BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005E09

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275064.1|  Per1-like family protein precursor                 241   2e-74   Solanum tuberosum [potatoes]
gb|KDO46714.1|  hypothetical protein CISIN_1g018683mg                   238   3e-74   Citrus sinensis [apfelsine]
gb|ACB45085.1|  PERLD1                                                  239   3e-74   Solanum commersonii
ref|XP_006421845.1|  hypothetical protein CICLE_v10005347mg             236   4e-74   
ref|XP_002280194.1|  PREDICTED: post-GPI attachment to proteins f...    240   5e-74   Vitis vinifera
ref|XP_011030038.1|  PREDICTED: post-GPI attachment to proteins f...    238   6e-74   Populus euphratica
ref|XP_011076241.1|  PREDICTED: post-GPI attachment to proteins f...    239   7e-74   Sesamum indicum [beniseed]
ref|XP_010035088.1|  PREDICTED: post-GPI attachment to proteins f...    239   9e-74   Eucalyptus grandis [rose gum]
ref|XP_006421842.1|  hypothetical protein CICLE_v10005347mg             235   2e-73   
gb|KDO60109.1|  hypothetical protein CISIN_1g019038mg                   235   2e-73   Citrus sinensis [apfelsine]
ref|XP_006422204.1|  hypothetical protein CICLE_v10005304mg             238   3e-73   
ref|XP_006422207.1|  hypothetical protein CICLE_v10005304mg             238   4e-73   
ref|XP_009758149.1|  PREDICTED: post-GPI attachment to proteins f...    231   4e-73   Nicotiana sylvestris
gb|KDP22331.1|  hypothetical protein JCGZ_26162                         238   4e-73   Jatropha curcas
gb|ABB86252.1|  Per1-like family protein                                238   4e-73   Solanum tuberosum [potatoes]
ref|XP_009586779.1|  PREDICTED: post-GPI attachment to proteins f...    238   5e-73   Nicotiana tomentosiformis
ref|XP_004234349.1|  PREDICTED: post-GPI attachment to proteins f...    238   5e-73   Solanum lycopersicum
gb|EYU25051.1|  hypothetical protein MIMGU_mgv1a009430mg                237   6e-73   Erythranthe guttata [common monkey flower]
ref|XP_002513401.1|  conserved hypothetical protein                     235   1e-72   
emb|CDP05250.1|  unnamed protein product                                236   1e-72   Coffea canephora [robusta coffee]
ref|XP_002513400.1|  conserved hypothetical protein                     236   1e-72   
ref|XP_007038582.1|  Per1-like family protein                           236   2e-72   
ref|XP_011030037.1|  PREDICTED: post-GPI attachment to proteins f...    236   3e-72   Populus euphratica
ref|XP_006422206.1|  hypothetical protein CICLE_v10005304mg             235   3e-72   Citrus clementina [clementine]
ref|XP_006490483.1|  PREDICTED: post-GPI attachment to proteins f...    235   4e-72   
ref|XP_010644976.1|  PREDICTED: post-GPI attachment to proteins f...    234   8e-72   Vitis vinifera
ref|XP_006421844.1|  hypothetical protein CICLE_v10005347mg             234   8e-72   Citrus clementina [clementine]
ref|XP_002266274.1|  PREDICTED: post-GPI attachment to proteins f...    234   8e-72   Vitis vinifera
emb|CAN65586.1|  hypothetical protein VITISV_034376                     233   2e-71   Vitis vinifera
ref|XP_010106800.1|  hypothetical protein L484_005346                   233   2e-71   Morus notabilis
ref|XP_004234347.1|  PREDICTED: post-GPI attachment to proteins f...    233   2e-71   Solanum lycopersicum
ref|XP_002266197.1|  PREDICTED: post-GPI attachment to proteins f...    234   2e-71   Vitis vinifera
gb|KHN31540.1|  Post-GPI attachment to proteins factor 3                231   2e-71   Glycine soja [wild soybean]
ref|XP_010278515.1|  PREDICTED: post-GPI attachment to proteins f...    233   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_002318250.1|  hypothetical protein POPTR_0012s13850g             232   7e-71   Populus trichocarpa [western balsam poplar]
gb|ACA64424.1|  PERLD1                                                  231   9e-71   Glycine max [soybeans]
ref|XP_003620227.1|  Post-GPI attachment to proteins factor             231   9e-71   
ref|XP_009625146.1|  PREDICTED: post-GPI attachment to proteins f...    231   1e-70   Nicotiana tomentosiformis
gb|KHG15846.1|  Post-GPI attachment tos factor 3                        231   1e-70   Gossypium arboreum [tree cotton]
ref|XP_006353377.1|  PREDICTED: post-GPI attachment to proteins f...    231   1e-70   Solanum tuberosum [potatoes]
ref|XP_004240743.1|  PREDICTED: post-GPI attachment to proteins f...    231   1e-70   Solanum lycopersicum
ref|XP_007152345.1|  hypothetical protein PHAVU_004G122200g             231   1e-70   Phaseolus vulgaris [French bean]
ref|XP_010061579.1|  PREDICTED: post-GPI attachment to proteins f...    231   2e-70   Eucalyptus grandis [rose gum]
ref|XP_008234299.1|  PREDICTED: post-GPI attachment to proteins f...    231   2e-70   Prunus mume [ume]
ref|XP_003549124.1|  PREDICTED: post-GPI attachment to proteins f...    230   3e-70   Glycine max [soybeans]
ref|XP_007218263.1|  hypothetical protein PRUPE_ppa008189mg             230   4e-70   Prunus persica
gb|KJB52864.1|  hypothetical protein B456_008G280700                    230   4e-70   Gossypium raimondii
ref|XP_011014824.1|  PREDICTED: post-GPI attachment to proteins f...    229   5e-70   Populus euphratica
ref|XP_006340525.1|  PREDICTED: protein PER1 homolog                    229   7e-70   Solanum tuberosum [potatoes]
ref|XP_002310105.1|  Per1-like family protein                           229   8e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010249649.1|  PREDICTED: post-GPI attachment to proteins f...    228   2e-69   Nelumbo nucifera [Indian lotus]
gb|KDP25109.1|  hypothetical protein JCGZ_22644                         228   2e-69   Jatropha curcas
gb|KCW90758.1|  hypothetical protein EUGRSUZ_A02835                     229   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010249648.1|  PREDICTED: post-GPI attachment to proteins f...    228   2e-69   Nelumbo nucifera [Indian lotus]
gb|KDO60107.1|  hypothetical protein CISIN_1g019038mg                   228   2e-69   Citrus sinensis [apfelsine]
emb|CDP13593.1|  unnamed protein product                                227   5e-69   Coffea canephora [robusta coffee]
ref|XP_006857922.1|  hypothetical protein AMTR_s00069p00146030          226   6e-69   
ref|XP_003528854.1|  PREDICTED: post-GPI attachment to proteins f...    227   6e-69   Glycine max [soybeans]
ref|XP_004968454.1|  PREDICTED: post-GPI attachment to proteins f...    227   7e-69   Setaria italica
ref|XP_006664912.1|  PREDICTED: post-GPI attachment to proteins f...    227   9e-69   Oryza brachyantha
ref|XP_009775256.1|  PREDICTED: post-GPI attachment to proteins f...    226   1e-68   Nicotiana sylvestris
gb|ACJ84406.1|  unknown                                                 226   2e-68   Medicago truncatula
ref|NP_001147973.1|  CAB2 precursor                                     226   2e-68   
ref|XP_006576320.1|  PREDICTED: post-GPI attachment to proteins f...    226   2e-68   Glycine max [soybeans]
