEE   +M NC  AL  G
Sbjct  56   LPEVVAKAPKIPGITHVGGNMFES-VPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVG  114

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI  EP LP  +D++ RTR LL +DIFIM  YRAK KH TEE YRQLGL  GF  F+ 
Sbjct  115  GKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRV  174

Query  225  YYMDFFLAVLEFHK  184
             ++D+F  V+EF K
Sbjct  175  IHVDYFFPVVEFQK  188


 Score = 60.1 bits (144),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  697  QGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             GF+GV  LVDVGGS+GDCLRMI+ K+  I +AINFD P
Sbjct  19   NGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLP  57



>gb|AAP03051.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=167

 Score =   150 bits (379),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    PEVV  AP IPG+THVGG+ F S +P+ DAIF+K VLT ++DEE   +M NC 
Sbjct  34   KAINFDLPEVVAKAPKIPGITHVGGNTFES-VPSGDAIFVKWVLTCFTDEEVITLMRNCN  92

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK KH TEE YRQLGL  G
Sbjct  93   KALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAG  152

Query  243  FRTFKAYYMDFFLAV  199
            F  F+  ++D+F  V
Sbjct  153  FPKFRVIHVDYFFPV  167


 Score = 62.8 bits (151),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  700  YQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            Y GF+GV  LVDVGGS+GDCLRMI+ K+  I +AINFD P
Sbjct  2    YDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLP  41



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  + + +    P+VV  AP I GV HVGGD+F S IP+ DAIFMK VLT W+++EC 
Sbjct  217  RRVGTIAQGINFDLPDVVAAAPPIAGVRHVGGDMFKS-IPSGDAIFMKWVLTTWTNDECT  275

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI+ NCY AL +GGKLI CEPV+P  TD + RTR LL +DIF+M  YR + +  +EE +R
Sbjct  276  AILKNCYGALPEGGKLIACEPVVPETTDTSTRTRALLENDIFVMTTYRTQGRERSEEEFR  335

Query  264  QLGLSVGFRTFKAYYMDFFLAVLEFHK  184
            QLGL+ GF  F+A Y+D F AVLE+ K
Sbjct  336  QLGLAAGFTAFRAIYLDPFYAVLEYLK  362


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQG-FKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M + M+G+S PFM+A  D Y G F+ V  LVDVGGS+G CL MI+ +  +I Q INFD P
Sbjct  172  MLRGMTGVSEPFMEALLDGYAGGFEDVRTLVDVGGSSGACLDMIMRRVGTIAQGINFDLP  231



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  +   +    P+VV  AP IPGV HVGGD+F S IP+ DAIFMK VLT W++EEC 
Sbjct  220  RRVRTIRDGVNFDLPDVVAAAPPIPGVRHVGGDMFKS-IPSGDAIFMKWVLTTWTNEECT  278

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI++NC+ AL  GGK+I CEPV+P  TD + RTR LL +DIF+M  YR + +  +EE +R
Sbjct  279  AILSNCHKALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQGRERSEEEFR  338

Query  264  QLGLSVGFRTFKAYYMDFFLAVLEFHK  184
             LGL+ GF +F+A Y+D F AVLE+ K
Sbjct  339  HLGLAAGFASFRAIYLDPFYAVLEYTK  365


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQ--GFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDF  584
            M +AM+G+S PFM+A  + Y   GF+GV+ LVDVGGS+G CL MI+ +  +I   +NFD 
Sbjct  174  MLRAMTGVSEPFMEALLEGYGDGGFEGVSTLVDVGGSSGACLEMIMRRVRTIRDGVNFDL  233

Query  583  P  581
            P
Sbjct  234  P  234



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P+++  AP  PG+THVGGD   S +P  DAIF+K  +  W+DEE K  + +CY AL   
Sbjct  226  LPDMISSAPQYPGITHVGGDALES-VPAGDAIFIKWTVLTWTDEEFKKALQSCYKALPVA  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLI+CEPVLP QTD+++RTR LL +DI+IM MYR K KH TEE ++QLG+S GF++F+A
Sbjct  285  GKLILCEPVLPEQTDESKRTRALLAADIWIMTMYRTKGKHRTEEQFKQLGISAGFKSFRA  344

Query  225  YYMDFFLAVLEFHK  184
            +++D +L VLEFHK
Sbjct  345  FHIDPYLPVLEFHK  358


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP*GCS  569
            +MSG+S+P+M+   ++Y GFKGV  LVDVGG++G  L MI+ K+ +I + INFD P   S
Sbjct  172  SMSGMSLPYMREMLENYDGFKGVETLVDVGGNSGVSLNMIMNKYPNILKGINFDLPDMIS  231

Query  568  VGSQH  554
               Q+
Sbjct  232  SAPQY  236



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   115 bits (289),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 70/103 (68%), Gaps = 12/103 (12%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK     W       IM  CY AL  G
Sbjct  161  LPEVVGEAPSIPGVTHIGGDMFKS-IPAADAIFMK-----W------LIMEKCYKALPAG  208

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTE  277
            GKLIVCEPVLP  ++++QRTR LL  DIF+M +YRAK   WT+
Sbjct  209  GKLIVCEPVLPDDSNESQRTRALLEGDIFVMTIYRAKAYQWTK  251


 Score = 92.0 bits (227),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  D Y GFKGV RLVDVGGS GDCLRMI++KH  I + INFD P
Sbjct  104  MRKAMSGVSVPFMTSVLDGYNGFKGVKRLVDVGGSVGDCLRMILQKHHFICEGINFDLP  162



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  + + +    P+VV  AP I GV HVGGD+F S IP+ DAIFMK VLT W++EEC 
Sbjct  197  RRVDTIREGINFDLPDVVAAAPPIVGVRHVGGDMFKS-IPSGDAIFMKWVLTTWTNEECT  255

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI+ NCY+AL  GGK+I CEPV+P +TD + RTR LL +DIF+M  YR + +  +E+ +R
Sbjct  256  AILGNCYSALPDGGKVIACEPVVPEETDGSTRTRALLENDIFVMTTYRTQGRERSEDEFR  315

Query  264  QLGLSVGFRTFKAYYMDFFLAVLEFHK  184
             LG++ GF  F+A Y+D   AVLE+ K
Sbjct  316  NLGIAAGFTGFRAIYLDPLYAVLEYTK  342


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQ-GFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AM+G+S PFM+A  D Y  GF+GV  LVDVGGS+G CL MI+ +  +I + INFD P
Sbjct  152  MLRAMTGVSEPFMEALLDGYAAGFEGVATLVDVGGSSGACLEMIMRRVDTIREGINFDLP  211



>ref|XP_009787879.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Nicotiana 
sylvestris]
Length=121

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  546  VTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQ  367
            + H+GGD+F   +P  +AIFMK VLT W+D+ECK IM +CY AL + GKLI CEPVLP  
Sbjct  1    INHIGGDMF-KYVPKGNAIFMKWVLTTWTDDECKQIMKSCYNALPKKGKLIACEPVLPHH  59

Query  366  TDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFH  187
            TDD++RTR LL  DIF+M +YRAK KH TE+ YRQLG S GF   + +Y+D F  VLEFH
Sbjct  60   TDDSKRTRALLEGDIFVMTIYRAKGKHRTEDEYRQLGRSAGFADCRGFYIDHFFTVLEFH  119

Query  186  K  184
            K
Sbjct  120  K  120



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  + + +    P+VV  AP I GV HVGGD+F S IP+ DAIFMK VLT W+D+EC 
Sbjct  228  RRVPTITEGINFDLPDVVAAAPPIAGVRHVGGDMFKS-IPSGDAIFMKWVLTTWTDDECT  286

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI+ NC+AAL  GGKL+ CEPV+P +TD + RTR LL +DIF+M  YR + +  +EE +R
Sbjct  287  AILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQGRERSEEEFR  346

Query  264  QLGL-SVGFRTFKAYYMDFFLAVLEFHK  184
             LG+ + GF  F+A Y+D F AVLE+ K
Sbjct  347  HLGVDAAGFTAFRAIYLDPFYAVLEYTK  374


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQ---GFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFD  587
            M +AM+G+S PFM A  D Y    GF+GV  LVDVGGS+G CL MI+ +  +IT+ INFD
Sbjct  181  MLRAMAGVSEPFMGALLDGYGAAGGFRGVATLVDVGGSSGACLEMIMRRVPTITEGINFD  240

Query  586  FP  581
             P
Sbjct  241  LP  242



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  + + +    P+VV  AP I GV HVGGD+F S IP+ DAIFMK VLT W+++EC 
Sbjct  232  RRVPTIKEGINFDLPDVVADAPAIAGVRHVGGDMFKS-IPSGDAIFMKWVLTTWTNDECT  290

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI+ NC+AAL  GGKL+ CEPV+P +TD + RTR LL +DIF+M  YR + +  +EE + 
Sbjct  291  AILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQGRERSEEEFH  350

Query  264  QLGLSVGFRTFKAYYMDFFLAVLEFHK  184
             LG++ GF  F+A Y+D F AVLE+ K
Sbjct  351  HLGIAAGFTGFRAIYLDPFYAVLEYTK  377


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQ---GFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFD  587
            M +AM+G+S PFM A  D Y    GF GV  LVDVGGS+G CL MI+ +  +I + INFD
Sbjct  185  MLRAMTGVSEPFMHALLDGYGFDGGFHGVATLVDVGGSSGACLEMIMRRVPTIKEGINFD  244

Query  586  FP  581
             P
Sbjct  245  LP  246



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = -1

Query  576  VVQLAPNIPGVTHVGGDVFTSA--IPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQGG  403
            ++Q  P++ G+     +V   A  IP  DAIFMK VLT W+D+ECKAIM NCY AL  GG
Sbjct  215  ILQKYPHVEGINFDLPEVVAKAPSIPAADAIFMKWVLTTWTDDECKAIMENCYKALPVGG  274

Query  402  KLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKAY  223
            KLI CEPVLP ++DD+ RTR LL  DIF+M +YRAK KH T++ ++QLGLS GF  F+A+
Sbjct  275  KLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAKGKHRTQDEFKQLGLSAGFPHFRAF  334

Query  222  YMDFFLAVLEFHK  184
            Y+D+F  VLEF K
Sbjct  335  YIDYFYTVLEFQK  347


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MQKAMSG+SVPFM+A  D Y G KGV RLVDVGGSAGDCLRMI++K+  + + INFD P
Sbjct  173  MQKAMSGVSVPFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLP  230



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 102/148 (69%), Gaps = 2/148 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  + + +    P+VV  AP I GV HVGGD+F S IP+ DAIFMK VLT W+D+EC 
Sbjct  228  RRVPTITEGINFDLPDVVAAAPPIAGVRHVGGDMFKS-IPSGDAIFMKWVLTTWTDDECT  286

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI+ NC+A L  GGKL+ CEPV+P +TD + RTR LL +DIF+M  YR + +  +EE +R
Sbjct  287  AILRNCHAXLPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQGRERSEEEFR  346

Query  264  QLGL-SVGFRTFKAYYMDFFLAVLEFHK  184
             LG+ + GF  F+A Y+D F AVLE+ K
Sbjct  347  HLGVDAAGFTAFRAIYLDPFYAVLEYTK  374


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQ---GFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFD  587
            M +AM+G+S PFM A  D Y    GF+GV  LVDVGGS+G CL MI+ +  +IT+ INFD
Sbjct  181  MLRAMAGVSEPFMGALLDGYGAAGGFRGVATLVDVGGSSGACLEMIMRRVPTITEGINFD  240

Query  586  FP  581
             P
Sbjct  241  LP  242



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -1

Query  561  PNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQGGKLIVCEP  382
            P+IP VTH+GG +F S I   DAIFMK VLT W+D+ECK IM NCY AL  GG+LI CEP
Sbjct  57   PSIPRVTHIGGGMFKS-IHAVDAIFMKWVLTTWTDDECKLIMENCYKALPAGGELIACEP  115

Query  381  VLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKAYYMDFFLA  202
            VLP  ++++QRTR LL  DIF+M +YRAK KH  E+ ++QLG S  F   +A+Y D+F  
Sbjct  116  VLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRIEQEFKQLGFSASFPHLRAFYFDYFHT  175

Query  201  VLEFHK  184
            +LEF K
Sbjct  176  LLEFQK  181



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  + + +    P+VV  AP I GV HVGGD+F S IP+ DAIFMK VLT W+++EC 
Sbjct  222  RRVPTIREGVNFDLPDVVAAAPPIAGVKHVGGDMFKS-IPSGDAIFMKWVLTTWTNDECT  280

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
            AI+  C+ AL  GGKL+ CEPV+P  TD + RTR LL +DIF+M  YR + +  +EE +R
Sbjct  281  AILKKCHDALPDGGKLVACEPVVPETTDASTRTRALLENDIFVMTTYRTQGRERSEEEFR  340

Query  264  QLGLSVGFRTFKAYYMDFFLAVLEFHK  184
            QLG++ GF  F+A Y+D F A+LE+ K
Sbjct  341  QLGIAAGFAGFRALYLDPFYALLEYVK  367


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQG-FKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AM+G+S PFM+A  D Y+G F+GV  LVDVGGS+G CL MI+ +  +I + +NFD P
Sbjct  177  MLRAMTGVSEPFMEALLDGYEGGFEGVGTLVDVGGSSGACLEMIMRRVPTIREGVNFDLP  236



>gb|EMT14045.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=197

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = -1

Query  573  VQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQGGKLI  394
            VQ+  +  GV HVGGD+F S IP+ DAIFMK VLT W+++EC AI+  C+ AL +GGKLI
Sbjct  69   VQVQSDCAGVKHVGGDMFKS-IPSGDAIFMKWVLTTWTNDECTAILKKCHEALPEGGKLI  127

Query  393  VCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKAYYMD  214
             CEPV+P  TD + RTR LL +DIF+M  YR + +  +EE +RQLGL+ GF  F+A Y+D
Sbjct  128  ACEPVVPDTTDASTRTRALLENDIFVMTTYRTQGRERSEEEFRQLGLTAGFAGFRALYLD  187

Query  213  FFLAVLEFHK  184
             F AVLE+ K
Sbjct  188  PFYAVLEYVK  197



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score = 92.0 bits (227),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             PEVV  AP+IPGVTH+GGD+F S IP  DAIFMK VLT W+D+ECK IM NCY AL  G
Sbjct  193  LPEVVGEAPSIPGVTHIGGDMFKS-IPATDAIFMKWVLTTWTDDECKLIMENCYKALLAG  251

Query  405  GKLI  394
            G+L+
Sbjct  252  GELL  255


 Score = 91.3 bits (225),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+KAMSG+SVPFM +  D Y GFKGV RLV+VGGSAGDCLRMI++KH  I + +NFD P
Sbjct  136  MRKAMSGVSVPFMTSVLDGYNGFKGVKRLVEVGGSAGDCLRMILQKHRFICEGMNFDLP  194



>ref|XP_006428523.1| hypothetical protein CICLE_v10013676mg [Citrus clementina]
 gb|ESR41763.1| hypothetical protein CICLE_v10013676mg [Citrus clementina]
Length=102

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -1

Query  486  MKSVLTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNM  307
            ++ VLT W+D+ECK IM NCY AL  GGKLI CEPVLP  ++++QRTR LL  DIF+M +
Sbjct  2    LQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTI  61

Query  306  YRAKRKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  184
            YRAK KH TE+ ++QLGLS GF   +A+Y+D+F  +LEF K
Sbjct  62   YRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFQK  102



>gb|KFK45045.1| hypothetical protein AALP_AA1G337000 [Arabis alpina]
Length=359

 Score =   104 bits (259),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 1/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  + NIPG+ +V GD++TS IP  +AIFMK +L +W DE C  I+ NCY +L   
Sbjct  225  LPSVINTSSNIPGIENVAGDMYTSTIPKGEAIFMKWILHSWDDEHCVKILRNCYESLPSN  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + V+P    DT   R L   ++F+MNM     K  T++ +  L    GF + + 
Sbjct  285  GKVIVIDMVIPDFPQDTLLDRSLFQFELFMMNM-NPSGKERTKKEFEILAHLSGFSSVQV  343

Query  225  YYMDFFLAVLEFHK  184
             +     + +EFHK
Sbjct  344  SFTSLCFSAIEFHK  357


 Score = 59.3 bits (142),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            QK+M G +  F++ F + Y+GF GV  LVDVGG  G  L  I+ K+  I +AINFD P
Sbjct  169  QKSMRGFNEVFVEEFVNKYKGFDGVESLVDVGGGDGSILSKIITKNPHIIKAINFDLP  226



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   109 bits (272),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV  AP IPGV HVGGD+F S +P  DAIFMK +L  WSDE C  ++ NCY ++ + 
Sbjct  222  LPHVVAKAPQIPGVEHVGGDMFVS-VPQGDAIFMKWILHDWSDEACITLLKNCYKSIPEH  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + VLP   D     R  L  D+ ++ +Y    K  T E + +L  + GF + K 
Sbjct  281  GKVIVVDSVLPSVLDTGAGARVALSIDLLML-VYNPGGKERTFEDFEKLAKASGFSSVKV  339

Query  225  YYMDFFLAVLEFHK  184
                 F++V+EFHK
Sbjct  340  PVTVDFISVVEFHK  353


 Score = 53.5 bits (127),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
              AMS  S  +M A  ++Y GFKG+  LVDVGG  G  L +I++K+  I + INFD P
Sbjct  167  HAAMSNHSKLYMNAILEAYHGFKGIGTLVDVGGGVGTSLTVILKKYPEI-KGINFDLP  223



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   109 bits (272),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV  AP IPGV HVGGD+F S +P  DAIFMK +L  WSDE C  ++ NCY ++ + 
Sbjct  222  LPHVVAKAPQIPGVEHVGGDMFVS-VPQGDAIFMKWILHDWSDEACITLLKNCYKSIPEH  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + VLP   D     R  L  D+ ++ +Y    K  T E + +L  + GF + K 
Sbjct  281  GKVIVVDSVLPSVLDTGAGARVALSIDLLML-VYNPGGKERTFEDFEKLAKASGFSSVKV  339

Query  225  YYMDFFLAVLEFHK  184
                 F++V+EFHK
Sbjct  340  PVTVDFISVVEFHK  353


 Score = 53.5 bits (127),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
              AMS  S  +M A  ++Y GFKG+  LVDVGG  G  L +I++K+  I + INFD P
Sbjct  167  HAAMSNHSKLYMNAILEAYHGFKGIGTLVDVGGGVGTSLAVILKKYPEI-KGINFDLP  223



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 87/147 (59%), Gaps = 21/147 (14%)
 Frame = -1

Query  624  RSIXVLHKQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECK  445
            R +  +   +    P+VV  AP IPGV HVGGD+F S IP+ DAIFMK            
Sbjct  220  RRVRTIRDGVNFDLPDVVAAAPPIPGVRHVGGDMFKS-IPSGDAIFMK------------  266

Query  444  AIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYR  265
                    AL  GGK+I CEPV+P  TD + RTR LL +DIF+M  YR + +  +EE +R
Sbjct  267  --------ALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQGRERSEEEFR  318

Query  264  QLGLSVGFRTFKAYYMDFFLAVLEFHK  184
             LGL+ GF +F+A Y+D F AVLE+ K
Sbjct  319  HLGLAAGFASFRAIYLDPFYAVLEYTK  345


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQ--GFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDF  584
            M +AM+G+S PFM+A  + Y   GF+GV+ LVDVGGS+G CL M++ +  +I   +NFD 
Sbjct  174  MLRAMTGVSEPFMEALLEGYGDGGFEGVSTLVDVGGSSGACLEMMMRRVRTIRDGVNFDL  233

Query  583  P  581
            P
Sbjct  234  P  234



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   105 bits (263),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP   GV HVGGD+F S +P  DAIFMKS+   WSD+ C   + NCY AL   
Sbjct  232  LPHVIEDAPQFLGVEHVGGDMFVS-VPKGDAIFMKSICHDWSDDHCLKFLKNCYTALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  Y    K  TE+ +  L +  GF+ F+ 
Sbjct  291  GKVILVESILPVAPDSSLATKVVVNLDV-IMLGYNPGGKERTEKEFEALAMGSGFKGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F +  +EF K
Sbjct  350  ICSAFHIYAIEFLK  363


 Score = 54.3 bits (129),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NRGMAAQSTIIMKKLLETYKGFEGLTSVVDVGGGTGAVVNMIVSKYPSI-KGINFDLP  233



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = -1

Query  606  HKQLTSI---FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIM  436
            HK L  I    P+VV+ AP   G+ HVGGD+    +P  D IFMK +L +W D+EC  ++
Sbjct  210  HKGLEGINFDLPKVVEAAPPYLGIEHVGGDML-EWVPQGDVIFMKGILCSWDDDECVGLL  268

Query  435  NNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLG  256
             NCY AL + GK+I  E VLP+ TD +  TR LL +D+F+M +Y    K  TE+ +R+L 
Sbjct  269  KNCYKALPEKGKVIALEQVLPMHTDTSPSTRALLQADVFLMAIYSPGSKRRTEDIFRRLS  328

Query  255  LSVGFRTFKAYYMDFFLAVLEFHK  184
             + GFRT +      F   LEF K
Sbjct  329  EAAGFRTLEIVLPGSFYTALEFQK  352


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -3

Query  757  MQKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M +AMS  S   M  F + Y GF+GV R+VD+GGS+G CL+ I++KH  + + INFD P
Sbjct  164  MMEAMSSSSGAVMDWFLERYDGFEGVRRVVDLGGSSGFCLKKILDKHKGL-EGINFDLP  221



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score =   102 bits (254),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVDHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPNN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  LGCAFNTYIMEFIK  363


 Score = 55.5 bits (132),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-RGINFDLP  233



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score =   102 bits (254),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVDHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPNN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  LGCAFNTYIMEFIK  363


 Score = 55.5 bits (132),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-RGINFDLP  233



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score =   102 bits (255),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY+AL   
Sbjct  232  LPHVIQDAPSYPGVEHVGGDMFVS-VPKADAIFMKWICHDWSDEHCLKFLKNCYSALPAN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K   E+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDASLATKSVIHIDC-IMLAHNPGGKERNEKEFEALAKGAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  LCSAFNTYVMEFLK  363


 Score = 55.1 bits (131),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  + MIV K+ S+ + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVINMIVSKYPSL-KGINFDLP  233



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score =   104 bits (259),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +P  DAIFMK +   WSD  C   + NCY AL + 
Sbjct  226  LPHVIQDAPPYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEH  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ ++ L  + GF  FK 
Sbjct  285  GKVIVAECILPVAPDASLATKGVIHIDL-IMLAHNPGGKERTEKEFQALSKAAGFLGFKV  343

Query  225  YYMDFFLAVLEFHK*P  178
            +   F   V+EF K P
Sbjct  344  HCCAFNTYVMEFLKTP  359


 Score = 53.5 bits (127),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  171  NKGMSDHSTITMKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLP  227



>ref|XP_004137204.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 gb|KGN53621.1| hypothetical protein Csa_4G091880 [Cucumis sativus]
Length=359

 Score =   104 bits (259),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +P  DAIFMK +   WSD  C   + NCY AL + 
Sbjct  226  LPHVIQDAPPYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEH  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ ++ L  + GF  FK 
Sbjct  285  GKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPGGKERTEKEFQALSKAAGFDGFKV  343

Query  225  YYMDFFLAVLEFHK*P  178
            +   F   V+EF K P
Sbjct  344  HCCAFNTYVMEFLKTP  359


 Score = 53.5 bits (127),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  171  NKGMSDHSTITMKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLP  227



>ref|XP_008380838.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   102 bits (255),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   W+DE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWTDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++ SD  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F    +EF K
Sbjct  350  VCSAFNTYAIEFLK  363


 Score = 55.1 bits (131),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMADNSTITMKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala]
 gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala]
Length=365

 Score =   103 bits (258),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSDE C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDEHCVKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++  D+ IM  +    K  TE+ +  L  + GF+ F+ 
Sbjct  291  GKVIVAECILPASPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKAAGFQGFRV  349

Query  225  YYMDFFLAVLEFHK*P  178
                F   ++EF K P
Sbjct  350  CCSAFNTYIMEFLKKP  365


 Score = 53.5 bits (127),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T LVDVGG  G  + MIV K+ SI   INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFEGLTSLVDVGGGTGAVISMIVSKYPSI-NGINFDLP  233



>gb|ABI54118.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   102 bits (255),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   W+DE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWTDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++ SD  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F    +EF K
Sbjct  350  VCSAFNTYAIEFLK  363


 Score = 54.7 bits (130),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMADNSTITMKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt)
 pdb|3REO|B Chain B, Monolignol O-Methyltransferase (Momt)
 pdb|3REO|C Chain C, Monolignol O-Methyltransferase (Momt)
 pdb|3REO|D Chain D, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|A Chain A, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|B Chain B, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|C Chain C, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|D Chain D, Monolignol O-Methyltransferase (Momt)
Length=368

 Score =   103 bits (257),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP   GV H+GGD+F   +P  DAIF+K +   WSDE C  ++ NCYAAL   
Sbjct  235  LPHVIQDAPAFSGVEHLGGDMF-DGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDH  293

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++ +D  ++  Y    K  TE+ ++ L ++ GFR FK 
Sbjct  294  GKVIVAEYILPPSPDPSIATKVVIHTDALML-AYNPGGKERTEKEFQALAMASGFRGFKV  352

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  353  ASCAFNTYVMEFLK  366


 Score = 53.5 bits (127),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   + Y GF+G+T +VDVGG  G    MIV K+ SI  AINFD P
Sbjct  180  NKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSI-NAINFDLP  236



>ref|XP_004156527.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=359

 Score =   103 bits (258),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +P  DAIFMK +   WSD  C   + NCY AL + 
Sbjct  226  LPHVIQDAPPYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEH  284

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ ++ L  + GF  FK 
Sbjct  285  GKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPGGKERTEKEFQALSKAAGFDGFKV  343

Query  225  YYMDFFLAVLEFHK*P  178
            +   F   V+EF K P
Sbjct  344  HCCAFNTYVMEFLKTP  359


 Score = 53.1 bits (126),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  171  NKRMSDHSTITMKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLP  227



>sp|O04385.2|IEMT_CLABR RecName: Full=(Iso)eugenol O-methyltransferase; AltName: Full=S-adenosysl-L-methionine:(Iso)eugenol 
O-methyltransferase; 
Short=IEMT; Flags: Precursor [Clarkia breweri]
 gb|AAC01533.1| SAM:(Iso)eugenol O-methyltransferase [Clarkia breweri]
Length=368

 Score =   103 bits (257),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP   GV H+GGD+F   +P  DAIF+K +   WSDE C  ++ NCYAAL   
Sbjct  235  LPHVIQDAPAFSGVEHLGGDMF-DGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDH  293

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++ +D  ++  Y    K  TE+ ++ L ++ GFR FK 
Sbjct  294  GKVIVAEYILPPSPDPSIATKVVIHTDALML-AYNPGGKERTEKEFQALAMASGFRGFKV  352

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  353  ASCAFNTYVMEFLK  366


 Score = 53.5 bits (127),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   + Y GF+G+T +VDVGG  G    MIV K+ SI  AINFD P
Sbjct  180  NKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSI-NAINFDLP  236



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score =   102 bits (253),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIQDAPSYPGVEHVGGDMFVS-VPKADAIFMKWICHDWSDEHCLKFLKNCYNALPAN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K   E+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDTSLATKSVIHIDC-IMLAHNPGGKERNEKEFEALAKGAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  LCSAFNTYVMEFLK  363


 Score = 55.1 bits (131),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  + MIV K+ S+ + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVINMIVSKYPSL-KGINFDLP  233



>ref|XP_010478733.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=352

 Score = 94.7 bits (234),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  +    G+ +V GD+FTS IP  +AIFMK +L +W DE C  I++NCY +L   
Sbjct  219  LPSVINTSSASSGIEYVSGDMFTS-IPKGEAIFMKWMLHSWDDEHCVKILSNCYQSLPSN  277

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + V+P    DT   R L   ++F+MNM     K  T++ +  L    GF + + 
Sbjct  278  GKVIVVDMVIPDLPGDTLLDRSLFQFELFMMNM-NPSGKERTKKEFETLARLAGFSSVQV  336

Query  225  YYMDFFLAVLEFHK  184
             +     +V+EFHK
Sbjct  337  PFTSLCFSVVEFHK  350


 Score = 62.8 bits (151),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            Q +M G +  FM+ F  SY GF GV  LVDVGG  G  L  I+ KH  I +AINFD P
Sbjct  163  QSSMKGFNEVFMEEFLKSYNGFDGVKSLVDVGGGDGSILSRIISKHPHIIKAINFDLP  220



>gb|AFQ94040.1| monolignol 4-O-methyltransferase 4 [synthetic construct]
Length=368

 Score =   103 bits (257),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP   GV H+GGD+F   +P  DAIF+K +   WSDE C  ++ NCYAAL   
Sbjct  235  LPHVIQDAPAFSGVEHLGGDMF-DGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDH  293

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++ +D  ++  Y    K  TE+ ++ L ++ GFR FK 
Sbjct  294  GKVIVAEYILPPSPDPSIATKVVIHTDALML-AYNPGGKERTEKEFQALAMASGFRGFKV  352

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  353  ASCAFNTYVMEFLK  366


 Score = 53.5 bits (127),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   + Y GF+G+T +VDVGG  G    MIV K+ SI  AINFD P
Sbjct  180  NKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSI-NAINFDLP  236



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score =   103 bits (256),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ ++ L    GF+ F  
Sbjct  291  GKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ACSAFNTYVIEFLK  363


 Score = 53.5 bits (127),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>ref|XP_007218167.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19366.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   103 bits (256),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ ++ L    GF+ F  
Sbjct  291  GKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ACSAFNTYVIEFLK  363


 Score = 53.9 bits (128),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>sp|Q43609.1|COMT1_PRUDU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Prunus dulcis]
 emb|CAA58218.1| caffeic O-methyltransferase [Prunus dulcis]
Length=365

 Score =   103 bits (256),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ ++ L    GF+ F  
Sbjct  291  GKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ACSAFNTYVIEFLK  363


 Score = 53.9 bits (128),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 99.8 bits (247),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP   GV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYA+L   
Sbjct  229  LPHVIEDAPAYNGVEHVGGDMFES-VPKGDAIFMKWICHDWSDEHCLKFLKNCYASLPDH  287

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IVCE +LP+  +     R +   D  IM  +    K  TE+ +  L    GF  F+ 
Sbjct  288  GKVIVCEYILPVAPETNHAARTVFHVDA-IMLAHNPGGKERTEQEFEGLAKGAGFEGFRV  346

Query  225  YYMDFFLAVLEFHK  184
                +   V+EF+K
Sbjct  347  ACSAYDTKVIEFYK  360


 Score = 57.4 bits (137),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   D+Y+GF+G++ LVDVGG  G  L MI+ KH +I + INFD P
Sbjct  174  NNGMSNHSTITMKRILDTYKGFEGLSTLVDVGGGTGATLNMIISKHPTI-KGINFDLP  230



>ref|XP_007218166.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19365.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   103 bits (256),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PG+ HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGINHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ ++ L    GF+ F  
Sbjct  291  GKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ACSAFNTYVIEFLK  363


 Score = 53.9 bits (128),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>ref|XP_009392797.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   105 bits (262),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV HVGGD+F S +P+ DAI MK +L  WSDE C  I+ +C+ AL + 
Sbjct  231  LPHVISEAPPFPGVEHVGGDMFAS-VPSGDAILMKWILHDWSDEHCAKILKSCWEALPEK  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP+  + T R + +   D+ IM  +    K  TEE +  L    GF  FKA
Sbjct  290  GKVIVVECVLPVVPEPTPRAQGVFHVDL-IMLAHNPGGKERTEEEFHGLAKQAGFSGFKA  348

Query  225  YYMDFFLAVLEFHK  184
             Y+     V+EF K
Sbjct  349  TYIFANAWVIEFTK  362


 Score = 51.2 bits (121),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 30/55 (55%), Gaps = 1/55 (2%)
 Frame = -3

Query  745  MSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M   S+   K   D Y+GF  V RLVDVGG  G  L MI  KH  I  AINFD P
Sbjct  179  MKNHSIIITKKLLDIYRGFDDVNRLVDVGGGIGATLFMITSKHPHI-HAINFDLP  232



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score =   103 bits (256),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +PN DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPNADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPGGKERTEKEFEGLANGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MCCAFNTHVIEFRK  363


 Score = 53.5 bits (127),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>gb|AID68566.1| caffeic O-methyltransferase [Punica granatum]
Length=370

 Score =   103 bits (258),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP++PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  237  LPHVIEDAPSLPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDH  295

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF  F+ 
Sbjct  296  GKVIVAECILPLSPDPSLATKGVIHIDC-IMLAHNPGGKERTEKEFEALAKGAGFEGFRV  354

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  355  ACCAFNTYVMEFLK  368


 Score = 52.4 bits (124),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  182  NRGMSDHSTITMKKILETYKGFEGLNTIVDVGGGTGAVLSMIVAKYPSI-KGINFDLP  238



>ref|XP_009361271.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=365

 Score =   105 bits (261),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP   GV HVGGD+F S +P  DAIFMKS+   WSD+ C  I+ NCY AL   
Sbjct  232  LPHVIDDAPQFLGVEHVGGDMFAS-VPKGDAIFMKSICHDWSDDHCLKILKNCYTALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  Y    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILAEGILPVAPDSSLATKVVVNLDV-IMLGYNPGGKERTEKEFEALAKGSGFKGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F +  +EF K
Sbjct  350  ICSAFHIYAIEFLK  363