gb|AFK39392.1|  unknown                                                 226   2e-68   Medicago truncatula
ref|XP_008661897.1|  PREDICTED: CAB2 isoform X1                         226   2e-68   
gb|ACN35025.1|  unknown                                                 226   2e-68   Zea mays [maize]
gb|AFW58545.1|  hypothetical protein ZEAMMB73_490076                    227   2e-68   
gb|KEH26587.1|  post-GPI attachment-like factor-protein                 226   2e-68   Medicago truncatula
ref|NP_001054945.1|  Os05g0220100                                       226   2e-68   
ref|XP_004512796.1|  PREDICTED: post-GPI attachment to proteins f...    225   2e-68   Cicer arietinum [garbanzo]
ref|XP_003521884.1|  PREDICTED: post-GPI attachment to proteins f...    225   2e-68   Glycine max [soybeans]
ref|XP_004513683.1|  PREDICTED: post-GPI attachment to proteins f...    225   3e-68   Cicer arietinum [garbanzo]
gb|KEH26588.1|  post-GPI attachment-like factor-protein                 225   3e-68   Medicago truncatula
ref|XP_008456335.1|  PREDICTED: post-GPI attachment to proteins f...    225   4e-68   Cucumis melo [Oriental melon]
ref|XP_004171793.1|  PREDICTED: post-GPI attachment to proteins f...    224   5e-68   
ref|XP_004143181.1|  PREDICTED: post-GPI attachment to proteins f...    224   5e-68   Cucumis sativus [cucumbers]
gb|KJB39383.1|  hypothetical protein B456_007G010000                    224   6e-68   Gossypium raimondii
ref|XP_004294129.1|  PREDICTED: post-GPI attachment to proteins f...    224   6e-68   Fragaria vesca subsp. vesca
ref|XP_008439161.1|  PREDICTED: post-GPI attachment to proteins f...    224   6e-68   Cucumis melo [Oriental melon]
ref|XP_008226095.1|  PREDICTED: post-GPI attachment to proteins f...    224   1e-67   Prunus mume [ume]
ref|XP_010915760.1|  PREDICTED: post-GPI attachment to proteins f...    223   2e-67   Elaeis guineensis
ref|XP_008805643.1|  PREDICTED: post-GPI attachment to proteins f...    223   2e-67   Phoenix dactylifera
gb|KHG02645.1|  Post-GPI attachment tos factor 3                        223   2e-67   Gossypium arboreum [tree cotton]
ref|XP_003562375.1|  PREDICTED: post-GPI attachment to proteins f...    223   3e-67   Brachypodium distachyon [annual false brome]
emb|CDY68708.1|  BnaA06g38370D                                          223   3e-67   Brassica napus [oilseed rape]
ref|XP_009149093.1|  PREDICTED: post-GPI attachment to proteins f...    223   3e-67   Brassica rapa
ref|XP_010094756.1|  hypothetical protein L484_019966                   222   4e-67   Morus notabilis
ref|XP_006416803.1|  hypothetical protein EUTSA_v10008113mg             222   5e-67   Eutrema salsugineum [saltwater cress]
emb|CDY40049.1|  BnaC05g12660D                                          222   5e-67   Brassica napus [oilseed rape]
ref|XP_002448009.1|  hypothetical protein SORBIDRAFT_06g019590          222   5e-67   Sorghum bicolor [broomcorn]
tpg|DAA37379.1|  TPA: hypothetical protein ZEAMMB73_215322              222   5e-67   
gb|KJB82126.1|  hypothetical protein B456_013G177900                    222   7e-67   Gossypium raimondii
ref|XP_009341265.1|  PREDICTED: post-GPI attachment to proteins f...    221   7e-67   Pyrus x bretschneideri [bai li]
ref|NP_001141953.1|  hypothetical protein precursor                     221   9e-67   Zea mays [maize]
ref|XP_010497975.1|  PREDICTED: post-GPI attachment to proteins f...    221   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004140795.1|  PREDICTED: post-GPI attachment to proteins f...    221   2e-66   
gb|KGN57336.1|  hypothetical protein Csa_3G180250                       221   2e-66   Cucumis sativus [cucumbers]
ref|XP_010459200.1|  PREDICTED: post-GPI attachment to proteins f...    220   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004308119.1|  PREDICTED: post-GPI attachment to proteins f...    220   2e-66   Fragaria vesca subsp. vesca
ref|XP_010476769.1|  PREDICTED: post-GPI attachment to proteins f...    220   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008377107.1|  PREDICTED: post-GPI attachment to proteins f...    220   2e-66   Malus domestica [apple tree]
ref|XP_009383493.1|  PREDICTED: post-GPI attachment to proteins f...    220   3e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006305176.1|  hypothetical protein CARUB_v10009543mg             220   4e-66   
ref|XP_007022223.1|  Per1-like family protein isoform 2                 219   5e-66   
ref|XP_007133380.1|  hypothetical protein PHAVU_011G174400g             219   6e-66   Phaseolus vulgaris [French bean]
ref|XP_009615087.1|  PREDICTED: post-GPI attachment to proteins f...    219   6e-66   Nicotiana tomentosiformis
ref|XP_009366488.1|  PREDICTED: post-GPI attachment to proteins f...    219   7e-66   
ref|XP_009404456.1|  PREDICTED: post-GPI attachment to proteins f...    218   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002322440.1|  hypothetical protein POPTR_0015s13810g             218   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_009117756.1|  PREDICTED: post-GPI attachment to proteins f...    218   2e-65   Brassica rapa
ref|XP_008376516.1|  PREDICTED: post-GPI attachment to proteins f...    218   2e-65   Malus domestica [apple tree]
ref|XP_009411454.1|  PREDICTED: post-GPI attachment to proteins f...    218   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009802480.1|  PREDICTED: post-GPI attachment to proteins f...    217   3e-65   Nicotiana sylvestris
ref|XP_010676806.1|  PREDICTED: post-GPI attachment to proteins f...    217   5e-65   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK02712.1|  predicted protein                                      217   5e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001031058.1|  Per1-like family protein                           215   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411453.1|  PREDICTED: post-GPI attachment to proteins f...    217   5e-65   
ref|XP_008795943.1|  PREDICTED: post-GPI attachment to proteins f...    216   9e-65   Phoenix dactylifera
dbj|BAJ93369.1|  predicted protein                                      215   3e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01927.1|  predicted protein                                      215   3e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT11964.1|  hypothetical protein F775_08311                         215   3e-64   
gb|EPS57354.1|  hypothetical protein M569_17464                         215   3e-64   Genlisea aurea
ref|XP_010925813.1|  PREDICTED: post-GPI attachment to proteins f...    214   4e-64   Elaeis guineensis
ref|XP_002510848.1|  conserved hypothetical protein                     214   5e-64   
gb|KJB26985.1|  hypothetical protein B456_004G270100                    214   5e-64   Gossypium raimondii
ref|XP_009371276.1|  PREDICTED: post-GPI attachment to proteins f...    214   7e-64   Pyrus x bretschneideri [bai li]
emb|CDX81768.1|  BnaC08g38330D                                          216   9e-64   
gb|EMS64956.1|  hypothetical protein TRIUR3_20884                       214   1e-63   Triticum urartu