 Score = 51.6 bits (122),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   M+   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NRGMAVQSTIIMEKLLETYKGFEGLTSVVDVGGGTGAAVNMIVSKYPSI-KGINFDLP  233



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   101 bits (252),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F    +EF K
Sbjct  350  VCSAFNTYAIEFLK  363


 Score = 54.7 bits (130),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score =   102 bits (253),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   W DE C   + NCYAAL   
Sbjct  300  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWXDEHCLKFLKNCYAALPDN  358

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++ SD  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  359  GKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  417

Query  225  YYMDFFLAVLEFHK  184
                F    +EF K
Sbjct  418  VCSAFNTYAIEFLK  431


 Score = 54.3 bits (129),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  245  NKGMADHSTITMKKLLENYNGFEGLTSIVDVGGGTGAVLXMIVSKYPSI-KGINFDLP  301



>ref|XP_010918594.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=362

 Score =   102 bits (255),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP IPGV HVGGD+F+S IP+ DAIFMK +L  WSDE C  I+ NC+ AL   
Sbjct  231  LPHVISGAPLIPGVVHVGGDMFSS-IPSADAIFMKWILHDWSDEHCLKILKNCWKALPNN  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP        T+ L   D+ ++  Y    K  T++ +  L    GF  FKA
Sbjct  290  GKVIVAECLLPEAPKANAETQVLYYGDLAMLT-YNIGGKERTKKEFESLAKEAGFAHFKA  348

Query  225  YYMDFFLAVLEFHK  184
                  + V+EF K
Sbjct  349  ECCALNMWVMEFLK  362


 Score = 53.5 bits (127),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  +  F+K   D+Y+GF+ +  LVDVGG  G  L+MIV K+  I Q INFD P
Sbjct  176  NQGMSNHTTLFVKKMLDTYKGFEDLKHLVDVGGGLGATLQMIVSKYPHI-QGINFDLP  232



>gb|KJB73218.1| hypothetical protein B456_011G223000 [Gossypium raimondii]
Length=353

 Score =   102 bits (255),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 80/135 (59%), Gaps = 4/135 (3%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VVQ AP+ P + HVGGD+F S +P  D I MK VL  W DE C  ++ NCY AL + 
Sbjct  222  LPHVVQQAPSFPDIEHVGGDMF-STVPKADTIMMKEVLHNWDDEHCLKLLKNCYEALEEK  280

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV   ++  + + +   +FL   D+++   + AK++  TE+ ++ + +  GF +F+ 
Sbjct  281  GKVIVISYMMFEEAEGSNAAKFLYQMDLYMATKFVAKQR--TEKQFKSMAMDAGFSSFQL  338

Query  225  YYMDF-FLAVLEFHK  184
              + F  +AV+E HK
Sbjct  339  KCLVFNVVAVMELHK  353


 Score = 53.5 bits (127),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM+ +S   MK   + Y GF+GVT LVDVGG  G  L M++ K+ SI + IN++ P
Sbjct  169  AMTNLSKIIMKKILERYNGFQGVTTLVDVGGGYGVTLNMVISKYPSI-KGINYELP  223



>gb|AAA80579.1| 3' flavonoid O-methyltransferase [Chrysosplenium americanum]
Length=343

 Score =   105 bits (261),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 80/134 (60%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PG+ HVGGD+F S +P  DAIFMK +   W++E+C  ++ NCY AL   
Sbjct  208  LPHVIQDAPEYPGIEHVGGDMFVS-VPKGDAIFMKWICHDWNEEQCLKLLKNCYDALPNN  266

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  ++  + +D+ I+    +  K  TE+ +  L  + GF+ F+ 
Sbjct  267  GKVIVAEYILPVVPDSSLASKLSVTADVMIVTQ-NSGGKERTEKEFEALAKAAGFQGFQV  325

Query  225  YYMDFFLAVLEFHK  184
            +   F + ++EF K
Sbjct  326  FCNAFTIYIIEFSK  339


 Score = 51.2 bits (121),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   +K   ++Y+GF+G+T LVDVGG  G  L  I+ K+ +I + INFD P
Sbjct  153  NKGMSDFSSMIIKKILETYKGFQGLTSLVDVGGGTGATLTKILSKYPTI-RGINFDLP  209



>gb|KJB73217.1| hypothetical protein B456_011G223000 [Gossypium raimondii]
Length=316

 Score =   102 bits (255),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 80/135 (59%), Gaps = 4/135 (3%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VVQ AP+ P + HVGGD+F S +P  D I MK VL  W DE C  ++ NCY AL + 
Sbjct  185  LPHVVQQAPSFPDIEHVGGDMF-STVPKADTIMMKEVLHNWDDEHCLKLLKNCYEALEEK  243

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV   ++  + + +   +FL   D+++   + AK++  TE+ ++ + +  GF +F+ 
Sbjct  244  GKVIVISYMMFEEAEGSNAAKFLYQMDLYMATKFVAKQR--TEKQFKSMAMDAGFSSFQL  301

Query  225  YYMDF-FLAVLEFHK  184
              + F  +AV+E HK
Sbjct  302  KCLVFNVVAVMELHK  316


 Score = 53.5 bits (127),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM+ +S   MK   + Y GF+GVT LVDVGG  G  L M++ K+ SI + IN++ P
Sbjct  132  AMTNLSKIIMKKILERYNGFQGVTTLVDVGGGYGVTLNMVISKYPSI-KGINYELP  186



>gb|KJB73216.1| hypothetical protein B456_011G223000 [Gossypium raimondii]
Length=344

 Score =   102 bits (255),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 80/135 (59%), Gaps = 4/135 (3%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VVQ AP+ P + HVGGD+F S +P  D I MK VL  W DE C  ++ NCY AL + 
Sbjct  213  LPHVVQQAPSFPDIEHVGGDMF-STVPKADTIMMKEVLHNWDDEHCLKLLKNCYEALEEK  271

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV   ++  + + +   +FL   D+++   + AK++  TE+ ++ + +  GF +F+ 
Sbjct  272  GKVIVISYMMFEEAEGSNAAKFLYQMDLYMATKFVAKQR--TEKQFKSMAMDAGFSSFQL  329

Query  225  YYMDF-FLAVLEFHK  184
              + F  +AV+E HK
Sbjct  330  KCLVFNVVAVMELHK  344


 Score = 53.5 bits (127),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM+ +S   MK   + Y GF+GVT LVDVGG  G  L M++ K+ SI + IN++ P
Sbjct  160  AMTNLSKIIMKKILERYNGFQGVTTLVDVGGGYGVTLNMVISKYPSI-KGINYELP  214



>ref|XP_008376828.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   102 bits (255),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP   GV HVGGD+F S +P  DAIFMKS+   WSD+ C   + NCY AL   
Sbjct  232  LPHVIEDAPQFLGVEHVGGDMFAS-VPKGDAIFMKSICHDWSDDHCLKFLKNCYTALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  Y    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILAECILPVAPDSSLATQVVVNLDV-IMLGYNPGGKERTEKEFEALAKGSGFKGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F +  +EF K
Sbjct  350  ICSAFHIYAIEFLK  363


 Score = 53.1 bits (126),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NRGMAAQSTITMKKLLETYKGFEGLTSVVDVGGGTGAVVNMIVSKYPSI-KGINFDLP  233



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score =   102 bits (255),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKESGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F +  +EF K
Sbjct  350  VCSAFNIYAIEFLK  363


 Score = 53.1 bits (126),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   + Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKLLEIYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>gb|KJB73213.1| hypothetical protein B456_011G222800 [Gossypium raimondii]
Length=366

 Score =   102 bits (253),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 4/135 (3%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VVQ AP+ PG+ HVGGD+F S +P  D I MK VL  W DE C  ++ NCY AL + 
Sbjct  235  LPHVVQQAPSFPGIEHVGGDMF-STVPKADTIMMKEVLHNWDDEHCLKLLKNCYEALEEK  293

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV   ++  + + +   +F+   D+++   +  K++  TE+  + + +  GF +F+ 
Sbjct  294  GKVIVISFIMVEEAEASNAAKFISQLDLYMATQFGGKQR--TEKQLKSMAMDAGFSSFQL  351

Query  225  YYMDF-FLAVLEFHK  184
              + F  +AV+EF+K
Sbjct  352  KCLVFNVVAVMEFYK  366


 Score = 53.9 bits (128),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM+ +S   +K   + Y GF+GVT LVDVGG  G  L MI+ K+ SI + IN+D P
Sbjct  182  AMTNLSKVIVKKILERYNGFQGVTTLVDVGGGYGVTLNMIISKYPSI-KGINYDLP  236



>ref|XP_002893750.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70009.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score = 95.9 bits (237),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  +P  PG+ HV GD+F + IP  + IFMK +L +W DE C  I++NCY +L   
Sbjct  219  LPTVINTSPPSPGIEHVAGDMFIN-IPKGEVIFMKWMLHSWDDEHCVKILSNCYQSLPSN  277

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + V+P    DT   R L   ++F+MNM     K  T++ +  L    GF   + 
Sbjct  278  GKVIVVDMVIPEFPGDTLLDRSLFQFELFMMNM-NPSGKERTKKEFEILARLSGFSNVQV  336

Query  225  YYMDFFLAVLEFHK  184
             +     +V+EFHK
Sbjct  337  PFTSLCFSVVEFHK  350


 Score = 60.1 bits (144),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            Q +M G +  F++ F  +Y GF GV  LVDVGG  G  L  I+ KH  I +AINFD P
Sbjct  163  QSSMKGFNEVFIEEFLKNYNGFNGVKSLVDVGGGDGSLLSRILSKHTHIIKAINFDLP  220



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score =   104 bits (259),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +P  DAIF+K +   WSDE C   + NCY AL   
Sbjct  233  LPHVIQDAPAFPGVEHVGGDMFVS-VPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  ++ ++  D  IM  +    K  TE+ +R L  + GF+ F+ 
Sbjct  292  GKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPGGKERTEQEFRALAKAAGFQGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  351  VSSAFNTYIMEFLK  364


 Score = 51.6 bits (122),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MI+ K+ SI + INFD P
Sbjct  178  NNGMSSHSTITMKKILENYKGFEGLNSVVDVGGGIGATLNMIISKYPSI-KGINFDLP  234



>gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium]
Length=366

 Score =   104 bits (259),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +P  DAIF+K +   WSDE C   + NCY AL   
Sbjct  233  LPHVIQDAPAFPGVEHVGGDMFVS-VPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  ++ ++  D  IM  +    K  TE+ +R L  + GF+ F+ 
Sbjct  292  GKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPGGKERTEQEFRALAKAAGFQGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  351  VSSAFNTYIMEFLK  364


 Score = 51.2 bits (121),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MI+ K+ SI + INFD P
Sbjct  178  NNGMSSHSTITMKKILENYKGFEGLNSVVDVGGGIGATLNMIISKYPSI-KGINFDLP  234



>ref|XP_010520934.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=366

 Score =   105 bits (262),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 79/134 (59%), Gaps = 3/134 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VVQ+AP+ PGV+HVGGD+F + +P  DAIFMK +   W+DE+C  ++ NC  AL   
Sbjct  236  LPHVVQVAPSYPGVSHVGGDMFVT-VPKGDAIFMKWICHDWNDEQCLKLLKNCGEALPDN  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +   + +  +DI I+++   K +  TE+ +  L    GFR F+ 
Sbjct  295  GKVIVAEWILPTVPDSSLSAKIVSHTDIIILDVSTGKER--TEDEFEALAKGAGFRGFQV  352

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  353  VCNVFGTYIMEFLK  366


 Score = 50.1 bits (118),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AM   S   MK   ++Y+GF+G++ LVDVGG  G    MIV K+  I +A NFD P
Sbjct  181  NRAMLNASSITMKKILETYEGFEGLSSLVDVGGGIGAIANMIVSKYPDI-KATNFDLP  237



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score =   103 bits (256),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  LCCAFNSYVMEFLK  363


 Score = 52.4 bits (124),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  + MIV K+ +I + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINMIVSKYPTI-KGINFDLP  233



>gb|EYU31472.1| hypothetical protein MIMGU_mgv1a019059mg, partial [Erythranthe 
guttata]
Length=242

 Score =   103 bits (258),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP+ PGV H+GGD+F S +P  DAIFMK ++  WSDE+C  ++ NC+ +L + 
Sbjct  111  LPHVIQHAPSYPGVEHIGGDMFVS-VPKGDAIFMKWIVHDWSDEQCLKLLKNCHNSLQEN  169

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFK  229
            GK+I+ E ++P + D +  T+ +L SD+ ++      R+  TE+ +  L  + GFR F+
Sbjct  170  GKVILAELIMPEEPDKSVATKTVLHSDVLMLTHNPGGRER-TEKEFHTLAKAAGFREFR  227


 Score = 51.2 bits (121),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = -3

Query  751  KAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            +AMS  S   +K   + Y GF+G+  +VDVGG  G  L MI+ K+ SI + INFD P
Sbjct  57   QAMSNYSTIVVKKILEIYDGFEGIESVVDVGGGTGAILNMIISKYPSI-KGINFDLP  112



>gb|ABI54120.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   100 bits (249),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +   DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VSKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++ SD  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F    +EF K
Sbjct  350  VCSAFNTYAIEFLK  363


 Score = 55.1 bits (131),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMADNSTITMKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>ref|XP_006305218.1| hypothetical protein CARUB_v10009584mg [Capsella rubella]
 gb|EOA38116.1| hypothetical protein CARUB_v10009584mg [Capsella rubella]
Length=352

 Score = 93.6 bits (231),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 71/134 (53%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+      PG+ H+ GD+FT  IP  +AIFMK +L  W DE C  I+ NCY +L   
Sbjct  219  LPFVINTTSASPGIEHIAGDMFT-CIPKGEAIFMKWMLHGWDDEHCVKILTNCYQSLPSN  277

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + V+P    D+   R L   ++F+MNM     K  T++ +  L    GF   + 
Sbjct  278  GKVIVVDMVIPDLPGDSLLDRSLFQFELFMMNM-NPSGKERTKKEFEVLARLAGFSNVQV  336

Query  225  YYMDFFLAVLEFHK  184
             +     +V+EFHK
Sbjct  337  PFTSLCFSVVEFHK  350


 Score = 62.0 bits (149),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            Q +M G +  FM+ F  +Y GF GV  LVDVGG  G  L  I+ KH  I +AINFD P
Sbjct  163  QNSMKGFNEVFMEEFLKNYNGFNGVKSLVDVGGGDGSILSRIISKHPHIIKAINFDLP  220



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   105 bits (261),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  T++ +  L    GF+ FK 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAGFQGFKV  349

Query  225  YYMDFFLAVLEFHK  184
            +   F   ++EF K
Sbjct  350  HCNAFNTYIMEFLK  363


 Score = 50.1 bits (118),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  233



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   105 bits (261),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  T++ +  L    GF+ FK 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAGFQGFKV  349

Query  225  YYMDFFLAVLEFHK  184
            +   F   ++EF K
Sbjct  350  HCNAFNTYIMEFLK  363


 Score = 50.1 bits (118),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  233



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   103 bits (257),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFAS-VPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  VCCAFNTNIMEFLK  363


 Score = 51.6 bits (122),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+ +  LVDVGG  G  + MIV KH +I + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFESLKSLVDVGGGTGAVINMIVSKHPTI-KGINFDLP  233



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score =   101 bits (252),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSFPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MCCAFNTHVIEFRK  363


 Score = 53.5 bits (127),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score =   104 bits (260),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSDE C   + NCY AL + 
Sbjct  232  LPHVIEEAPSFPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDEHCVKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFRV  349

Query  225  YYMDFFLAVLEFHK*P  178
                F   ++EF K P
Sbjct  350  CCSAFNSYIMEFLKKP  365


 Score = 49.7 bits (117),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPSI-KGINFDLP  233



>ref|NP_174579.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAF31281.1|AC006424_10 CDS [Arabidopsis thaliana]
 gb|AAL58927.1|AF462839_1 At1g33030/F9L11_18 [Arabidopsis thaliana]
 gb|AAW80884.1| At1g33030 [Arabidopsis thaliana]
 gb|AEE31551.1| O-methyltransferase-like protein [Arabidopsis thaliana]
Length=352

 Score = 94.4 bits (233),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  +   PG+ HV GD+FT+  P  +AIFMK +L +W D+ C  I++NCY +L   
Sbjct  219  LPTVINTSLPSPGIEHVAGDMFTNT-PKGEAIFMKWMLHSWDDDHCVKILSNCYQSLPSN  277

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + V+P    DT   R L   ++F+MNM     K  T++ +  L    GF   + 
Sbjct  278  GKVIVVDMVIPEFPGDTLLDRSLFQFELFMMNM-NPSGKERTKKEFEILARLAGFSNVQV  336

Query  225  YYMDFFLAVLEFHK  184
             +     +VLEFHK
Sbjct  337  PFTSLCFSVLEFHK  350


 Score = 60.5 bits (145),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            Q +M G +  F++ F  +Y GF GV  LVDVGG  G  L  I+ KH  I +AINFD P
Sbjct  163  QSSMKGFNEVFIEEFLKNYNGFDGVKSLVDVGGGDGSLLSRIISKHTHIIKAINFDLP  220



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   107 bits (267),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP +PGV HVGGD+F S IP+ DAI MK ++  WSDE C  I+ NCY AL   
Sbjct  236  LPHVISEAPPLPGVEHVGGDMFAS-IPSGDAILMKWIMHDWSDEHCAKILENCYKALPNN  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            G++I+CE +LP+  +     + +   D+ IM  +    K  TE+ Y+ L    GF  FKA
Sbjct  295  GRVILCECILPVAPEPVPSAQGVFHLDM-IMLAHNPGGKERTEKEYQDLAKGAGFTGFKA  353

Query  225  YYMDFFLAVLEFHK  184
             Y      VLEF K
Sbjct  354  QYCFSTAWVLEFTK  367


 Score = 47.4 bits (111),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M   S+   K   +SY+GF+ +  LVDVGG  G  L MI  K+  I + INFD P
Sbjct  181  NEGMKNHSIVITKKLLESYKGFEDINVLVDVGGGIGATLHMITSKYPHI-KGINFDLP  237



>ref|XP_008357058.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=367

 Score = 99.8 bits (247),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAI MK +   WSDE C  ++ NC+AAL   
Sbjct  232  LPHVIKDAPQYPGVEHVGGDMFVS-VPKGDAIVMKHICHDWSDEHCLKLLKNCHAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E ++P+  D +  T+     D+ ++       K  TEE +  L    GF+ F+ 
Sbjct  291  GKVILVEIIIPVSPDSSLATKLANHIDVLML-ANNPGGKERTEEEFEALAKESGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MCSAFHSNVIEFLK  363


 Score = 55.1 bits (131),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAM+  S   MK   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NKAMADQSSIAMKKLLETYKGFEGLTSVVDVGGGIGSVIHMIVSKYPSI-KGINFDLP  233



>gb|AEW26161.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26162.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26169.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26170.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26174.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26179.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26180.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26183.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26184.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26185.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26188.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26189.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26190.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26192.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26193.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26194.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26195.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26196.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26197.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26198.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26199.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26202.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26203.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26204.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26207.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26208.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26214.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26217.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26219.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26220.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26227.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26228.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26229.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26230.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26239.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26241.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26242.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26245.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26246.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
Length=224

 Score =   105 bits (261),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY
Sbjct  85   KGINFDLPHVIEDAPSYPGVEHVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCY  143

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  T++ +  L    G
Sbjct  144  EALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAG  202

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ FK +   F   ++EF K
Sbjct  203  FQGFKVHCNAFNTYIMEFLK  222


 Score = 49.3 bits (116),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  36   NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  92



>gb|AEI54336.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Glycine 
max]
Length=365

 Score =   103 bits (257),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLTHNPGGKERTEKEFEALAKGSGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  LCCAFNTYVMEFLK  363


 Score = 50.8 bits (120),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+  LVDVGG  G  + MIV K+ +I + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLP  233



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score =   101 bits (251),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MCCAFNTHVIEFRK  363


 Score = 53.5 bits (127),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score =   100 bits (250),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MCCAFNTHVIEFRK  363


 Score = 53.9 bits (128),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   103 bits (257),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  LCCAFNTYVMEFLK  363


 Score = 50.8 bits (120),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+  LVDVGG  G  + MIV K+ +I + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLP  233



>ref|XP_008362842.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=253

 Score =   100 bits (250),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY
Sbjct  114  KGINFDLPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCY  172

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
            AAL   GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    G
Sbjct  173  AALPDNGKVIVAECILPVAPDSSLATKGVVHID-EIMLAHNPGGKERTEKEFEALAKGSG  231

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ F+     F    +EF K
Sbjct  232  FQGFRVVCSAFNTYAIEFLK  251


 Score = 53.5 bits (127),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  65   NKGMADHSTITMKKLLENYNGFEGLTCIVDVGGGTGAILNMIVSKYPSI-KGINFDLP  121



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 99.8 bits (247),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NC+AAL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCHAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDTSLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F    +EF K
Sbjct  350  VCSAFNTYAIEFLK  363


 Score = 54.7 bits (130),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLP  233



>gb|AEW26209.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
Length=224

 Score =   105 bits (261),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY
Sbjct  85   KGINFDLPHVIEDAPSYPGVEHVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCY  143

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  T++ +  L    G
Sbjct  144  EALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAG  202

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ FK +   F   ++EF K
Sbjct  203  FQGFKVHCNAFNTYIMEFLK  222


 Score = 48.9 bits (115),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  36   NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAXINTIVSKYPTI-KGINFDLP  92



>gb|AAC18863.1| caffeic acid 3-O-methyltransferase [Mesembryanthemum crystallinum]
Length=350

 Score =   102 bits (254),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HV GD+F S +P  DAIFMK +   WSDE C + + NCYAAL   
Sbjct  217  LPHVIEDAPAYPGVEHVEGDMFVS-VPKGDAIFMKWICHDWSDEHCLSFLKNCYAALPNH  275

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IVCE +LP+  + +   R +   D  IM  +    K  TE+ ++ L    GF  FK 
Sbjct  276  GKVIVCEYILPVAPETSHAARTVFHVDA-IMLAHNPGGKERTEQEFQALAKGSGFEGFKV  334

Query  225  YYMDFFLAVLEFHK  184
                +   V+EF K
Sbjct  335  ACSAYDTKVMEFLK  348


 Score = 52.0 bits (123),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -3

Query  745  MSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MS  S   MK   D YQGF+G++ LVDVGG       MI+ KH +I + INFD P
Sbjct  165  MSNHSTITMKKILDDYQGFEGLSTLVDVGGRHWGYPNMIISKHTTI-KGINFDLP  218



>gb|ADR31598.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   100 bits (250),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY
Sbjct  82   KGINFDLPHVIEDAPSYPGVXHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCY  140

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    G
Sbjct  141  DALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAG  199

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ F+     F   V+EF K
Sbjct  200  FQGFEVMCCAFNTHVIEFRK  219


 Score = 53.1 bits (126),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  33   NKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  89



>ref|XP_006420931.1| hypothetical protein CICLE_v10005230mg [Citrus clementina]
 gb|ESR34171.1| hypothetical protein CICLE_v10005230mg [Citrus clementina]
Length=363

 Score =   103 bits (257),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PG+ HVGGD+F S IP  +AIFMK +   WS+E C  I+ NCY AL + 
Sbjct  230  LPHVIQDAPAYPGIEHVGGDMFVS-IPKAEAIFMKWICHNWSEEACVKILKNCYEALPED  288

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LP+  D +  ++ ++  D F++  Y    +  TE+ ++ L  + GF+ FK 
Sbjct  289  GKVIVVDCILPVLPDTSLASKQVIQLDCFML-AYTIGGREMTEQDFKTLAKAAGFQGFKV  347

Query  225  YYMDFFLAVLEFHK*P  178
                F   ++EF K P
Sbjct  348  VCSAFNTYIMEFLKNP  363


 Score = 50.4 bits (119),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  721  MKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MK F ++Y+GF+G+  +VDVGG  G  L MI+ K+ SI + INFD P
Sbjct  186  MKKFLENYKGFEGLQSVVDVGGGIGASLDMIISKYPSI-KGINFDLP  231



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score =   103 bits (258),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  T++ +  L    GF+ FK 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKERTQKEFEDLAKGAGFQGFKV  349

Query  225  YYMDFFLAVLEFHK  184
            +   F   ++EF K
Sbjct  350  HCNAFNTYIMEFFK  363


 Score = 50.1 bits (118),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  233



>gb|ADR31595.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31596.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31601.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31605.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31606.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31608.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   100 bits (250),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY
Sbjct  82   KGINFDLPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCY  140

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    G
Sbjct  141  DALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAG  199

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ F+     F   V+EF K
Sbjct  200  FQGFEVMCCAFNTHVIEFRK  219


 Score = 53.5 bits (127),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  33   NKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  89



>gb|ADR31603.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=203

 Score =   100 bits (250),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY
Sbjct  65   KGINFDLPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCY  123

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    G
Sbjct  124  DALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAG  182

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ F+     F   V+EF K
Sbjct  183  FQGFEVMCCAFNTHVIEFRK  202


 Score = 53.1 bits (126),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  16   NKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  72



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score =   103 bits (256),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSDE C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDEHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  LCSAFNSYIMEFLK  363


 Score = 50.8 bits (120),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+  LVDVGG  G  + MIV K+ +I + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTGAIINMIVSKYPNI-KGINFDLP  233



>gb|AEW26163.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
Length=224

 Score =   104 bits (260),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY
Sbjct  85   KGINFDLPHVIEDAPSYPGVEHVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCY  143

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  T++ +  L    G
Sbjct  144  EALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLXKGAG  202

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ FK +   F   ++EF K
Sbjct  203  FQGFKVHCNAFNTYIMEFLK  222


 Score = 49.3 bits (116),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  36   NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  92



>gb|ADR31604.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=216

 Score =   100 bits (250),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY
Sbjct  78   KGINFDLPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCY  136

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    G
Sbjct  137  DALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAG  195

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ F+     F   V+EF K
Sbjct  196  FQGFEVMCCAFNTHVIEFRK  215


 Score = 53.1 bits (126),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  29   NKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  85



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PG+ HVGGD+F S +P  DAIFMK +   WSDE C   + NCY ALS+ 
Sbjct  230  LPHVIEDAPSHPGIEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCVKFLKNCYEALSED  288

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP   D +  T+ ++  D  ++  Y  K +  TE+ +  L  + GF+  K 
Sbjct  289  GKVILAECILPETPDSSLSTKQVVHVDCIMLAHYGGKER--TEKEFEALAKASGFKGIKV  346

Query  225  YYMDFFLAVLEFHK  184
                F + ++E  K
Sbjct  347  VCDAFGVNLIELLK  360


 Score = 54.3 bits (129),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   ++Y+GF+G+T LVDVGG  G  L+MIV K+ ++ + INFD P
Sbjct  175  NNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLP  231



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score =   101 bits (252),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSFPGVEHVGGDMFAS-VPKGDAIFMKWICHDWSDEHCLNFLKNCYDALPAN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVIHIDC-IMLAHNPGGKERTEKEFEALAKGAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MCCAFNSYVMEFLK  363


 Score = 52.4 bits (124),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+T +VDVGG  G  L MIV K+ SI +  NFD P
Sbjct  177  NRGMSDHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-KGTNFDLP  233



>ref|XP_003626614.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ABD32716.1| O-methyltransferase, family 2; Dimerisation [Medicago truncatula]
 gb|AES82832.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=375

 Score =   100 bits (250),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +P  DAIFMK +L  WSDE C  ++ NCY A+ + 
Sbjct  244  LPHVLQHAPVYPGVEHVGGDMFES-VPAGDAIFMKWILHDWSDEHCLKLLKNCYKAIPED  302

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LP+  + T   +    SD+ +M      ++  TE  +++L    GF   K 
Sbjct  303  GKVIVVDTILPVMPETTANAKTACMSDVLMMTQNPGGKER-TEHEFKELAKGSGFSAIKP  361

Query  225  YYMDFFLAVLEFHK  184
                  L V+EF K
Sbjct  362  ICCVSGLWVMEFFK  375


 Score = 53.1 bits (126),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAM   +   MK   D YQGF  +T+LVDVGG  G  L++I  K+  I Q INFD P
Sbjct  189  NKAMVNSTTINMKRIIDCYQGFDHITKLVDVGGGLGINLKLITSKYSHI-QGINFDLP  245



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score = 98.2 bits (243),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   +  CY AL   
Sbjct  232  LPHVIEDAPAYPGVEHVGGDMFES-VPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDS  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++  D  IM  +    K  TE+ +  L  S GF+ F+ 
Sbjct  291  GKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKERTEKEFEALARSAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  KCCAFGTYIMEFVK  363


 Score = 55.5 bits (132),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y GF+G+  LVDVGG  G  L MIV KH SI + INFD P
Sbjct  177  NRGMSDHSTITMKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLP  233



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score =   103 bits (257),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  T++ +  L    GF+ FK 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKERTQKEFEDLAKGAGFQGFKV  349

Query  225  YYMDFFLAVLEFHK  184
            +   F   ++EF K
Sbjct  350  HCNAFNTYIMEFLK  363


 Score = 50.1 bits (118),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  233



>sp|O23760.1|COMT1_CLABR RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase; Flags: Precursor [Clarkia breweri]
 gb|AAB71141.1| caffeic acid O-methyltransferase [Clarkia breweri]
Length=370

 Score =   105 bits (262),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL + 
Sbjct  237  LPHVIEDAPIYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPEH  295

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L +  GF+ FK 
Sbjct  296  GKVIVAECILPLSPDPSLATKGVIHIDA-IMLAHNPGGKERTEKEFEALAIGAGFKGFKV  354

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  355  ACCAFNTYVMEFLK  368


 Score = 48.1 bits (113),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   + Y GF+ +  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  182  NRGMSDHSTITMKKIFEMYTGFEALNTIVDVGGGTGAVLSMIVAKYPSI-KGINFDLP  238



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score = 98.2 bits (243),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   +  CY AL   
Sbjct  232  LPHVIEDAPAYPGVEHVGGDMFES-VPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDS  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++  D  IM  +    K  TE+ +  L  S GF+ F+ 
Sbjct  291  GKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKERTEKEFEALARSAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  KCCAFGTYIMEFVK  363


 Score = 55.5 bits (132),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y GF+G+  LVDVGG  G  L MIV KH SI + INFD P
Sbjct  177  NRGMSDHSTITMKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLP  233



>gb|AFK42771.1| unknown [Medicago truncatula]
Length=375

 Score =   100 bits (249),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +P  DAIFMK +L  WSDE C  ++ NCY A+ + 
Sbjct  244  LPHVLQHAPVYPGVEHVGGDMFES-VPAGDAIFMKWILHDWSDEHCLKLLKNCYKAIPED  302

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LP+  + T   +    SD+ +M      ++  TE  +++L    GF   K 
Sbjct  303  GKVIVVDTILPVMPETTANAKTACMSDVLMMTQNPGGKER-TEHEFKELAEGSGFSAIKP  361

Query  225  YYMDFFLAVLEFHK  184
                  L V+EF K
Sbjct  362  ICCVSGLWVMEFFK  375


 Score = 53.1 bits (126),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAM   +   MK   D YQGF  +T+LVDVGG  G  L++I  K+  I Q INFD P
Sbjct  189  NKAMVNSTTINMKRIIDCYQGFDHITKLVDVGGGLGINLKLITSKYSHI-QGINFDLP  245



>ref|XP_011084579.1| PREDICTED: LOW QUALITY PROTEIN: caffeic acid 3-O-methyltransferase-like 
[Sesamum indicum]
Length=347

 Score = 97.8 bits (242),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 71/134 (53%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP+ PGV H+GGD+F S +P  DAIFMK +   WSD  C+ ++ NCY AL   
Sbjct  216  LPHVIQDAPSFPGVEHIGGDMFVS-VPKADAIFMKWICHDWSDAHCQKLLKNCYDALPDN  274

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP   +     R    +D+ IM       K  TE  +  L    GFR  + 
Sbjct  275  GKMIIAEIILPEDQNSGPAFRRAAHADV-IMLAVNPGGKERTEMEFHALAQYAGFREVRK  333

Query  225  YYMDFFLAVLEFHK  184
                  + +LEFHK
Sbjct  334  VCCASSIWILEFHK  347


 Score = 55.8 bits (133),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AM   S  FMK   + Y+GF+GV  LVDVGG  G  LRMI+ K+ +I + INFD P
Sbjct  161  NQAMYEQSTIFMKQILEKYKGFEGVKSLVDVGGGIGASLRMILSKYPAI-KGINFDLP  217



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score =   100 bits (249),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  237  LPHVIEDAPTYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCAKFLKNCYDALPNN  295

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E  LP+  D +  ++ ++  D+ IM  +    K  T+E +  L    GF  F+ 
Sbjct  296  GKVIVAECNLPVAPDTSLASKNVIHIDV-IMLAHNPGGKERTKEEFEALAKGAGFEGFRV  354

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  355  MCSAFNTYVMEFLK  368


 Score = 53.1 bits (126),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   + YQGF+G+T LVDVGG  G  L MI  K+ +I + INFD P
Sbjct  182  NQGMSNHSTITMKKILEIYQGFEGLTSLVDVGGGTGATLHMIRSKYPTI-KGINFDLP  238