ref|NP_173104.1|  Per1-like family protein                              213   2e-63   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19866.1|  AT1G16560                                              213   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004250185.1|  PREDICTED: post-GPI attachment to proteins f...    211   5e-63   Solanum lycopersicum
gb|EMT06679.1|  hypothetical protein F775_25984                         212   6e-63   
ref|XP_002890173.1|  hypothetical protein ARALYDRAFT_471855             211   7e-63   
ref|XP_007022222.1|  Per1-like family protein isoform 1                 211   1e-62   
ref|XP_009382286.1|  PREDICTED: post-GPI attachment to proteins f...    211   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083636.1|  PREDICTED: post-GPI attachment to proteins f...    211   2e-62   
ref|XP_006364637.1|  PREDICTED: post-GPI attachment to proteins f...    210   2e-62   Solanum tuberosum [potatoes]
ref|XP_011083635.1|  PREDICTED: post-GPI attachment to proteins f...    211   2e-62   Sesamum indicum [beniseed]
ref|XP_010693511.1|  PREDICTED: post-GPI attachment to proteins f...    210   2e-62   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX71621.1|  BnaC09g26620D                                          204   3e-62   
gb|EMS67113.1|  Post-GPI attachment to proteins factor 3                214   6e-61   Triticum urartu
ref|XP_010255551.1|  PREDICTED: post-GPI attachment to proteins f...    206   1e-60   Nelumbo nucifera [Indian lotus]
emb|CDY37390.1|  BnaC05g30400D                                          199   2e-60   Brassica napus [oilseed rape]
ref|XP_010537783.1|  PREDICTED: post-GPI attachment to proteins f...    205   2e-60   Tarenaya hassleriana [spider flower]
gb|EYU19511.1|  hypothetical protein MIMGU_mgv1a009409mg                204   4e-60   Erythranthe guttata [common monkey flower]
emb|CDX94579.1|  BnaC09g22570D                                          198   5e-60   
ref|XP_009590513.1|  PREDICTED: post-GPI attachment to proteins f...    203   9e-60   Nicotiana tomentosiformis
ref|XP_011097638.1|  PREDICTED: post-GPI attachment to proteins f...    202   2e-59   
ref|XP_011097637.1|  PREDICTED: post-GPI attachment to proteins f...    202   3e-59   Sesamum indicum [beniseed]
ref|XP_002872857.1|  hypothetical protein ARALYDRAFT_490363             200   5e-59   
emb|CDY38313.1|  BnaC05g30060D                                          198   2e-58   Brassica napus [oilseed rape]
ref|XP_009788343.1|  PREDICTED: post-GPI attachment to proteins f...    198   2e-57   Nicotiana sylvestris
ref|XP_004240259.1|  PREDICTED: post-GPI attachment to proteins f...    196   5e-57   Solanum lycopersicum
gb|KFK27944.1|  hypothetical protein AALP_AA8G451600                    195   9e-57   Arabis alpina [alpine rockcress]
ref|XP_001771346.1|  predicted protein                                  195   2e-56   
ref|XP_006394431.1|  hypothetical protein EUTSA_v10004514mg             190   2e-55   
emb|CDX82919.1|  BnaC01g13690D                                          186   3e-55   
emb|CDY00259.1|  BnaA06g21600D                                          191   4e-55   
ref|XP_006360399.1|  PREDICTED: post-GPI attachment to proteins f...    191   5e-55   
emb|CDX86924.1|  BnaC03g51940D                                          189   7e-55   
dbj|BAB10175.1|  unnamed protein product                                188   9e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394432.1|  hypothetical protein EUTSA_v10004514mg             190   1e-54   Eutrema salsugineum [saltwater cress]
ref|XP_009151332.1|  PREDICTED: post-GPI attachment to proteins f...    190   1e-54   Brassica rapa
ref|XP_009130193.1|  PREDICTED: post-GPI attachment to proteins f...    190   2e-54   Brassica rapa
ref|NP_568951.1|  Per1-like family protein                              189   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190592.1|  Per1-like family protein                           188   5e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27545.1|  hypothetical protein MIMGU_mgv1a009440mg                187   2e-53   Erythranthe guttata [common monkey flower]
emb|CDY32129.1|  BnaCnng06380D                                          182   4e-53   Brassica napus [oilseed rape]
emb|CDY10592.1|  BnaC03g70220D                                          180   5e-53   Brassica napus [oilseed rape]
ref|XP_010523608.1|  PREDICTED: post-GPI attachment to proteins f...    183   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_010483931.1|  PREDICTED: post-GPI attachment to proteins f...    183   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006280748.1|  hypothetical protein CARUB_v10026718mg             183   5e-52   Capsella rubella
ref|XP_010458286.1|  PREDICTED: post-GPI attachment to proteins f...    182   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007149294.1|  hypothetical protein PHAVU_005G058200g             182   2e-51   Phaseolus vulgaris [French bean]
ref|XP_004985958.1|  PREDICTED: post-GPI attachment to proteins f...    182   2e-51   Setaria italica
ref|XP_010523600.1|  PREDICTED: post-GPI attachment to proteins f...    183   3e-51   Tarenaya hassleriana [spider flower]
emb|CDY55489.1|  BnaCnng29030D                                          178   4e-51   Brassica napus [oilseed rape]
gb|EMT25149.1|  hypothetical protein F775_19461                         180   9e-51   
emb|CDY66169.1|  BnaCnng49780D                                          176   1e-50   Brassica napus [oilseed rape]
gb|ACF87974.1|  unknown                                                 178   1e-50   Zea mays [maize]
ref|XP_002866473.1|  hypothetical protein ARALYDRAFT_919464             179   1e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_010444070.1|  PREDICTED: post-GPI attachment to proteins f...    179   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_007211583.1|  hypothetical protein PRUPE_ppa008593m1g            172   3e-50   
ref|NP_001142245.1|  hypothetical protein precursor                     178   4e-50   Zea mays [maize]
ref|XP_003545917.1|  PREDICTED: post-GPI attachment to proteins f...    178   4e-50   Glycine max [soybeans]
gb|EMS62696.1|  hypothetical protein TRIUR3_14941                       178   4e-50   Triticum urartu
ref|XP_002465979.1|  hypothetical protein SORBIDRAFT_01g049340          178   4e-50   Sorghum bicolor [broomcorn]
ref|XP_010229303.1|  PREDICTED: post-GPI attachment to proteins f...    176   2e-49   
gb|KHN27719.1|  Post-GPI attachment to proteins factor 3                176   2e-49   Glycine soja [wild soybean]
emb|CDY51101.1|  BnaCnng20040D                                          171   3e-49   Brassica napus [oilseed rape]
ref|XP_003558964.1|  PREDICTED: post-GPI attachment to proteins f...    175   7e-49   Brachypodium distachyon [annual false brome]
ref|XP_002964918.1|  hypothetical protein SELMODRAFT_167352             173   3e-48   Selaginella moellendorffii
ref|XP_008668589.1|  PREDICTED: hypothetical protein isoform X1         177   3e-48   
ref|XP_002986499.1|  hypothetical protein SELMODRAFT_124213             173   4e-48   Selaginella moellendorffii
emb|CDY27430.1|  BnaC03g64700D                                          164   5e-47   Brassica napus [oilseed rape]
gb|AFW89791.1|  hypothetical protein ZEAMMB73_859279                    169   5e-47   
ref|NP_001141237.1|  hypothetical protein precursor                     169   2e-46   Zea mays [maize]
gb|AFW89789.1|  hypothetical protein ZEAMMB73_859279                    169   2e-46   
ref|XP_010919212.1|  PREDICTED: post-GPI attachment to proteins f...    168   2e-46   Elaeis guineensis
ref|XP_010919213.1|  PREDICTED: post-GPI attachment to proteins f...    168   3e-46   Elaeis guineensis
gb|KCW90759.1|  hypothetical protein EUGRSUZ_A02835                     166   4e-46   Eucalyptus grandis [rose gum]
ref|XP_006661973.1|  PREDICTED: post-GPI attachment to proteins f...    167   6e-46   Oryza brachyantha
emb|CDX73479.1|  BnaC08g25240D                                          161   6e-46   
gb|AFK33317.1|  unknown                                                 160   1e-45   Medicago truncatula
emb|CDX85322.1|  BnaC07g26330D                                          162   1e-45   
ref|NP_001065105.1|  Os10g0524100                                       166   2e-45   
gb|EAY79263.1|  hypothetical protein OsI_34379                          166   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_007149295.1|  hypothetical protein PHAVU_005G058200g             166   2e-45   Phaseolus vulgaris [French bean]
ref|XP_007022228.1|  Per1-like family protein isoform 7                 159   6e-43   
ref|XP_007022226.1|  Per1-like family protein isoform 5                 159   1e-42   
emb|CDY50719.1|  BnaCnng19530D                                          152   1e-42   Brassica napus [oilseed rape]
gb|EAY79260.1|  hypothetical protein OsI_34376                          157   4e-42   Oryza sativa Indica Group [Indian rice]
emb|CDY22428.1|  BnaC03g61410D                                          146   7e-39   Brassica napus [oilseed rape]
emb|CDY34434.1|  BnaC01g21990D                                          134   1e-34   Brassica napus [oilseed rape]
emb|CDY63979.1|  BnaCnng42900D                                          122   4e-31   Brassica napus [oilseed rape]
emb|CDY43293.1|  BnaC06g01750D                                          124   6e-31   Brassica napus [oilseed rape]
ref|XP_006422203.1|  hypothetical protein CICLE_v10005304mg             124   3e-30   
ref|XP_007213774.1|  hypothetical protein PRUPE_ppa024516m1g            115   1e-28   
gb|KEH26892.1|  post-GPI attachment-like factor-protein                 115   2e-28   Medicago truncatula
gb|KJB52865.1|  hypothetical protein B456_008G280700                    117   9e-28   Gossypium raimondii
gb|AFK49320.1|  unknown                                                 111   3e-27   Lotus japonicus
gb|AES76445.2|  post-GPI attachment-like factor-protein                 115   4e-27   Medicago truncatula
ref|XP_006421843.1|  hypothetical protein CICLE_v10005347mg             115   5e-27   
ref|XP_004171395.1|  PREDICTED: post-GPI attachment to proteins f...    114   9e-27   
emb|CDY26180.1|  BnaA06g12370D                                          111   9e-27   Brassica napus [oilseed rape]
emb|CDY02556.1|  BnaA08g01630D                                          111   1e-26   
ref|XP_009788344.1|  PREDICTED: post-GPI attachment to proteins f...    107   9e-24   Nicotiana sylvestris
gb|KDO46709.1|  hypothetical protein CISIN_1g018683mg                   103   1e-22   Citrus sinensis [apfelsine]
ref|XP_010739161.1|  PREDICTED: post-GPI attachment to proteins f...  99.8    5e-21   Larimichthys crocea [croceine croaker]
emb|CBZ39512.1|  td11ITM2 protein                                     94.0    6e-21   Triticum turgidum subsp. durum
ref|XP_008435790.1|  PREDICTED: post-GPI attachment to proteins f...  99.0    7e-21   Poecilia reticulata
ref|XP_005810657.1|  PREDICTED: post-GPI attachment to proteins f...  98.6    9e-21   
ref|XP_004080335.1|  PREDICTED: post-GPI attachment to proteins f...  99.0    9e-21   Oryzias latipes [Japanese rice fish]
ref|XP_008312260.1|  PREDICTED: post-GPI attachment to proteins f...  98.2    1e-20   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_787276.2|  PREDICTED: post-GPI attachment to proteins fact...  97.8    2e-20   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003458790.2|  PREDICTED: post-GPI attachment to proteins f...  97.4    3e-20   Oreochromis niloticus
ref|XP_007572869.1|  PREDICTED: post-GPI attachment to proteins f...  97.4    3e-20   Poecilia formosa
emb|CBN81402.1|  Post-GPI attachment to proteins factor 3             97.1    4e-20   Dicentrarchus labrax [European sea bass]
ref|XP_006805747.1|  PREDICTED: post-GPI attachment to proteins f...  97.1    4e-20   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008281815.1|  PREDICTED: post-GPI attachment to proteins f...  96.3    7e-20   Stegastes partitus
ref|XP_005947497.1|  PREDICTED: post-GPI attachment to proteins f...  96.3    8e-20   Haplochromis burtoni
ref|XP_005749356.1|  PREDICTED: post-GPI attachment to proteins f...  96.3    8e-20   Pundamilia nyererei
ref|XP_010770964.1|  PREDICTED: post-GPI attachment to proteins f...  95.9    8e-20   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010902233.1|  PREDICTED: post-GPI attachment to proteins f...  95.9    9e-20   Esox lucius
ref|XP_004575037.1|  PREDICTED: post-GPI attachment to proteins f...  95.9    9e-20   Maylandia zebra
ref|XP_007239376.1|  PREDICTED: post-GPI attachment to proteins f...  94.7    2e-19   
ref|XP_008657726.1|  PREDICTED: post-GPI attachment to proteins f...  92.0    4e-19   
ref|XP_007062025.1|  PREDICTED: post-GPI attachment to proteins f...  93.2    5e-19   
ref|XP_008666951.1|  PREDICTED: post-GPI attachment to proteins f...  91.3    5e-19   
ref|XP_003961434.1|  PREDICTED: post-GPI attachment to proteins f...  93.6    7e-19   Takifugu rubripes [tiger puffer]
ref|XP_005845196.1|  hypothetical protein CHLNCDRAFT_26223            92.8    8e-19   Chlorella variabilis
emb|CDY61124.1|  BnaC05g51990D                                        89.0    1e-18   Brassica napus [oilseed rape]
tpg|DAA52253.1|  TPA: hypothetical protein ZEAMMB73_366866            92.8    1e-18   
ref|XP_006394430.1|  hypothetical protein EUTSA_v10004514mg           91.7    1e-18   
gb|ETE72876.1|  Post-GPI attachment to proteins factor 3              91.7    2e-18   Ophiophagus hannah
tpg|DAA52252.1|  TPA: hypothetical protein ZEAMMB73_366866            92.4    2e-18   
ref|XP_002954799.1|  hypothetical protein VOLCADRAFT_44760            90.9    3e-18   Volvox carteri f. nagariensis
ref|XP_008679020.1|  PREDICTED: post-GPI attachment to proteins f...  90.1    3e-18   
ref|XP_005294203.1|  PREDICTED: post-GPI attachment to proteins f...  91.3    3e-18   Chrysemys picta bellii