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   102 bits (255),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIGDAPSYPGVEHVGGDMFVS-VPEADAIFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  LCCAFNTYVMEFLK  363


 Score = 50.8 bits (120),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+  LVDVGG  G  + MIV K+ +I + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLP  233



>gb|KDP36008.1| hypothetical protein JCGZ_10407 [Jatropha curcas]
Length=365

 Score =   100 bits (249),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F +A P  DAIFMK +   WSDE C  ++ NCY A+   
Sbjct  232  LPHVIEDAPSFPGVEHVGGDMFVTA-PKGDAIFMKWICHDWSDEYCLKLLKNCYNAIPAN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  +M  +    K  TEE +  L    GF+ F+ 
Sbjct  291  GKVIVAEYILPVAPDTSLATKAVIHMDC-LMLAHLPGGKERTEEEFETLAKGAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ICSAFNTYVMEFLK  363


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   M+   ++Y+GF+G+T LVDVGG  G  L MIV K+ S+ + INFD P
Sbjct  177  NEGMSYHSTIIMRKILETYKGFEGLTSLVDVGGGIGAVLNMIVTKYPSM-KGINFDLP  233



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score =   104 bits (260),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+  GV HVGGD+F S IP  DA+FMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYQGVEHVGGDMFAS-IPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L  S GF+ FK 
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKSAGFQGFKV  349

Query  225  YYMDFFLAVLEFHK  184
            +   F   ++EF K
Sbjct  350  FCSAFNTYIMEFLK  363


 Score = 48.5 bits (114),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   + Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  177  NKGMSDHSTITMKKILEIYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  233



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVQHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ +M  +    K  TE+ +  L    GF+  + 
Sbjct  291  GKVILGECILPVAPDTSLATKGVVHIDV-VMLAHNPGGKERTEQEFEALAKGSGFQGIRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ACNAFNTYVIEFLK  363


 Score = 53.5 bits (127),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLP  233



>gb|KDP32876.1| hypothetical protein JCGZ_12168 [Jatropha curcas]
Length=361

 Score = 99.4 bits (246),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PGV HV GD+F S +P  DAIFMK +L  WSDE C  ++ NCY AL   
Sbjct  229  LPNVLADAPSFPGVEHVAGDMFVS-VPKGDAIFMKWILHGWSDEYCLKLLKNCYEALPSK  287

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  ++   +  +   D+F+       ++  T++ Y  L +  GF + + 
Sbjct  288  GKVIVAESILPLAPENAVSSHIVFEQDLFMFAQTPGGKER-TQKDYETLAIKSGFSSCEV  346

Query  225  YYMDFFLAVLEFHK  184
                +   V+EFHK
Sbjct  347  VCCAYNSWVMEFHK  360


 Score = 53.9 bits (128),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AMS  +  F+K   + Y GF GV  LVDVGG  GD LR+I  K+  I + INFD P
Sbjct  174  NEAMSNHTTLFVKKIIEVYDGFDGVKVLVDVGGGIGDALRIITSKYPHI-KGINFDLP  230



>gb|KJB52492.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=387

 Score = 98.6 bits (244),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  254  LPHVIEDAPSCPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCAKFLKNCYEALPDN  312

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++  D  +M  +    K  T + ++ L    GF+ F+ 
Sbjct  313  GKVIVAECILPDYPDPSLATKLVVHIDC-VMLAHNPGGKERTAKEFKALATGAGFQGFQI  371

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  372  KCSAFGTNIMEFLK  385


 Score = 54.7 bits (130),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   D+Y GF+G+  LVDVGG  G  L MIV K+ +I + INFD P
Sbjct  199  NKGMSDHSTITMKKILDTYDGFQGLKTLVDVGGGTGATLSMIVSKYPTI-KGINFDLP  255



>ref|XP_006477839.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=363

 Score =   101 bits (252),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 77/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q  P  PG+ HVGGD+F S IP  D IFMK +   WS+E C  I+ NCY AL + 
Sbjct  230  LPHVIQDGPAYPGIEHVGGDMFVS-IPKADVIFMKWICHNWSEEACVKILKNCYEALPEN  288

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  ++ ++  D  IM  +    +  TE+ ++ L  + GF+ FK 
Sbjct  289  GKVIVAECILPVLPDPSLASKQVIHIDC-IMLAHTTGGREMTEQDFKTLAKAAGFQGFKV  347

Query  225  YYMDFFLAVLEFHK*P  178
                F   ++EF K P
Sbjct  348  VCSAFSTYIMEFLKKP  363


 Score = 51.6 bits (122),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  721  MKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MK F ++Y+GF+G+  +VDVGG  G  L MI+ K+ SI + INFD P
Sbjct  186  MKKFLENYKGFEGLKSVVDVGGGIGASLNMIISKYPSI-KGINFDLP  231



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score =   105 bits (263),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +PN DAI +K +L  WSDE C  ++ NC+ ++ +G
Sbjct  301  LPHVIQHAPEYPGVKHVGGDMFQS-VPNGDAILIKWILHDWSDEHCLKLLKNCHKSIHEG  359

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLIV E VLP   + +  ++     D+ +M  Y   ++  T+  +  L    GF   + 
Sbjct  360  GKLIVVESVLPELPETSTHSKINFLGDVLVMTQYPGGKER-TKHEFMTLATGAGFSGVRF  418

Query  225  YYMDFFLAVLEFHK  184
                F L V+EFHK
Sbjct  419  DCFFFNLWVMEFHK  432


 Score = 47.4 bits (111),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM   +   ++   ++Y+GF+ + +LVDVGGS G+ L+ I+ K+  I + INFD P
Sbjct  248  AMYNHTTLVIQKILEAYKGFEHIKQLVDVGGSLGNTLKAIISKYPHI-KGINFDLP  302



>ref|XP_003634161.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=364

 Score = 97.4 bits (241),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PGV +VGGD+F S +P  DAIFMK +   WSD  C   + NCY AL   
Sbjct  231  LPHVIDDAPSYPGVENVGGDMFVS-VPKGDAIFMKWICHDWSDAHCLKFLKNCYQALPDN  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ FK 
Sbjct  290  GKVIVAECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFKV  348

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  349  VCCAFNTWIMEFCK  362


 Score = 55.5 bits (132),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MSG S   MK   ++Y+GF+G+T +VDVGG  G  L MI+ K+ +I + INFD P
Sbjct  176  NNGMSGHSTITMKKILEAYKGFEGLTSIVDVGGGTGATLNMIISKYPTI-KGINFDLP  232



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score = 98.6 bits (244),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   +  CY AL   
Sbjct  232  LPHVIEDAPAYPGVEHVGGDMFES-VPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++  D  IM  +    K  TE+ +  L  S GF+ F+ 
Sbjct  291  GKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKERTEKEFEALARSAGFQGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  KCCAFGTYIMEFLK  363


 Score = 54.7 bits (130),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y GF+G+  LVDVGG  G  L M+V KH SI + INFD P
Sbjct  177  NRGMSDHSTITMKKILETYDGFEGLKTLVDVGGGTGATLNMLVTKHPSI-KGINFDLP  233



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score =   102 bits (254),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDEHCLKFLKNCYEALPNN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F  
Sbjct  291  GKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFHV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  LCCAFNTYIMEFLK  363


 Score = 50.4 bits (119),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   + Y GF+G+  LVDVGG  G  + MIV K+ +I + INFD P
Sbjct  177  NKGMSDHSTITMKKILELYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLP  233



>gb|KDP32878.1| hypothetical protein JCGZ_12170 [Jatropha curcas]
Length=367

 Score = 99.4 bits (246),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PGV HV GD+F S +P  DAIFMK +L  WSDE C  ++ NCY AL   
Sbjct  235  LPNVLADAPSFPGVEHVAGDMFVS-VPKGDAIFMKWILHGWSDEYCLKLLKNCYEALPSK  293

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  ++   +  +   D+F+       ++  T++ Y  L +  GF + + 
Sbjct  294  GKVIVAESILPLAPENAVSSHIVFEQDLFMFAQTPGGKER-TQKDYETLAIKSGFSSCEV  352

Query  225  YYMDFFLAVLEFHK  184
                +   V+EFHK
Sbjct  353  VCCAYNSWVMEFHK  366


 Score = 53.9 bits (128),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AMS  +  F+K   + Y GF GV  LVDVGG  GD LR+I  K+  I + INFD P
Sbjct  180  NEAMSNHTTLFVKKIIEVYDGFDGVKVLVDVGGGIGDALRIITSKYPHI-KGINFDLP  236



>ref|XP_009361274.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=367

 Score =   100 bits (249),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAI MK +   WSDE C  ++ NCYAAL   
Sbjct  232  LPHVIKDAPQYPGVEHVGGDMFVS-VPKGDAIVMKHICHDWSDEHCLKLLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E ++P+  D +  T+     D+ IM       K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVEIIIPVSPDSSLATKLANHVDV-IMLANNPGGKERTEDEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MSSAFDGNVIEFLK  363


 Score = 52.4 bits (124),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AM+  S   MK   ++Y+GF+G+T +VDVGG  G    MIV K+ SI + INFD P
Sbjct  177  NRAMADHSSIAMKKLLETYKGFEGLTSVVDVGGGIGSVSHMIVSKYPSI-KGINFDLP  233



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score = 98.6 bits (244),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY AL   
Sbjct  230  LPHVIEDAPSYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDDHCLKFLKNCYDALPHN  288

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D    T+ ++  D+ IM  +    K  T++ +  L    GF  F+ 
Sbjct  289  GKVIIAECILPVAPDTKLATKNVVHIDV-IMLAHNPGGKERTQKEFEALAKGAGFAGFRV  347

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  348  MCCAFNTYVMEFLK  361


 Score = 54.3 bits (129),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   D Y GF G+T +VDVGG  G  L MIV KH +I + INFD P
Sbjct  175  NQGMSNHSTITMKKILDIYGGFDGLTTVVDVGGGTGATLNMIVSKHPTI-KGINFDLP  231



>ref|XP_004494877.1| PREDICTED: anthranilate N-methyltransferase-like [Cicer arietinum]
Length=371

 Score =   102 bits (253),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV+ AP  PGV HVGGD+F S +P+ DAIFMK +L  WSDE C  ++ NCY A+ + 
Sbjct  240  LPHVVEHAPLYPGVDHVGGDMFES-VPSGDAIFMKWILHDWSDEHCLKVLKNCYKAIPED  298

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LPI  + T   +    SD+ +M      ++  TE+ + +L    GF   K 
Sbjct  299  GKVIVVDSILPITAETTTSAKSAFMSDLLMMTQNPGGKER-TEQEFMELAKGSGFSGIKF  357

Query  225  YYMDFFLAVLEFHK  184
                  L V+EF+K
Sbjct  358  VCCVSGLWVMEFYK  371


 Score = 50.8 bits (120),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAM   +   MK   + Y+GF  VT+LVDVGG  G  L++I  K+  I Q INFD P
Sbjct  185  NKAMVNSTTINMKGILNCYKGFDHVTKLVDVGGGLGINLKLITSKYSHI-QGINFDLP  241



>gb|AGO50639.1| caffeic acid O-methyltransferase [Linum usitatissimum]
Length=367

 Score =   101 bits (252),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP +PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NC+ AL   
Sbjct  233  LPHVIEDAPALPGVQHVGGDMFAS-VPTGDAIFMKWICHDWSDQHCLKFLKNCFDALPAN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IVCE ++P+  D +  TR ++  D  IM  +    K  T+  +  L    GF+ F+ 
Sbjct  292  GKVIVCECIMPVAPDTSLATRNVVHIDC-IMLAHNPGGKERTQAEFESLAKGAGFQGFRV  350

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  351  VCSAFNTYVMEFLK  364


 Score = 51.2 bits (121),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF  +  LVDVGG  G  L MI+ KH SI + INFD P
Sbjct  178  NKGMSDHSTITMKKILETYTGFDVLKSLVDVGGGTGAVLSMILSKHPSI-KGINFDLP  234



>ref|XP_008382714.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=229

 Score = 99.8 bits (247),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY
Sbjct  90   KGINFDLPYVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCY  148

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
            +AL   GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    G
Sbjct  149  SALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGSG  207

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ F+     F    +EF K
Sbjct  208  FQGFRVVCSAFNTYAIEFLK  227


 Score = 53.1 bits (126),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  41   NKGMANHSTITMKNLLENYNGFEGLTSIVDVGGGTGIVLNMIVFKYPSI-KGINFDLP  97



>ref|XP_003528760.1| PREDICTED: anthranilate N-methyltransferase [Glycine max]
Length=372

 Score =   100 bits (250),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PG+ HVGGD+F S +PN DAIFMK +L  WSDE+C  ++ NC+ A+   
Sbjct  241  LPHVIEHAPTYPGIEHVGGDMFES-VPNGDAIFMKWILHDWSDEQCLKLLKNCHKAIPSD  299

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LPI  + T   +    +D+ +M    +  K  T+  + +L LS GF   K 
Sbjct  300  GKVIVVDLILPILPESTVTAKSGFQADLLMMTQ-NSGGKERTQHEFMELALSSGFSGIKI  358

Query  225  YYMDFFLAVLEFHK  184
                    V+EF+K
Sbjct  359  VCSVSGFWVMEFYK  372


 Score = 51.6 bits (122),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAM  ++   MK   + Y+GFK + RLVDVGG  G  L +I  K+  + Q +NFD P
Sbjct  186  NKAMFNLTTIVMKRVLEFYEGFKNINRLVDVGGGLGINLNLITSKYPHV-QGVNFDLP  242



>ref|XP_010527383.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=364

 Score =   100 bits (249),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 3/134 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PG+ HVGGD+F S +P  DAIF+K +   W+DE+C  ++ NCY +L   
Sbjct  232  LPHVIDGAPSYPGIEHVGGDMFAS-VPTGDAIFLKGITHDWNDEQCVKLLKNCYESLPDS  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  + +   R ++  D +++ +   K +  TE+ +R L    GF+ F+ 
Sbjct  291  GKVILAEWILPVVPNPSASNRLVVDIDCYMLALDPGKER--TEDEFRALAEGAGFQGFQV  348

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  349  VCKAFTHHIIEFLK  362


 Score = 52.0 bits (123),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               +S  S   +K   ++Y+GF+G+T +VDVGG  G  L MIV KH +I + INFD P
Sbjct  177  NSGLSSHSSIVVKKIVETYKGFEGLTTVVDVGGGTGATLNMIVSKHPNI-KGINFDLP  233



>gb|KHN06374.1| Anthranilate N-methyltransferase [Glycine soja]
Length=372

 Score =   100 bits (250),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PG+ HVGGD+F S +PN DAIFMK +L  WSDE+C  ++ NC+ A+   
Sbjct  241  LPHVIEHAPTYPGIEHVGGDMFES-VPNGDAIFMKWILHDWSDEQCLKLLKNCHKAIPSD  299

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LPI  + T   +    +D+ +M    +  K  T+  + +L LS GF   K 
Sbjct  300  GKVIVVDLILPILPESTVTAKSGFQADLLMMTQ-NSGGKERTQHEFMELALSSGFSGIKI  358

Query  225  YYMDFFLAVLEFHK  184
                    V+EF+K
Sbjct  359  VCSVSGFWVMEFYK  372


 Score = 51.6 bits (122),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAM  ++   MK   + Y+GFK + RLVDVGG  G  L +I  K+  + Q +NFD P
Sbjct  186  NKAMFNLTTIVMKRVLEFYEGFKNINRLVDVGGGLGINLNLITSKYPHV-QGVNFDLP  242



>sp|Q42653.1|OMT2_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 2; AltName: Full=Flavonol 
3-O-methyltransferase 2 [Chrysosplenium americanum]
 gb|AAA86982.1| caffeic acid O-methyl transferase [Chrysosplenium americanum]
Length=343

 Score = 98.6 bits (244),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PG+ HVGGD+F S +P  DAIFMK +   WSDE C  ++ NCY AL   
Sbjct  208  LPHVIEDAPEYPGIEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNN  266

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP   D +  T+ ++  D+ I   +    K  TE+ +  L  + GF+ F+ 
Sbjct  267  GKVILAECILPEVPDSSLATKGVVHIDV-ITVAHNPGGKERTEKEFEALAKAAGFQGFQV  325

Query  225  YYMDFFLAVLEFHK  184
            +   F   ++EF K
Sbjct  326  FCNAFNTYIIEFSK  339


 Score = 53.5 bits (127),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK    +YQGF+G+T LVDVGG  G  L MI+ K+ +I + INFD P
Sbjct  153  NRGMSDHSTITMKKVFQTYQGFQGLTSLVDVGGGTGATLTMILSKYPTI-RCINFDLP  209



>ref|XP_008803441.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Phoenix dactylifera]
Length=362