emb|CEI90577.1|  hypothetical protein RMCBS344292_04899               90.5    3e-18   Rhizopus microsporus
ref|XP_003786463.1|  PREDICTED: post-GPI attachment to proteins f...  90.9    4e-18   Otolemur garnettii
ref|XP_008679019.1|  PREDICTED: post-GPI attachment to proteins f...  90.1    4e-18   
ref|XP_006676575.1|  hypothetical protein BATDEDRAFT_18873            90.9    5e-18   Batrachochytrium dendrobatidis JAM81
emb|CDX87260.1|  BnaC09g05750D                                        88.2    5e-18   
ref|XP_008653826.1|  PREDICTED: post-GPI attachment to proteins f...  89.7    6e-18   
ref|XP_005994118.1|  PREDICTED: post-GPI attachment to proteins f...  90.5    6e-18   
gb|ELU10150.1|  hypothetical protein CAPTEDRAFT_219496                90.5    6e-18   Capitella teleta
gb|ESA00216.1|  hypothetical protein GLOINDRAFT_69438                 90.5    6e-18   
gb|AFW63553.1|  hypothetical protein ZEAMMB73_769729                  90.9    7e-18   
ref|XP_006022655.1|  PREDICTED: post-GPI attachment to proteins f...  90.1    7e-18   Alligator sinensis
emb|CDX79390.1|  BnaC06g19130D                                        88.2    8e-18   
ref|XP_005394375.1|  PREDICTED: post-GPI attachment to proteins f...  89.7    8e-18   Chinchilla lanigera
ref|XP_007424262.1|  PREDICTED: post-GPI attachment to proteins f...  90.1    9e-18   Python bivittatus
gb|AFW82647.1|  hypothetical protein ZEAMMB73_016301                  92.0    1e-17   
ref|XP_005394374.1|  PREDICTED: post-GPI attachment to proteins f...  89.7    1e-17   Chinchilla lanigera
ref|XP_010725828.1|  PREDICTED: post-GPI attachment to proteins f...  89.0    1e-17   Meleagris gallopavo [common turkey]
ref|XP_006260277.1|  PREDICTED: post-GPI attachment to proteins f...  89.7    1e-17   Alligator mississippiensis
emb|CEI96473.1|  hypothetical protein RMCBS344292_10633               89.4    1e-17   Rhizopus microsporus
ref|XP_007482370.1|  PREDICTED: post-GPI attachment to proteins f...  89.0    1e-17   
tpg|DAA60857.1|  TPA: hypothetical protein ZEAMMB73_967237            89.7    1e-17   
ref|XP_010725826.1|  PREDICTED: post-GPI attachment to proteins f...  88.6    2e-17   
ref|XP_001370840.1|  PREDICTED: post-GPI attachment to proteins f...  89.0    2e-17   
emb|CEG71087.1|  hypothetical protein RMATCC62417_06875               88.6    2e-17   
ref|XP_004764703.1|  PREDICTED: post-GPI attachment to proteins f...  88.6    2e-17   
ref|XP_005156102.1|  PREDICTED: post-GPI attachment to proteins f...  88.6    3e-17   
ref|XP_003466972.1|  PREDICTED: post-GPI attachment to proteins f...  88.2    3e-17   
ref|XP_007482368.1|  PREDICTED: post-GPI attachment to proteins f...  88.6    3e-17   
ref|XP_003642860.1|  PREDICTED: post-GPI attachment to proteins f...  88.2    4e-17   
ref|XP_004655527.1|  PREDICTED: post-GPI attachment to proteins f...  87.8    4e-17   
ref|NP_001271369.1|  post-GPI attachment to proteins factor 3 pre...  87.8    5e-17   
ref|XP_008517101.1|  PREDICTED: post-GPI attachment to proteins f...  86.7    6e-17   
dbj|GAN01072.1|  conserved hypothetical protein                       87.4    6e-17   
ref|XP_005368340.1|  PREDICTED: post-GPI attachment to proteins f...  87.4    6e-17   
ref|XP_001501181.1|  PREDICTED: post-GPI attachment to proteins f...  87.4    7e-17   
ref|NP_001108063.1|  post-GPI attachment to proteins factor 3 pre...  87.4    7e-17   
ref|XP_006940364.1|  PREDICTED: post-GPI attachment to proteins f...  87.0    7e-17   
ref|XP_008517100.1|  PREDICTED: post-GPI attachment to proteins f...  86.7    7e-17   
ref|XP_003131568.3|  PREDICTED: post-GPI attachment to proteins f...  87.0    8e-17   
ref|XP_003996830.1|  PREDICTED: post-GPI attachment to proteins f...  87.0    9e-17   
ref|XP_007085925.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  87.0    9e-17   
ref|XP_008517098.1|  PREDICTED: post-GPI attachment to proteins f...  86.7    1e-16   
ref|XP_008517097.1|  PREDICTED: post-GPI attachment to proteins f...  86.3    1e-16   
emb|CEG83689.1|  hypothetical protein RMATCC62417_17568               86.3    1e-16   
gb|EHH58072.1|  PER1-like domain-containing protein 1                 86.7    1e-16   
ref|XP_004395103.1|  PREDICTED: post-GPI attachment to proteins f...  86.7    1e-16   
ref|XP_010377600.1|  PREDICTED: post-GPI attachment to proteins f...  86.7    1e-16   
ref|XP_003414744.1|  PREDICTED: post-GPI attachment to proteins f...  86.7    1e-16   
ref|XP_007112601.1|  PREDICTED: post-GPI attachment to proteins f...  86.3    1e-16   
gb|EPB92095.1|  hypothetical protein HMPREF1544_01159                 86.3    2e-16   
gb|EHH24900.1|  PER1-like domain-containing protein 1                 86.3    2e-16   
ref|XP_004859545.1|  PREDICTED: post-GPI attachment to proteins f...  86.3    2e-16   
ref|NP_001252663.1|  post-GPI attachment to proteins factor 3 pre...  86.3    2e-16   
ref|NP_001278655.1|  post-GPI attachment to proteins factor 3 iso...  85.5    2e-16   
ref|XP_004434624.1|  PREDICTED: post-GPI attachment to proteins f...  85.9    2e-16   
ref|XP_003278279.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    2e-16   
ref|XP_004041878.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
dbj|BAG62705.1|  unnamed protein product                              85.1    3e-16   
ref|XP_005321841.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_006533613.1|  PREDICTED: post-GPI attachment to proteins f...  85.1    3e-16   
ref|XP_005964807.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_006971904.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_007465229.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|NP_219487.3|  post-GPI attachment to proteins factor 3 isofor...  85.5    3e-16   
ref|XP_002827692.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
emb|CDQ75401.1|  unnamed protein product                              85.5    3e-16   
ref|XP_002748572.2|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_004633765.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_003942893.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_511460.1|  PREDICTED: post-GPI attachment to proteins fact...  85.5    3e-16   
ref|XP_006156089.1|  PREDICTED: post-GPI attachment to proteins f...  85.9    3e-16   
ref|XP_003278278.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_004282779.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    3e-16   
ref|XP_004948650.1|  PREDICTED: post-GPI attachment to proteins f...  86.3    3e-16   
ref|XP_005531473.1|  PREDICTED: post-GPI attachment to proteins f...  85.5    4e-16   
gb|AAH30368.1|  Perld1 protein                                        84.3    4e-16   
gb|ELW54888.1|  Post-GPI attachment to proteins factor 3              85.1    4e-16   
ref|XP_006533612.1|  PREDICTED: post-GPI attachment to proteins f...  84.7    4e-16   
ref|XP_004311611.1|  PREDICTED: post-GPI attachment to proteins f...  85.1    4e-16   
ref|XP_006214312.1|  PREDICTED: post-GPI attachment to proteins f...  85.1    4e-16   