 Score =   101 bits (251),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP IPGV HVGGD+F+S IP  DAIFMK +L  WSDE C  I+ NC+ AL   
Sbjct  231  LPHVISEAPVIPGVVHVGGDMFSS-IPRADAIFMKWILHDWSDEHCLNILKNCWKALPDN  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   +    T+    +D+ ++  Y    K  T++ +  L    GF  FKA
Sbjct  290  GKVIVAECLLPEAPETNAETQIRYYADLAMLT-YNIGGKERTKKEFESLAKEAGFSRFKA  348

Query  225  YYMDFFLAVLEFHK  184
                  + V+EF K
Sbjct  349  ECCVLNIWVMEFLK  362


 Score = 51.2 bits (121),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  +  F+K   D+Y+GF+G+  LVDVGG  G  L MI  K+  I + INFD P
Sbjct  176  NQGMANHATLFVKKMLDTYEGFEGLKDLVDVGGGLGATLHMIASKYPHI-KGINFDLP  232



>ref|XP_008803442.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Phoenix dactylifera]
Length=330

 Score =   101 bits (251),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP IPGV HVGGD+F+S IP  DAIFMK +L  WSDE C  I+ NC+ AL   
Sbjct  199  LPHVISEAPVIPGVVHVGGDMFSS-IPRADAIFMKWILHDWSDEHCLNILKNCWKALPDN  257

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   +    T+    +D+ ++  Y    K  T++ +  L    GF  FKA
Sbjct  258  GKVIVAECLLPEAPETNAETQIRYYADLAMLT-YNIGGKERTKKEFESLAKEAGFSRFKA  316

Query  225  YYMDFFLAVLEFHK  184
                  + V+EF K
Sbjct  317  ECCVLNIWVMEFLK  330


 Score = 51.2 bits (121),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  +  F+K   D+Y+GF+G+  LVDVGG  G  L MI  K+  I + INFD P
Sbjct  144  NQGMANHATLFVKKMLDTYEGFEGLKDLVDVGGGLGATLHMIASKYPHI-KGINFDLP  200



>sp|P59049.1|OMT1_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 1; AltName: Full=Flavonol 
3-O-methyltransferase 1 [Chrysosplenium americanum]
Length=343

 Score = 98.6 bits (244),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PG+ HVGGD+F S +P  DAIFMK +   WSDE C  ++ NCY AL   
Sbjct  208  LPHVIEDAPEYPGIEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNN  266

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP   D +  T+ ++  D+ I   +    K  TE+ +  L  + GF+ F+ 
Sbjct  267  GKVILAECILPEVPDSSLATKGVVHIDV-ITVAHNPGGKERTEKEFEALAKAAGFQGFQV  325

Query  225  YYMDFFLAVLEFHK  184
            +   F   ++EF K
Sbjct  326  FCNAFNTYIIEFSK  339


 Score = 53.5 bits (127),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK    +YQGF+G+T LVDVGG  G  L MI+ K+ +I + INFD P
Sbjct  153  NRGMSDHSTITMKKVFQAYQGFQGLTSLVDVGGGTGATLTMILSKYPTI-RCINFDLP  209



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score = 98.6 bits (244),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+E  K
Sbjct  350  MCCAFNTHVIELRK  363


 Score = 53.5 bits (127),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>prf||1906376A O-methyltransferase
Length=364

 Score = 98.6 bits (244),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+E  K
Sbjct  350  MCCAFNTHVIELRK  363


 Score = 53.5 bits (127),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score = 99.0 bits (245),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+E  K
Sbjct  350  MCCAFNTHVIELRK  363


 Score = 53.1 bits (126),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVSTIVSKYPSI-KGINFDLP  233



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score =   102 bits (254),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV+ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C + + NCY AL Q 
Sbjct  234  LPHVVEDAPAYPGVEHVGGDMFVS-VPEGDAIFMKWICHDWSDEHCLSFLKNCYKALPQN  292

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP   D    T+ ++  D+ IM  +    K  TE+ +  LG   GF++F  
Sbjct  293  GKVILAECILPEAPDSKLTTKNVIHIDV-IMLAHNPGGKERTEKEFEALGKEAGFKSFNK  351

Query  225  YYMDFFLAVLEFHK  184
                +   V+E+ K
Sbjct  352  ACCAYNTWVIEYLK  365


 Score = 49.7 bits (117),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -3

Query  745  MSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MS  S   MK   ++Y GF G+  +VDVGG  G  L MI  K+ SI + INFD P
Sbjct  182  MSNHSTITMKKILETYNGFAGLKTVVDVGGGTGATLHMITSKYPSI-KGINFDLP  235



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score = 99.4 bits (246),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 74/140 (53%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY
Sbjct  226  KDINFDLPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCY  284

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL   GK+IV E + P+  D +  T+ ++  D  IM  +    K  TE+ +  L    G
Sbjct  285  VALPDNGKVIVAECIFPVAPDSSLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGFG  343

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ F+     F    +EF K
Sbjct  344  FQGFRVVCCAFNTYAIEFFK  363


 Score = 52.4 bits (124),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   + Y GF+G+T +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKLLEIYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KDINFDLP  233



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score = 98.2 bits (243),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   +N CY AL   
Sbjct  232  LPHVIEDAPAYPGVEHVGGDMFES-VPKGDAIFMKWICHDWSDEHCSKFLNKCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++  D  IM  +    K  T++ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPDYPDASLATKLVVHIDC-IMLAHNPGGKERTQKEFEALAKGAGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  KCCAFGTYIMEFLK  363


 Score = 53.9 bits (128),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y GF G+  LVDVGG  G  + MIV KH SI + INFD P
Sbjct  177  NRGMSDHSTITMKKILETYDGFDGLKTLVDVGGGTGATINMIVSKHPSI-KGINFDLP  233



>ref|XP_010461123.1| PREDICTED: quercetin 3-O-methyltransferase 1 [Camelina sativa]
Length=362

 Score = 90.5 bits (223),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  +   PG+ ++ G++FT+ IP  +AIFMK +L +W +E C  I+ NCY +L   
Sbjct  229  LPFVINTSSASPGIENIAGEMFTN-IPKGEAIFMKWMLHSWDNEHCLKILTNCYQSLPSN  287

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + V+P    DT   R L   ++F+MNM     K  T++ +  L    GF + + 
Sbjct  288  GKVIVVDMVIPDLPGDTLLDRSLFQFELFMMNM-NPSGKERTKKEFETLARLAGFSSVQV  346

Query  225  YYMDFFLAVLEFHK  184
             +     +V+EFHK
Sbjct  347  PFTSLCFSVVEFHK  360


 Score = 60.8 bits (146),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            Q +M G +  FM+ F  +Y GF GV  LVDVGG  G  L  I+ KH  I +A+NFD P
Sbjct  173  QSSMKGFNEVFMEEFLKNYNGFDGVKSLVDVGGGDGSILSRIISKHPHIIKAVNFDLP  230



>gb|KDP35860.1| hypothetical protein JCGZ_10599 [Jatropha curcas]
Length=365

 Score = 96.3 bits (238),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HV GD+F + +P  DAIFMK +   WSDE C   + NC  AL   
Sbjct  232  LPHVIEDAPSYPGVEHVSGDMFVT-VPKADAIFMKWICHNWSDEHCLKFLKNCCDALPVN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GKLIV + +LP+  D +  T+ ++  D  ++ ++   ++  TE  +  L    GF+ F+ 
Sbjct  291  GKLIVADYILPVAPDTSLATKGVIHMDCIMLALHSGGKER-TENEFEALAKGAGFKGFQV  349

Query  225  YYMDFFLAVLEFHK  184
                F  +V+EF K
Sbjct  350  TCSAFNTSVMEFIK  363


 Score = 55.5 bits (132),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S+  MK   ++Y+GF+G+T L DVGG  G  + MIV K+ S+ + INFD P
Sbjct  177  NKGMSNHSIVTMKKILETYKGFEGLTSLADVGGGTGAVINMIVSKYPSL-KGINFDLP  233



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score = 98.2 bits (243),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDVHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+E  K
Sbjct  350  MCCAFNTHVIELRK  363


 Score = 53.5 bits (127),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score = 97.8 bits (242),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  254  LPHVIEDAPSCPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCAKFLKNCYEALPDN  312

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP   D +  T+ ++  D  IM  +    K  T + +  L    GF+ F+ 
Sbjct  313  GKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKERTAKEFEALAKGAGFQGFQI  371

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  372  TCSAFGTNIMEFLK  385


 Score = 53.5 bits (127),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   D+Y GF+G+  LVDVGG  G  L MIV K+ +I + INFD P
Sbjct  199  NRGMSDHSTITMKKILDTYDGFQGLKTLVDVGGGTGATLSMIVSKYPTI-KGINFDLP  255



>dbj|BAO79385.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=359

 Score = 99.4 bits (246),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (59%), Gaps = 4/135 (3%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV  AP+ PGV HVGGD+F S +PN DAIF+K V   WSDE+C +I+ NCY AL+ G
Sbjct  228  LPHVVGDAPSRPGVEHVGGDMFAS-LPNGDAIFLKLVCHNWSDEDCLSILKNCYRALADG  286

Query  405  GKLIVCEPVLP-IQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFK  229
             K+I+ E +LP +  D+   T+ ++  D  ++  +  K +  +E+ +  L  S GFR   
Sbjct  287  KKVIIAECLLPEVPGDNGDATKCVVNLDAIMLAHHCGKER--SEKEFEALATSAGFRVSP  344

Query  228  AYYMDFFLAVLEFHK  184
                 F   ++EF K
Sbjct  345  NVCCAFNTWIMEFSK  359


 Score = 52.0 bits (123),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y GF+G+T +VDVGG  G  L MI+ K+ +I + INFD P
Sbjct  173  NQCMTSNSSIIMKKILETYNGFEGLTSIVDVGGGRGAALSMIISKYPTI-KGINFDLP  229



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score = 97.8 bits (242),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVQHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  T + +  L    GF+  + 
Sbjct  291  GKVILGECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTGQEFEALAKGSGFQGIRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ACNAFNTYVIEFLK  363


 Score = 53.5 bits (127),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLP  233



>ref|XP_008382917.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Malus 
domestica]
Length=230

 Score = 94.4 bits (233),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV H+GGD+F + +P  DAIFMK V   WSDE C  I+ NCYAAL   
Sbjct  97   LPHVIKDAPQYPGVEHIGGDMFGT-VPKGDAIFMKCVCHDWSDEHCLKILKNCYAALPDN  155

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +L +       T+     D+ ++    + R+  TEE +  L    GF+ F+ 
Sbjct  156  GKVILAECILQVAPTSNLATKVXAHHDLIMLTNSPSGRER-TEEEFEVLAKGSGFQGFRV  214

Query  225  YYMDFFLAVLEFHK  184
                F   V+E  K
Sbjct  215  MCPAFNTYVIELLK  228


 Score = 56.6 bits (135),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AM+ IS   MK   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  42   NRAMADISTITMKKILETYKGFEGLTSVVDVGGGTGAVINMIVSKYPSI-KGINFDLP  98



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score = 99.8 bits (247),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV +VGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDAPSYPGVEYVGGDMFAS-VPKADAIFMKWICHDWSDEHCLKFLKNCYQALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAQCILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  350  VCCAFNTNIMEFLK  363


 Score = 51.2 bits (121),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF+ +  LVDVGG  G  + MIV KH +I + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFESLKSLVDVGGGTGAVINMIVSKHPTI-KGINFDLP  233



>ref|XP_006442372.1| hypothetical protein CICLE_v10020761mg [Citrus clementina]
 gb|ESR55612.1| hypothetical protein CICLE_v10020761mg [Citrus clementina]
Length=363

 Score =   101 bits (251),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PG+ HV GD+F S IP  DAIFMK +   WS+E C  I+ NCY AL + 
Sbjct  230  LPHVIQDAPAYPGIEHVAGDMFVS-IPKGDAIFMKWICHNWSEEACVKILKNCYEALPED  288

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LP+  D +  ++ ++  D  ++      R+  TE+ ++ L  + GF+ FK 
Sbjct  289  GKVIVADCILPVLPDTSLASKHVIQLDCIMLTTTSGGRE-MTEQDFKTLAKAAGFQGFKV  347

Query  225  YYMDFFLAVLEFHK*P  178
                F   ++EF K P
Sbjct  348  VCSAFNTYIMEFLKKP  363


 Score = 49.7 bits (117),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  721  MKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            MK F ++Y+GF+G+  +VDVGG  G  L +I+ K+ SI + INFD P
Sbjct  186  MKKFLENYKGFEGLKSVVDVGGGIGASLNIIISKYPSI-KGINFDLP  231



>ref|XP_006441596.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
 gb|ESR54836.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
Length=352

 Score =   103 bits (258),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F S +PN DAI +K +L  WSDE C  ++ NC+ ++ +G
Sbjct  221  LPHVIQHAPEYPGVKHVGGDMFRS-VPNGDAILIKWILHDWSDEHCLKLLKNCHKSIPEG  279

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP   + +  ++     D+ +M  Y   ++  T+  +  L    GF   + 
Sbjct  280  GKVIVVESVLPELPETSTHSKINFLGDVLVMTQYPGGKER-TKHEFMTLATGAGFSGVRF  338

Query  225  YYMDFFLAVLEFHK  184
                F L V+EFHK
Sbjct  339  DCFFFNLWVMEFHK  352


 Score = 47.0 bits (110),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM   +   ++   ++Y+GF+ + +LVDVGGS G+ L+ I+ K+  I + INFD P
Sbjct  168  AMYNHTTLVIQKILEAYKGFEHIKQLVDVGGSLGNTLKAIISKYPHI-KGINFDLP  222



>gb|AEW26176.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
Length=224

 Score =   101 bits (252),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  603  KQLTSIFPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCY  424
            K +    P V++ AP+ PGV  VGGD+F S IP  DA+FMK +   WSDE C   + NCY
Sbjct  85   KGINFDLPHVIEDAPSYPGVEXVGGDMFVS-IPKADAVFMKWICHDWSDEHCLKFLKNCY  143

Query  423  AALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVG  244
             AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  T++ +  L    G
Sbjct  144  EALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAG  202

Query  243  FRTFKAYYMDFFLAVLEFHK  184
            F+ FK +   F   ++EF K
Sbjct  203  FQGFKVHCNAFNTYIMEFLK  222


 Score = 49.7 bits (117),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y GF+G+  LVDVGG  G  +  IV K+ +I + INFD P
Sbjct  36   NKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLP  92



>gb|ADB82906.1| caffeic O-methyltransferase1 [Eucalyptus camaldulensis]
Length=366

 Score =   100 bits (249),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP +PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY AL   
Sbjct  233  LPHVIEDAPPLPGVKHVGGDMFVS-VPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP+  D +  T+ ++  D  IM  +    K  T++ +  L    GF+ F+ 
Sbjct  292  GKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKERTQKEFEALAKGAGFQGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  351  MCCAFGTHVMEFLK  364


 Score = 50.4 bits (119),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ S+ + INFD P
Sbjct  178  NRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLP  234



>ref|XP_009361272.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=365

 Score =   100 bits (248),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSD+ C  I+ NCY AL   
Sbjct  232  LPHVIEDAPQYPGVEHVGGDMFVS-VPKGDAIFMKFICHDWSDDHCLKILKNCYTALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+    +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILAECILPVAPASSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFKGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ICSAFNTYVIEFLK  363


 Score = 50.8 bits (120),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -3

Query  745  MSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M+  S   MK   ++Y+GF+G++ +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  180  MAAHSTITMKKLLETYKGFEGLSSVVDVGGGIGAVINMIVSKYPSI-KGINFDLP  233



>ref|XP_011003285.1| PREDICTED: caffeic acid 3-O-methyltransferase 3 [Populus euphratica]
Length=364

 Score =   100 bits (248),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV +VGGD+F S +P  DA+FMK +   WSDE C   + NCY AL + 
Sbjct  231  LPHVIADAPAFPGVENVGGDMFVS-VPKADAVFMKWICHDWSDEHCLRFLKNCYDALPEN  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  290  GKVILVECILPVAPDTSLATKGVMHVDV-IMMAHNPGGKERTEKEFEGLARGAGFKGFEV  348

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  349  MCCAFNTYVIEFRK  362


 Score = 50.8 bits (120),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+  LVDVGG  G  L  I+ K+ SI + INFD P
Sbjct  176  NKGMSDHSKIAMKKILETYKGFEGLASLVDVGGGTGAVLSTIISKYPSI-KGINFDLP  232



>gb|ACY66932.1| caffeic O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=366

 Score =   100 bits (249),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP +PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY AL   
Sbjct  233  LPHVIEDAPPLPGVKHVGGDMFVS-VPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP+  D +  T+ ++  D  IM  +    K  T++ +  L    GF+ F+ 
Sbjct  292  GKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKERTQKEFETLAKGAGFQGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  351  MCCAFGTHVMEFLK  364