ref|XP_010958773.1|  PREDICTED: post-GPI attachment to proteins f...  85.1    4e-16   
ref|NP_001087556.1|  post-GPI attachment to proteins factor 3 pre...  85.1    4e-16   
ref|XP_007531010.1|  PREDICTED: post-GPI attachment to proteins f...  85.1    4e-16   
ref|XP_007177624.1|  PREDICTED: post-GPI attachment to proteins f...  85.1    4e-16   
ref|XP_008843536.1|  PREDICTED: post-GPI attachment to proteins f...  85.1    5e-16   
ref|NP_001028709.2|  post-GPI attachment to proteins factor 3 pre...  85.1    5e-16   
ref|XP_004463081.1|  PREDICTED: post-GPI attachment to proteins f...  84.7    5e-16   
ref|XP_006117462.1|  PREDICTED: post-GPI attachment to proteins f...  84.0    6e-16   
ref|NP_001072247.1|  post-GPI attachment to proteins factor 3 pre...  84.3    6e-16   
ref|XP_008198099.1|  PREDICTED: post-GPI attachment to proteins f...  84.3    7e-16   
emb|CDH51586.1|  mn2 homeostasis protein per1                         84.3    8e-16   
ref|XP_006924763.1|  PREDICTED: post-GPI attachment to proteins f...  84.3    8e-16   
ref|XP_008111540.1|  PREDICTED: post-GPI attachment to proteins f...  84.3    8e-16   
ref|XP_003222491.2|  PREDICTED: post-GPI attachment to proteins f...  84.7    9e-16   
gb|KEQ73016.1|  Per1-like protein                                     84.0    1e-15   
gb|KFH65090.1|  hypothetical protein MVEG_08571                       84.3    1e-15   
ref|XP_006889452.1|  PREDICTED: post-GPI attachment to proteins f...  84.0    1e-15   
ref|XP_008766335.1|  PREDICTED: post-GPI attachment to proteins f...  83.6    1e-15   
ref|XP_008588014.1|  PREDICTED: post-GPI attachment to proteins f...  84.0    1e-15   
ref|XP_004378092.1|  PREDICTED: post-GPI attachment to proteins f...  84.0    1e-15   
dbj|BAC11642.1|  unnamed protein product                              83.2    1e-15   
ref|XP_010990123.1|  PREDICTED: post-GPI attachment to proteins f...  83.6    1e-15   
ref|XP_004684304.1|  PREDICTED: post-GPI attachment to proteins f...  83.2    1e-15   
ref|XP_005693807.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  83.6    2e-15   
ref|XP_005104826.1|  PREDICTED: post-GPI attachment to proteins f...  83.6    2e-15   
ref|XP_004591202.1|  PREDICTED: post-GPI attachment to proteins f...  83.6    2e-15   
emb|CDY31921.1|  BnaC09g28230D                                        79.7    2e-15   
ref|NP_001137367.1|  post-GPI attachment to proteins factor 3 pre...  83.2    2e-15   
ref|XP_005220776.1|  PREDICTED: post-GPI attachment to proteins f...  82.8    2e-15   
ref|XP_008070803.1|  PREDICTED: post-GPI attachment to proteins f...  82.8    2e-15   
dbj|BAE42049.1|  unnamed protein product                              83.2    2e-15   
ref|XP_010840965.1|  PREDICTED: post-GPI attachment to proteins f...  82.8    2e-15   
ref|XP_004684302.1|  PREDICTED: post-GPI attachment to proteins f...  83.2    2e-15   
emb|CEP08422.1|  hypothetical protein                                 85.9    2e-15   
ref|XP_005075993.1|  PREDICTED: post-GPI attachment to proteins f...  83.2    2e-15   
ref|XP_006832620.1|  PREDICTED: post-GPI attachment to proteins f...  82.8    2e-15   
ref|XP_011235688.1|  PREDICTED: post-GPI attachment to proteins f...  82.4    3e-15   
ref|NP_001098833.1|  post-GPI attachment to proteins factor 3 pre...  82.8    3e-15   
ref|XP_008070788.1|  PREDICTED: post-GPI attachment to proteins f...  82.8    3e-15   
ref|XP_010840964.1|  PREDICTED: post-GPI attachment to proteins f...  82.8    3e-15   
gb|AEW08974.1|  hypothetical protein CL2595Contig1_05                 78.2    3e-15   
ref|XP_001634224.1|  predicted protein                                82.4    3e-15   
emb|CDH49221.1|  per1-like protein                                    82.4    4e-15   
gb|KIY99526.1|  hypothetical protein MNEG_8435                        83.6    4e-15   
ref|XP_007940229.1|  PREDICTED: post-GPI attachment to proteins f...  81.6    4e-15   
ref|XP_011381324.1|  PREDICTED: post-GPI attachment to proteins f...  82.0    4e-15   
ref|XP_002929402.1|  PREDICTED: post-GPI attachment to proteins f...  82.0    4e-15   
ref|XP_001650006.1|  AAEL004910-PA                                    82.0    5e-15   
ref|XP_794806.2|  PREDICTED: post-GPI attachment to proteins fact...  80.5    5e-15   
ref|XP_006774493.1|  PREDICTED: post-GPI attachment to proteins f...  81.6    6e-15   
gb|AEW08975.1|  hypothetical protein CL2595Contig1_05                 77.4    6e-15   
ref|XP_005059868.1|  PREDICTED: post-GPI attachment to proteins f...  82.8    6e-15   
ref|XP_008152088.1|  PREDICTED: post-GPI attachment to proteins f...  81.6    6e-15   
ref|XP_007940227.1|  PREDICTED: post-GPI attachment to proteins f...  81.6    7e-15   
emb|CDS04990.1|  hypothetical protein LRAMOSA07520                    82.0    7e-15   
ref|XP_011381323.1|  PREDICTED: post-GPI attachment to proteins f...  82.0    7e-15   
ref|XP_007899636.1|  PREDICTED: post-GPI attachment to proteins f...  80.1    8e-15   
gb|KEQ80347.1|  Per1-like protein                                     81.3    9e-15   
ref|XP_005898066.1|  PREDICTED: post-GPI attachment to proteins f...  81.3    1e-14   
ref|XP_005861951.1|  PREDICTED: post-GPI attachment to proteins f...  81.3    1e-14   
ref|XP_006100845.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  80.9    1e-14   
emb|CDS07088.1|  hypothetical protein LRAMOSA09611                    80.9    1e-14   
ref|XP_006176416.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  80.5    2e-14   
ref|XP_004707177.1|  PREDICTED: post-GPI attachment to proteins f...  79.7    2e-14   
ref|XP_005439443.1|  PREDICTED: post-GPI attachment to proteins f...  79.7    2e-14   
gb|EPY87156.1|  post-GPI attachment to proteins factor 3-like iso...  79.7    2e-14   
ref|XP_005431774.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  78.6    3e-14   
gb|EFA09753.1|  hypothetical protein TcasGA2_TC011892                 80.1    3e-14   
gb|EPQ05047.1|  Post-GPI attachment to proteins factor 3              80.5    3e-14   
gb|KGG52930.1|  hypothetical protein DI09_123p100                     79.7    4e-14   
ref|XP_002407981.1|  post-GPI attachment to proteins factor, puta...  80.5    4e-14   
gb|EPX73000.1|  GPI-phospholipase A2 activity regulator               79.7    4e-14   
dbj|GAM88072.1|  hypothetical protein ANO11243_061020                 79.3    5e-14   
ref|XP_005232756.1|  PREDICTED: post-GPI attachment to proteins f...  77.8    7e-14   
ref|XP_004799098.1|  PREDICTED: post-GPI attachment to proteins f...  79.0    1e-13   
ref|NP_001233642.1|  post-GPI attachment to proteins factor 3 pre...  78.2    1e-13   
gb|KEQ96405.1|  hypothetical protein AUEXF2481DRAFT_64474             77.8    1e-13   
gb|KFO69408.1|  Post-GPI attachment to proteins factor 3              76.6    1e-13   
gb|KEQ65839.1|  Per1-like family protein                              77.0    2e-13   
ref|XP_011449238.1|  PREDICTED: post-GPI attachment to proteins f...  77.8    2e-13   
ref|XP_001864441.1|  conserved hypothetical protein                   77.4    2e-13   
ref|XP_010584003.1|  PREDICTED: post-GPI attachment to proteins f...  78.2    2e-13   
ref|XP_009569074.1|  PREDICTED: post-GPI attachment to proteins f...  76.6    2e-13   
ref|NP_593834.1|  GPI-phospholipase A2 activity regulator (predic...  77.4    2e-13   
emb|CAG12654.1|  unnamed protein product                              77.0    2e-13   
emb|CDY61123.1|  BnaC05g51980D                                        72.4    3e-13   
gb|EPY52414.1|  GPI-phospholipase A2 activity regulator               77.0    4e-13   
ref|XP_503274.1|  YALI0D25454p                                        76.6    4e-13   
ref|XP_004209649.1|  PREDICTED: uncharacterized protein LOC101240231  76.3    7e-13   
ref|XP_002116782.1|  hypothetical protein TRIADDRAFT_31335            75.9    8e-13   
gb|EIE84161.1|  hypothetical protein RO3G_08871                       77.4    1e-12   
ref|XP_008517099.1|  PREDICTED: post-GPI attachment to proteins f...  74.3    1e-12   
gb|KFB47003.1|  AGAP005392-PA-like protein                            75.1    2e-12   
gb|AFK38324.1|  unknown                                               73.6    2e-12   
ref|XP_002176043.1|  GPI-phospholipase A2 activity regulator          74.7    2e-12   
ref|XP_004522696.1|  PREDICTED: post-GPI attachment to proteins f...  74.7    2e-12   
ref|XP_006695795.1|  hypothetical protein CTHT_0054610                75.1    2e-12   
gb|ELR54780.1|  Post-GPI attachment to proteins factor 3              74.3    3e-12   
ref|XP_002125801.1|  PREDICTED: post-GPI attachment to proteins f...  73.9    4e-12   
ref|XP_009025273.1|  hypothetical protein HELRODRAFT_95556            73.6    4e-12   
ref|XP_009655353.1|  PER1 protein                                     73.6    6e-12   
gb|ETN61145.1|  Post-GPI attachment to protein factor 3               72.8    1e-11   
ref|XP_007638499.1|  PREDICTED: post-GPI attachment to proteins f...  72.8    1e-11   
ref|XP_002479940.1|  Mn2 homeostasis protein (Per1), putative         72.8    1e-11   
gb|KIW37613.1|  hypothetical protein PV06_10255                       72.4    2e-11   
ref|XP_002781217.1|  conserved hypothetical protein                   72.8    2e-11   
ref|XP_003656805.1|  hypothetical protein THITE_2121961               72.0    2e-11   
ref|XP_001244089.1|  hypothetical protein CIMG_03530                  70.5    2e-11   
ref|XP_001220643.1|  hypothetical protein CHGG_01422                  72.0    2e-11   
gb|KIW12574.1|  hypothetical protein PV08_09851                       71.6    3e-11   
ref|XP_661839.1|  hypothetical protein AN4235.2                       71.2    3e-11   
gb|KEI40932.1|  hypothetical protein L969DRAFT_86185                  72.0    3e-11   
gb|EPB91026.1|  hypothetical protein HMPREF1544_02095                 71.2    3e-11   
emb|CCG84234.1|  protein of unknown function                          71.2    3e-11   
ref|XP_964817.3|  Mn2+ homeostasis protein Per1                       71.6    3e-11   
ref|XP_003068690.1|  Per1-like family protein                         70.5    4e-11   
tpe|CBF74426.1|  TPA: Mn2+ homeostasis protein (Per1), putative (...  71.2    4e-11   
gb|KFX49309.1|  Protein PER1 like                                     69.7    4e-11   
ref|XP_001701622.1|  predicted protein                                70.9    4e-11   
emb|CDP23167.1|  Putative protein of unknown function                 69.7    4e-11   
gb|EFQ28773.1|  hypothetical protein GLRG_03917                       71.2    4e-11   
dbj|GAA94883.1|  hypothetical protein E5Q_01538                       71.6    4e-11   
dbj|GAM39653.1|  hypothetical protein TCE0_034f11376                  70.9    5e-11   
ref|XP_007913219.1|  putative mn2+ homeostasis protein per1 protein   70.9    5e-11   
ref|XP_001212166.1|  conserved hypothetical protein                   70.9    5e-11   
emb|CCF44738.1|  hypothetical protein CH063_03414                     70.5    5e-11   
ref|XP_009047399.1|  hypothetical protein LOTGIDRAFT_138807           70.5    5e-11   
gb|EFW20582.1|  Mn2+ homeostasis protein                              70.9    6e-11   
gb|KEF52362.1|  hypothetical protein A1O9_11603                       68.6    6e-11   
ref|XP_003786464.1|  PREDICTED: post-GPI attachment to proteins f...  70.1    6e-11   
gb|EYE99388.1|  Mn2+ homeostasis protein                              70.5    7e-11   
dbj|GAN03920.1|  per1-like protein                                    69.7    7e-11   
gb|KIH90393.1|  hypothetical protein SPBR_00688                       70.5    8e-11   
gb|ERS97992.1|  hypothetical protein HMPREF1624_06165                 70.5    8e-11   
ref|XP_315401.4|  AGAP005392-PA                                       70.1    1e-10   
gb|ELT94072.1|  hypothetical protein CAPTEDRAFT_139412                69.3    1e-10   
ref|XP_007482369.1|  PREDICTED: post-GPI attachment to proteins f...  69.7    1e-10   
gb|EAS32506.3|  Mn2+ homeostasis protein                              69.7    1e-10   
ref|XP_002600731.1|  hypothetical protein BRAFLDRAFT_83474            70.9    1e-10   
ref|XP_006822127.1|  PREDICTED: post-GPI attachment to proteins f...  68.6    1e-10   
ref|XP_002143617.1|  Mn2+ homeostasis protein (Per1), putative        69.7    1e-10   
gb|ENH77007.1|  mn2+ homeostasis protein                              69.3    2e-10   
dbj|GAA89994.1|  Mn2+ homeostasis protein                             69.3    2e-10   
emb|CAX73357.1|  Protein PER1 precursor                               68.6    2e-10   
ref|XP_001398972.2|  Mn2+ homeostasis protein (Per1)                  68.9    2e-10   
ref|XP_004921568.1|  PREDICTED: post-GPI attachment to proteins f...  67.4    2e-10   
emb|CBY23301.1|  unnamed protein product                              67.0    2e-10   
gb|KFY74872.1|  hypothetical protein V499_05132                       67.8    2e-10   
gb|EZF34264.1|  hypothetical protein H101_02202                       67.4    3e-10   
emb|CEL61772.1|  Protein PER1 homolog OS=Schizosaccharomyces pomb...  67.4    3e-10   
ref|XP_011196627.1|  PREDICTED: post-GPI attachment to proteins f...  68.9    3e-10   
ref|XP_011209814.1|  PREDICTED: post-GPI attachment to proteins f...  68.9    3e-10   
gb|KDB22724.1|  hypothetical protein H109_05390                       67.4    3e-10   
gb|EEH19943.1|  hypothetical protein PABG_02202                       68.6    3e-10   
gb|EPS27679.1|  hypothetical protein PDE_02623                        68.6    3e-10   
ref|XP_011209815.1|  PREDICTED: post-GPI attachment to proteins f...  68.6    4e-10   
gb|KDN64865.1|  hypothetical protein CSUB01_02355                     68.6    4e-10   
ref|XP_004921566.1|  PREDICTED: post-GPI attachment to proteins f...  67.4    4e-10   
ref|XP_010756422.1|  hypothetical protein PADG_00603                  68.2    4e-10   
gb|KIJ63364.1|  hypothetical protein HYDPIDRAFT_92761                 68.2    4e-10   