 Score = 50.4 bits (119),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ S+ + INFD P
Sbjct  178  NRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLP  234



>ref|XP_009608171.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana tomentosiformis]
Length=363

 Score = 97.1 bits (240),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIGDAPAYPGVEHVGGDMFAS-VPKADAIFMKWICHDWSDEHCLKFLKNCYEALPAN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP   D +  T+  +  DI +M  +    K  TE+ +  L    GF  F+ 
Sbjct  291  GKVIIAECILPEAPDTSLATKNTVHVDI-VMLAHNPGGKERTEKEFEALAKGAGFTGFRK  349

Query  225  YYMDFFLAVLEFHK  184
                +   V+EF+K
Sbjct  350  ACCAYNTWVMEFNK  363


 Score = 53.9 bits (128),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   + Y+GF+G+  +VDVGG  G  + MIV KH SI + INFD P
Sbjct  177  NRGMSDHSTMSMKKILEDYKGFEGLNSIVDVGGGTGATVNMIVSKHPSI-KGINFDLP  233



>ref|XP_010048429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score =   100 bits (248),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP +PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY AL   
Sbjct  233  LPHVIEDAPPLPGVKHVGGDMFVS-VPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP+  D +  T+ ++  D  IM  +    K  T++ +  L    GF+ F+ 
Sbjct  292  GKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKERTQKEFEALAKGAGFQGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  351  MCCAFGTHVMEFLK  364


 Score = 50.4 bits (119),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ S+ + INFD P
Sbjct  178  NRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLP  234



>gb|KCW89068.1| hypothetical protein EUGRSUZ_A01397 [Eucalyptus grandis]
Length=429

 Score =   100 bits (249),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP +PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY AL   
Sbjct  296  LPHVIEDAPPLPGVKHVGGDMFVS-VPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNN  354

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP+  D +  T+ ++  D  IM  +    K  T++ +  L    GF+ F+ 
Sbjct  355  GKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKERTQKEFEALAKGAGFQGFQV  413

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  414  MCCAFGTHVMEFLK  427


 Score = 50.4 bits (119),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ S+ + INFD P
Sbjct  241  NRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLP  297



>ref|XP_011084580.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=367

 Score = 95.9 bits (237),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP+ PGV HVGGD+F S +P  DAIFMK +   WSD  C+ ++ NCY AL   
Sbjct  236  LPHVIQDAPSFPGVEHVGGDMFVS-VPKADAIFMKWICHDWSDAHCQKLLKNCYDALPDN  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ + + P   +     + +   D+ IM       K  +E+ ++ L    GFR    
Sbjct  295  GKVIIADSIFPEDPNSGPAFKRVAHGDV-IMLALNPGGKERSEKEFQSLAQYAGFREVIK  353

Query  225  YYMDFFLAVLEFHK  184
                F + ++EFHK
Sbjct  354  VCSAFNIWIMEFHK  367


 Score = 54.7 bits (130),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AM   S  FMK   + Y+GF+GV  LVDVGG  G  L+MI+ K+ +I + INFD P
Sbjct  181  NRAMYEQSTIFMKQILEKYKGFEGVKSLVDVGGGIGASLKMILSKYPTI-KGINFDLP  237



>ref|XP_010061962.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score = 96.7 bits (239),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+  GV HVGGD+F + IPN DA+FMK +   WSDE C  ++ NCY  L   
Sbjct  233  LPHVIEDAPSYRGVEHVGGDMFVN-IPNGDAVFMKWICHNWSDEHCAKLLKNCYDVLPVN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            G++IV E +LP+  D +  T+  +  D  ++  +   ++  TE+ +  L    GF+ F+ 
Sbjct  292  GRVIVAEYILPVYPDRSLSTKGAIHMDCIMLTHFSGGKER-TEKEFEALAKGAGFQDFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F  +++EF K
Sbjct  351  TCHAFNTSIMEFLK  364


 Score = 53.9 bits (128),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AMS  S   MK   ++Y GF+G+  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  178  NRAMSDHSTIMMKKILETYNGFEGLKTVVDVGGGTGAMLNMIVAKYPSI-KGINFDLP  234



>gb|AAF63200.1| caffeic acid O-3-methyltransferase [Populus tomentosa]
Length=360

 Score = 97.1 bits (240),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 74/131 (56%), Gaps = 2/131 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DA+FMK +   WSD  C   + NCY AL + 
Sbjct  232  LPHVIEDAPSYPGVEHVGGDMFVS-VPKADAVFMKWICHDWSDAHCLKFLKNCYDALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPGGKERTEKEFEGLANGAGFQGFEV  349

Query  225  YYMDFFLAVLE  193
                F   V+E
Sbjct  350  MCCAFNTHVIE  360


 Score = 53.5 bits (127),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+T LVDVGG  G  +  IV K+ SI + INFD P
Sbjct  177  NKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLP  233



>dbj|BAO31651.1| O-methyltransferase [Sesamum radiatum]
Length=354

 Score = 95.1 bits (235),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP+ PGV H+GGD+F S +P  DAIFMK +   WSD   + ++ NCY AL   
Sbjct  223  LPHVIQDAPSYPGVEHIGGDMFVS-VPKADAIFMKWICHDWSDAHRQKLLKNCYEALPNN  281

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ + +LP   +     R     D+ IM  +    K  +E+ ++ L    GFR    
Sbjct  282  GKVIIADSILPEDPNSGSAFRRAAQGDV-IMLAFNPGGKERSEKEFQALAQYAGFREVIK  340

Query  225  YYMDFFLAVLEFHK  184
                F + ++EFHK
Sbjct  341  VCSAFNIWIMEFHK  354


 Score = 55.5 bits (132),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  733  SVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            S  FMK   + Y+GF+GV  LVDVGG  G  L+MI+ K+ SI +AINFD P
Sbjct  175  STIFMKQILEKYKGFEGVKSLVDVGGGIGASLKMILSKYPSI-KAINFDLP  224



>ref|XP_010035325.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW46638.1| hypothetical protein EUGRSUZ_K00449 [Eucalyptus grandis]
Length=365

 Score = 94.7 bits (234),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL + 
Sbjct  234  LPHVIANAPSYPGVEHVGGDMFVS-VPTGDAIFMKWICHDWSDEHCLKFLKNCYNALPEH  292

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LP   D +  T+    +D+ IM  +    K  TE+ +  L  + GF+ F  
Sbjct  293  GKVIVADCILPELPDTSFATKVAFHADL-IMMAHNPGGKERTEKEFEALAKAAGFKRFHI  351

Query  225  YYMDFFLAVLEFHK  184
              + F   V+EF K
Sbjct  352  ACVAFD-HVMEFLK  364


 Score = 55.8 bits (133),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAMS +S   MK   ++Y+GF G+  +VD+GG  G  L MIV K+ SI + INFD P
Sbjct  179  NKAMSDVSTITMKQVLETYKGFDGLKSVVDIGGGTGAVLNMIVSKYPSI-KGINFDLP  235



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score = 99.4 bits (246),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 75/136 (55%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + +CY AL   
Sbjct  232  LPHVIEDAPAYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKSCYDALPNN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ +   D+ IM  +    K   E+ ++ L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDTSLATKGVAHIDV-IMLAHNPGGKERAEKEFQALAKGAGFQGFRV  349

Query  225  YYMDFFLAVLEFHK*P  178
                F   V+EF K P
Sbjct  350  VCSAFNTYVMEFLKKP  365


 Score = 51.2 bits (121),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV  + SI + INFD P
Sbjct  177  NRGMSDHSTITMKKLLETYKGFEGLNSVVDVGGGTGAVLSMIVSNYPSI-KGINFDLP  233



>ref|XP_006413044.1| hypothetical protein EUTSA_v10027501mg [Eutrema salsugineum]
 gb|ESQ54497.1| hypothetical protein EUTSA_v10027501mg [Eutrema salsugineum]
Length=369

 Score =   100 bits (249),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+  G+ HV GD+F S +P  DAIF+K V   WSDE C  ++ NCY ALS  
Sbjct  236  LPHVIENAPSFSGIEHVEGDMFVS-VPKGDAIFLKWVCHDWSDEHCLKLLKNCYEALSDN  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E ++PI  D +  T+ ++  D  IM  + A  +  TEE +  L   VGF+ F+ 
Sbjct  295  GKVIVVECLVPIAPDTSLLTKQVVHLDC-IMMAHTAGGRERTEEEFESLARRVGFKGFQV  353

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF+K
Sbjct  354  ICNVFGTYIMEFYK  367


 Score = 50.1 bits (118),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   ++Y+GF+G++ +VDVGG  G  L MIV K+ +I +  NFD P
Sbjct  181  NNGMSNHSTIVMKKILEAYKGFEGLSSVVDVGGGIGASLHMIVSKYPNI-KGTNFDLP  237



>ref|XP_008376824.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=365

 Score = 97.8 bits (242),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY A    
Sbjct  232  LPHVIXDAPQYPGVEHVGGDMFVS-VPKGDAIFMKFICHDWSDDHCLKFLKNCYTAXPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILAECILPVAPDSSLATKGVVHIDV-IMLAHXPGGKERTEKEFEALAKGSGFKGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ICSAFNTYVIEFLK  363


 Score = 52.4 bits (124),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G    MIV K+ SI + INFD P
Sbjct  177  NRGMAAHSTITMKKLLETYKGFEGLTSVVDVGGGTGAITNMIVSKYPSI-KGINFDLP  233



>gb|KCW90804.1| hypothetical protein EUGRSUZ_A02870 [Eucalyptus grandis]
Length=357

 Score = 96.7 bits (239),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+  GV HVGGD+F + IPN DA+FMK +   WSDE C  ++ NCY  L   
Sbjct  224  LPHVIEDAPSYRGVEHVGGDMFVN-IPNGDAVFMKWICHNWSDEHCAKLLKNCYDVLPVN  282

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            G++IV E +LP+  D +  T+  +  D  ++  +   ++  TE+ +  L    GF+ F+ 
Sbjct  283  GRVIVAEYILPVYPDRSLSTKGAIHMDCIMLTHFSGGKER-TEKEFEALAKGAGFQDFQV  341

Query  225  YYMDFFLAVLEFHK  184
                F  +++EF K
Sbjct  342  TCHAFNTSIMEFLK  355


 Score = 53.9 bits (128),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             +AMS  S   MK   ++Y GF+G+  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  169  NRAMSDHSTIMMKKILETYNGFEGLKTVVDVGGGTGAMLNMIVAKYPSI-KGINFDLP  225



>gb|KDO41090.1| hypothetical protein CISIN_1g018681mg [Citrus sinensis]
Length=352

 Score =   102 bits (255),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q AP  PGV HVGGD+F + +PN DAI +K +L  WSDE C  ++ NC+ ++ +G
Sbjct  221  LPHVIQHAPEYPGVKHVGGDMFRN-VPNGDAILIKWILHDWSDEHCLKLLKNCHKSIHEG  279

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP   + +  ++     D+ +M  Y   ++  T+  +  L    GF   + 
Sbjct  280  GKVIVVESVLPELPETSTHSKINFLGDVLVMTQYPGGKER-TKHEFMTLATGAGFSGVRF  338

Query  225  YYMDFFLAVLEFHK  184
                F L V+EFHK
Sbjct  339  DCFFFNLWVMEFHK  352


 Score = 47.4 bits (111),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM   +   ++   ++Y+GF+ + +LVDVGGS G+ L+ I+ K+  I + INFD P
Sbjct  168  AMYNHTTLVIQKILEAYKGFEHIKQLVDVGGSLGNTLKAIISKYPHI-EGINFDLP  222



>ref|XP_010068758.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89063.1| hypothetical protein EUGRSUZ_A01389 [Eucalyptus grandis]
Length=366

 Score = 95.9 bits (237),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGG++F S +P  DAIF+KS+   W++E C  ++ NCY AL   
Sbjct  233  LPHVIKDAPSYPGVEHVGGNMFVS-VPKGDAIFLKSICHNWNNEHCAKLLKNCYDALPIN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            G++I+ E +LP+  D +  T+ ++ +D  ++  +    K  TE+ +  L    GF+ F+ 
Sbjct  292  GRVIIAEDILPVYPDPSLATKGVIHTDCMML-AHCPGGKERTEKEFEALAKGAGFQGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  351  MCRAFNTYIMEFLK  364


 Score = 54.7 bits (130),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AMS IS   MK   ++Y GF+G+  +VDVGG  G  L MI+ K+ SI + INFD P
Sbjct  180  AMSDISTITMKKIVETYDGFEGLKTVVDVGGGTGAVLNMIIAKYPSI-KGINFDLP  234



>ref|XP_008347272.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=365

 Score = 97.8 bits (242),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY A    
Sbjct  232  LPHVIXDAPQYPGVEHVGGDMFVS-VPKGDAIFMKFICHDWSDDHCLKFLKNCYTAXPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILAECILPVAPDSSLATKGVVHIDV-IMLAHXPGGKERTEKEFEALAKGSGFKGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  ICSAFNTYVIEFLK  363


 Score = 52.4 bits (124),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M+  S   MK   ++Y+GF+G+T +VDVGG  G    MIV K+ SI + INFD P
Sbjct  177  NRGMAAHSTITMKKLLETYKGFEGLTSVVDVGGGTGAITNMIVSKYPSI-KGINFDLP  233



>gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score = 95.9 bits (237),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 68/116 (59%), Gaps = 2/116 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL Q 
Sbjct  233  LPHVIEDAPSYPGVEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPQN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFR  238
            GK+I+ E VLP   D    T+ ++  D+ IM  +    K  TE+ +  L  + GF+
Sbjct  292  GKVILAECVLPEAPDSGLATKNVVHIDV-IMLAHNPGGKERTEKEFHNLAKAAGFK  346


 Score = 54.3 bits (129),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MSG S   MK   ++Y+GF G+  +VDVGG  G  L MIV K+ SI + INFD P
Sbjct  178  NQGMSGHSTITMKKILETYKGFDGLNSVVDVGGGIGATLHMIVSKYPSI-KGINFDLP  234



>ref|XP_010034911.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW46118.1| hypothetical protein EUGRSUZ_K00041 [Eucalyptus grandis]
Length=365

 Score = 94.0 bits (232),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL + 
Sbjct  234  LPHVIANAPSYPGVEHVGGDMFVS-VPTGDAIFMKWICHDWSDEHCLKFLKNCYNALPEH  292

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV + +LP   D +  T+    +D+ IM  +    K  TE+ +  L  + GF+ F  
Sbjct  293  GKVIVADCILPELPDTSFATKVAFHADL-IMMAHNPGGKERTEKEFGALAKAAGFKRFHI  351

Query  225  YYMDFFLAVLEFHK  184
              + F   V+EF K
Sbjct  352  ACVAFD-HVMEFLK  364


 Score = 56.2 bits (134),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             KAMS +S   MK   ++Y+GF G+  +VD+GG  G  L MIV K+ SI + INFD P
Sbjct  179  NKAMSDVSTITMKEVLETYKGFHGLKSVVDIGGGTGAVLNMIVSKYPSI-KGINFDLP  235



>ref|XP_004307899.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=365

 Score = 99.0 bits (245),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVQHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCIKFLKNCYAALPDD  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+  + 
Sbjct  291  GKVILGECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEQEFEALAKGSGFQGIRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  CCDAFNTYVIEFLK  363


 Score = 50.8 bits (120),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y+GF+G+  +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKILETYKGFEGLKSIVDVGGGTGAVVNMIVAKYPSI-KGINFDLP  233



>ref|XP_002963026.1| hypothetical protein SELMODRAFT_78541 [Selaginella moellendorffii]
 gb|EFJ36489.1| hypothetical protein SELMODRAFT_78541 [Selaginella moellendorffii]
Length=394

 Score = 97.4 bits (241),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 3/136 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV  AP   G+ HVGG++F   IP  D +++K ++  WSD+ C  ++NNCY +L  G
Sbjct  259  LPHVVAGAPEYDGMKHVGGNMFEQ-IPGGDGMYLKHIMHNWSDDSCIKVLNNCYKSLKNG  317

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E + P   D +QR R  L  D+ +M  +  K +  +E  +R L  + GF   + 
Sbjct  318  GKIIMVEFLAPDPGDHSQRARVALSYDLVMMAHFLGKER--SEREFRDLLRAAGFSQIRI  375

Query  225  YYMDFFLAVLEFHK*P  178
                  +AV+E HK P
Sbjct  376  ALRVDCVAVVEAHKNP  391


 Score = 52.8 bits (125),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AMS +S  +M+A  ++Y GFK    LVDVGG  G  L MI+ K+  I   INFD P
Sbjct  206  AMSDMSEIYMEAIVNNYHGFKDTKTLVDVGGGTGSSLAMILTKYPHI-HGINFDLP  260



>ref|XP_009361268.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=367

 Score = 96.3 bits (238),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  DAI MK +   WSDE C  ++ NCYAAL   
Sbjct  232  LPHVIKDAPQYPGVEHVGGDMFVS-VPKGDAIVMKHICHDWSDEHCLKLLKNCYAALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E ++P+  + +  T+     D+ ++       K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVILVEFIIPVSPNSSLATKLANHIDLLML-ANNPGGKERTEDEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  MCSAFNSNVIEFLK  363


 Score = 53.5 bits (127),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y+GF+G+T +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NKGMADQSSISMKKLLETYKGFEGLTSIVDVGGGIGSVIHMIVSKYPSI-KGINFDLP  233



>ref|XP_003528001.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=366

 Score =   100 bits (248),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ A + PGV HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  232  LPHVIEDATSYPGVEHVGGDMFVS-VPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  291  GKVIVAECILPVAPDFSLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRV  349

Query  225  YYMDFFLAVLEFHK  184
            +   F   V+EF K
Sbjct  350  HCCAFNTYVMEFLK  363


 Score = 49.7 bits (117),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y GF G+  LVDVGG  G  + MIV K+ +I + INFD P
Sbjct  177  NKGMADHSTITMKKILETYTGFGGLKSLVDVGGGTGAIINMIVSKYPTI-KGINFDLP  233



>gb|AGS49198.1| O-methyltransferase [Zea mays]
Length=364

 Score =   102 bits (255),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV HVGGD+F S +P  DAI MK +L  WSD  C  ++ NCY AL + 
Sbjct  233  LPHVISEAPPFPGVRHVGGDMFAS-VPAGDAILMKWILHDWSDAHCATLLKNCYDALPEN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP+ T+ T + + +   D+ IM  +    K   E  +R+L    GF  FKA
Sbjct  292  GKVIVDECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSRFKA  350

Query  225  YYMDFFLAVLEFHK  184
             Y+      +EF K
Sbjct  351  TYIYANAWAIEFIK  364


 Score = 47.4 bits (111),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 30/58 (52%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M   SV   K   D Y GF+GV+ LVDVGG  G  L  I  +H  I   +NFD P
Sbjct  178  NEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVGATLLAITSRHPHIP-GVNFDLP  234



>ref|XP_010537046.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=366

 Score = 99.0 bits (245),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PG+ HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL   
Sbjct  233  LPHVIEDAPSYPGIEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCLKFLKNCYEALPDN  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF  F+ 
Sbjct  292  GKVIVAECILPVAPDPSLLTKQVVHIDC-IMLAHNPGGKERTEKEFEALAKGSGFHGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF K
Sbjct  351  VCNAFGTYIMEFLK  364


 Score = 50.8 bits (120),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   ++Y GF+G++ +VDVGG  G  L MIV K+ +I + INFD P
Sbjct  178  NNGMSNHSTITMKKILETYNGFEGLSSVVDVGGGIGATLSMIVSKYPAI-KGINFDLP  234



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score = 95.1 bits (235),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PG+ HVGGD+F S +P  DAIFMK +   WSDE C   + NCY AL + 
Sbjct  230  LPHVIEDAPSHPGIEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPED  288

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP   D +  T+ ++  D  IM  +    K  TE+ +  L  + GF+  K 
Sbjct  289  GKVILAECILPETPDSSLSTKQVVHVDC-IMLAHNPGGKERTEKEFEALAKASGFKGIKV  347

Query  225  YYMDFFLAVLEFHK  184
                F + ++E  K
Sbjct  348  VCDAFGVNLIELLK  361


 Score = 54.3 bits (129),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   ++Y+GF+G+T LVDVGG  G  L+MIV K+ ++ + INFD P
Sbjct  175  NNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLP  231



>sp|P46484.1|COMT1_EUCGU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Eucalyptus gunnii]
 emb|CAA52814.1| 0-Methyltransferase [Eucalyptus gunnii]
Length=366

 Score = 99.0 bits (245),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP +PGV HVGGD+F S +P  DAIFMK +   WSD+ C   + NCY AL   
Sbjct  233  LPHVIEDAPPLPGVKHVGGDMFVS-VPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNI  291

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP+  D +  T+ ++  D  IM  +    K  T++ +  L    GF+ F+ 
Sbjct  292  GKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKERTQKEFETLAKGAGFQGFQV  350

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  351  MCCAFGTHVMEFLK  364


 Score = 50.8 bits (120),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + MS  S   MK   ++Y+GF+G+  +VDVGG  G  L MIV K+ S+ + INFD P
Sbjct  178  NRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLP  234



>sp|A8J6X1.1|BMT_GLELI RecName: Full=Bergaptol O-methyltransferase; Short=BMT [Glehnia 
littoralis]
 dbj|BAF81987.1| bergaptol O-methyltransferase [Glehnia littoralis]
Length=359

 Score = 95.9 bits (237),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 7/137 (5%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV  +P  PGV HVGGD+F S +P  DAIF+K +  +WSDE+C  I+ NCY AL+  
Sbjct  227  LPHVVGDSPIHPGVEHVGGDMFAS-VPKGDAIFLKWIFHSWSDEDCLRILKNCYEALADN  285

Query  405  GKLIVCE---PVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRT  235
             K+IV E   P +P  +DD  ++   L +   IM  Y    K  TE+ +  L    GF++
Sbjct  286  KKVIVAEFIIPEVPGGSDDATKSVVHLDA---IMLAYVPGGKERTEKEFESLATRAGFKS  342

Query  234  FKAYYMDFFLAVLEFHK  184
            F+     F   ++EF K
Sbjct  343  FRKVCCAFNTWIMEFSK  359


 Score = 53.5 bits (127),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             ++M+G S   MK   ++Y GF+G+  +VDVGG +G  L MI+ K+ +I + INFD P
Sbjct  172  NRSMAGHSTITMKKIVETYNGFEGLKSIVDVGGGSGATLNMIISKYPTI-KGINFDLP  228



>ref|XP_006478221.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=352

 Score =   101 bits (252),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q +P  PGV HVGGD+F S +PN DAI +K +L  WSDE C  ++ NCY ++ +G
Sbjct  221  LPHVIQHSPEYPGVKHVGGDMFQS-VPNGDAILIKWILHDWSDEHCLKLLKNCYKSIPEG  279

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E VLP   + +  ++    +D+ +M  Y   ++  T+  +  L    GF   + 
Sbjct  280  GKVIVVESVLPELPETSTHSKINSLADVLVMTQYPGGKER-TKHEFTTLATEAGFSGIRF  338

Query  225  YYMDFFLAVLEFHK  184
                + L V+EF+K
Sbjct  339  VCFFYNLWVMEFYK  352


 Score = 47.8 bits (112),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AM   +   ++   ++Y+GF+ + +LVDVGGS G+ LR I  K+  I + INFD P
Sbjct  168  AMYNHTTLVLQKILEAYKGFEHIKQLVDVGGSLGNTLREITSKYPHI-KGINFDLP  222



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score = 95.1 bits (235),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP+ PG+ HVGGD+F S +P  DAIFMK +   WSDE C+  + NCY AL + 
Sbjct  232  LPHVIDDAPSHPGIEHVGGDMFVS-VPKGDAIFMKWICHDWSDEHCEKFLKNCYEALPEN  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E ++P   D +  T+ ++  D  IM  +    K  TE+ +  L  + GF+  K 
Sbjct  291  GKVILAECIVPETLDSSLSTKQVVHVDC-IMLAHNPGGKERTEKDFEALAKASGFKGIKV  349

Query  225  YYMDFFLAVLEFHK  184
                F + ++E  K
Sbjct  350  VCDAFGVNIIELLK  363


 Score = 54.7 bits (130),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   ++Y+GF+G+T LVDVGG  G  L+MIV K+ ++ + INFD P
Sbjct  177  NNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLP  233



>ref|XP_002980303.1| hypothetical protein SELMODRAFT_112597 [Selaginella moellendorffii]
 gb|EFJ18563.1| hypothetical protein SELMODRAFT_112597 [Selaginella moellendorffii]
Length=394

 Score = 97.1 bits (240),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 3/136 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P VV  AP   G+ HVGG++F   IP  D +++K ++  WSD+ C  ++NNCY +L  G
Sbjct  259  LPHVVAGAPEYDGMKHVGGNMFEQ-IPGGDGMYLKHIMHNWSDDACIKVLNNCYKSLKNG  317

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E + P   D +QR R  L  D+ +M  +  K +  +E  +R L  + GF   + 
Sbjct  318  GKIIMVEFLAPDPGDHSQRARVALSYDLVMMAHFLGKER--SEREFRDLLRAAGFSQIRI  375

Query  225  YYMDFFLAVLEFHK*P  178
                  +AV+E HK P
Sbjct  376  ALRVDCVAVVEAHKNP  391


 Score = 52.8 bits (125),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -3

Query  748  AMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            AMS +S  +M+A  ++Y GFK    LVDVGG  G  L MI+ K+  I   INFD P
Sbjct  206  AMSDMSEIYMEAIVNNYHGFKDTKTLVDVGGGTGSSLAMILAKYPHI-HGINFDLP  260



>ref|XP_006442371.1| hypothetical protein CICLE_v10024037mg [Citrus clementina]
 gb|ESR55611.1| hypothetical protein CICLE_v10024037mg [Citrus clementina]
Length=363

 Score =   100 bits (249),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 76/136 (56%), Gaps = 2/136 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+Q  P  PG+ HVGGD+F S IP  D IFMK +   WS+E C  I+ NCY AL + 
Sbjct  230  LPHVIQDGPAYPGIEHVGGDMFVS-IPKADVIFMKWICHNWSEEACVKILKNCYEALPEN  288

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E +LP+  D +  ++ ++  D  IM  +    +  TE+ ++ L    GF+ FK 
Sbjct  289  GKVIVAECILPVLPDPSLASKQVIHIDC-IMLAHTTGGREMTEQDFKTLAKVAGFQGFKV  347

Query  225  YYMDFFLAVLEFHK*P  178
                F   ++EF K P
Sbjct  348  VCSAFSTYIMEFLKKP  363


 Score = 48.9 bits (115),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  721  MKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            +K F ++Y+GF+G+  +VDVGG  G  + MI+ K+ SI + INFD P
Sbjct  186  LKKFLENYKGFEGLKSVVDVGGGIGASVNMIISKYPSI-KGINFDLP  231



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score = 98.2 bits (243),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP  PGV HVGGD+F S +P  +AIFMK +   WSDE C   + NCYAAL   
Sbjct  232  LPHVIEDAPQYPGVQHVGGDMFVS-VPKGNAIFMKWICHDWSDEHCIKFLKNCYAALPDD  290

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K  TE+ +  L    GF+  + 
Sbjct  291  GKVILAECILPVAPDTSLATKGVVHMDV-IMLAHNPGGKERTEQEFEALAKGSGFQGIRV  349

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  350  CCDAFNTYVIEFLK  363


 Score = 51.2 bits (121),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K M+  S   MK   ++Y+GF+G+  +VDVGG  G  + MIV K+ SI + INFD P
Sbjct  177  NKGMADHSTITMKKILETYKGFEGLKSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLP  233



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score =   104 bits (260),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV H+GGD+F S +P+ DAI MK ++  WSDE C  I+ NC+ AL   
Sbjct  236  LPHVISEAPPFPGVEHIGGDMFAS-VPSGDAILMKWIMHDWSDEHCAKILENCHKALPNN  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+CE +LP+  +     + +   D+ IM  +    K  TE+ Y+ L    GF  FKA
Sbjct  295  GKVILCECILPVAPEPIPSAQGVFHVDM-IMLAHNPGGKERTEKEYQDLAKGAGFTGFKA  353

Query  225  YYMDFFLAVLEFHK  184
             Y      VLEF K
Sbjct  354  QYCFSTAWVLEFTK  367


 Score = 44.7 bits (104),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             + M   S+   K   + Y+GF+ V  LVDVGG  G  L MI  K+  I + INFD P
Sbjct  181  NEGMKNHSIIITKKLLEFYKGFEDVNVLVDVGGGIGATLHMITSKYPHI-KGINFDLP  237



>ref|XP_002869549.1| hypothetical protein ARALYDRAFT_354029 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45808.1| hypothetical protein ARALYDRAFT_354029 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   100 bits (248),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+  G+ HV GD+F S +P  DAIF+K V   WSDE C  ++NNCY AL   
Sbjct  236  LPHVIENAPSFSGIEHVKGDMFVS-VPKGDAIFLKWVCHDWSDEHCLKLLNNCYKALPDN  294

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+IV E ++P+  D +  T+ ++  D  IM  + A  +  TEE +  L   VGF+ F+ 
Sbjct  295  GKVIVVECLVPVAPDSSLLTKQVVHLDC-IMMAHTAGGRERTEEEFELLARRVGFKGFQV  353

Query  225  YYMDFFLAVLEFHK  184
                F   ++EF+K
Sbjct  354  ICNVFGTYIMEFYK  367


 Score = 49.3 bits (116),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
               MS  S   MK   + Y+GFKG++ +VDVGG  G  L MIV K+ +I +  NFD P
Sbjct  181  NNGMSNHSTIVMKKLLEVYKGFKGLSFVVDVGGGIGASLHMIVSKYPNI-KGTNFDLP  237



>ref|XP_002321948.1| Chain A family protein [Populus trichocarpa]
 ref|XP_006374080.1| hypothetical protein POPTR_0015s00550g [Populus trichocarpa]
 gb|ACC63884.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|EEF06075.1| Chain A family protein [Populus trichocarpa]
 gb|ERP51877.1| hypothetical protein POPTR_0015s00550g [Populus trichocarpa]
Length=364

 Score = 97.8 bits (242),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV +VGGD+F S +P  DA+FMK +   WSDE C   + NCY AL + 
Sbjct  231  LPHVIADAPAFPGVENVGGDMFVS-VPKADAVFMKWICHDWSDEHCLRFLKNCYDALPEN  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  290  GKVILVECILPVAPDTSLATKGVMHVDA-IMLAHNPGGKERTEKEFEGLARGAGFKGFEV  348

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  349  MCCAFNTYVIEFRK  362


 Score = 51.6 bits (122),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+  LVDVGG  G  L  IV K+ SI + INFD P
Sbjct  176  NKGMSDHSKIAMKKILETYKGFEGLASLVDVGGGTGAVLSTIVSKYPSI-KGINFDLP  232



>gb|ACJ76442.1| caffeic acid 3-O-methyltransferase 2 [Populus trichocarpa]
Length=364

 Score = 98.2 bits (243),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V+  AP  PGV +VGGD+F S +P  DA+FMK +   WSDE C   + NCY AL + 
Sbjct  231  LPHVIADAPAFPGVENVGGDMFVS-VPQADAVFMKWICHDWSDEHCLRFLKNCYDALPEN  289

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFKA  226
            GK+I+ E +LP+  D +  T+ ++  D  IM  +    K  TE+ +  L    GF+ F+ 
Sbjct  290  GKVILVECILPVAPDTSLATKGVMHVDA-IMLAHNPGGKERTEKEFEGLARGAGFKGFEV  348

Query  225  YYMDFFLAVLEFHK  184
                F   V+EF K
Sbjct  349  MCCAFNTYVIEFRK  362


 Score = 51.2 bits (121),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  754  QKAMSGISVPFMKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
             K MS  S   MK   ++Y+GF+G+  LVDVGG  G  L  IV K+ SI + INFD P
Sbjct  176  NKGMSDHSKIAMKKILETYKGFEGLASLVDVGGGTGAVLSTIVSKYPSI-KGINFDLP  232



>gb|EPS64988.1| hypothetical protein M569_09791, partial [Genlisea aurea]
Length=350

 Score =   102 bits (253),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  585  FPEVVQLAPNIPGVTHVGGDVFTSAIPNCDAIFMKSVLTAWSDEECKAIMNNCYAALSQG  406
             P V++ AP+ PGV H+GGD+F S +P  DAI +K +L  WSDE+C  I+  C  A+ + 
Sbjct  218  MPRVIEHAPSYPGVEHIGGDMFES-VPKGDAILLKWILHDWSDEDCNRILKKCCEAIPES  276

Query  405  GKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGFRTFK  229
            GK++V E +LP   D++  TR ++  D  IM       K  TEE +R LGL+ GF+ FK
Sbjct  277  GKVMVAEYILPNTPDNSSATRNVVNMDA-IMLARSPSGKERTEEEFRTLGLASGFKHFK  334


 Score = 47.4 bits (111),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -3

Query  721  MKAFXDSYQGFKGVTRLVDVGGSAGDCLRMIVEKHXSITQAINFDFP  581
            M    + Y+GF+ V+ +VDVGG  G  L MIV KH  I + INFD P
Sbjct  174  MNKLLNKYRGFENVSTVVDVGGGIGAALNMIVSKHPRI-RGINFDMP  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470