>ref|NP_001275064.1| Per1-like family protein precursor [Solanum tuberosum]
 gb|ABB72805.1| Per1-like family protein [Solanum tuberosum]
Length=342

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV+LTE+LD+SSAVALLGFS+ILA+LR FNV DEA RVMV++P++AFVTTHIL
Sbjct  179  SVVFHSRDVNLTEKLDYSSAVALLGFSLILAVLRVFNVTDEAARVMVSAPLVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYGLN KVC GM + +L +W VWAGV+RHPSRWKLWVVVIGG +A ++E++DF
Sbjct  239  YLNCYQLDYGLNMKVCLGMGILQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+WSFVRDDSEFRTT+L KKAK
Sbjct  299  PPYRGFVDAHALWHATTIPLTYLWWSFVRDDSEFRTTTLIKKAK  342



>gb|KDO46714.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=276

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+ D+SSAVALLGFS+ILAILR+FNVRDEA RVMVA+P++AFVTTHIL
Sbjct  113  SAVFHSRDVDLTEKFDYSSAVALLGFSLILAILRSFNVRDEAARVMVAAPLLAFVTTHIL  172

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +A+L IW  WAG++RHPSRWKLWVVV GG +A ++E++DF
Sbjct  173  YLNFYKLDYGWNMKVCVVMAVAQLLIWATWAGITRHPSRWKLWVVVFGGALAMLLEIYDF  232

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY+G++DAHA+WHAT IPLTY++WSF+RDD+EF+T ++ KKAK
Sbjct  233  PPYYGFLDAHAIWHATTIPLTYIWWSFIRDDAEFQTANMLKKAK  276



>gb|ACB45085.1| PERLD1 [Solanum commersonii]
Length=307

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDVDLTE+LD+SSAVALLGFS+ILA+LR F+V DEA RVMV++P++AFVTTHIL
Sbjct  144  SVVFHSRDVDLTEKLDYSSAVALLGFSLILAVLRVFSVTDEAARVMVSAPLVAFVTTHIL  203

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYGLN KVC GM + +L +W VWAGV+RHPSRWKLWVVVIGG +A ++E++DF
Sbjct  204  YLNCYQLDYGLNMKVCLGMGILQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDF  263

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+W+FVRDDSEFRTT+L KKAK
Sbjct  264  PPYRGFVDAHALWHATTIPLTYLWWNFVRDDSEFRTTTLIKKAK  307



>ref|XP_006421845.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|ESR35085.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
Length=204

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGF+ ILAILR F+VRDEA RVMVA+P+IAFVTTHIL
Sbjct  41   SAVFHSRDVELTEKLDCSSAVALLGFNFILAILRAFSVRDEAARVMVAAPLIAFVTTHIL  100

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D+GLN KVC  M +A+L IW +WAGV+RHPSRWKLW+VV+G  +A +++++DF
Sbjct  101  YLNFYKLDHGLNMKVCLAMGVAQLLIWAIWAGVTRHPSRWKLWLVVVGEGLAMLLQIYDF  160

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA++HA  IPLTYL+WSF+RDDSEFRTT+L KK K
Sbjct  161  PPYRGFVDAHALYHAANIPLTYLWWSFIRDDSEFRTTALLKKPK  204



>ref|XP_002280194.1| PREDICTED: post-GPI attachment to proteins factor 3 [Vitis vinifera]
 emb|CAN61923.1| hypothetical protein VITISV_036651 [Vitis vinifera]
 emb|CBI31849.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +AVFHSRDVDLTE+LD+SS VALLGF++ILAILR FNVRDEA RVM+A+P++AFVTTHIL
Sbjct  179  NAVFHSRDVDLTEKLDYSSGVALLGFTLILAILRAFNVRDEAARVMIAAPLMAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A+L +W VWAGV+ HPSRWKLWVVV+GG +A  +E++DF
Sbjct  239  YLNFYKLDYGLNMKVCLTMGIAQLLLWTVWAGVTHHPSRWKLWVVVVGGALAMFLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PYWG+VDAHAVWHA  IP TYL+WSFV+DDSEFRT++L KK K
Sbjct  299  PPYWGFVDAHAVWHALAIPFTYLWWSFVKDDSEFRTSALMKKVK  342



>ref|XP_011030038.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Populus euphratica]
Length=289

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGFS+ILAILR F++RDEA RVMV++PIIAFVTTHIL
Sbjct  126  SAVFHSRDVELTEKLDFSSAVALLGFSLILAILRAFSMRDEAARVMVSAPIIAFVTTHIL  185

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DYGLNRKVC  M +A+L IW VWAGV+ HPSR+KLWV ++GG +A ++E++DF
Sbjct  186  YLNFYNLDYGLNRKVCVAMGVAQLLIWAVWAGVTHHPSRFKLWVALVGGGLAILLEIYDF  245

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+WSFV+DD+EFRT+SL KK +
Sbjct  246  PPYHGFVDAHALWHATTIPLTYLWWSFVKDDAEFRTSSLLKKER  289



>ref|XP_011076241.1| PREDICTED: post-GPI attachment to proteins factor 3 [Sesamum 
indicum]
Length=342

 Score =   239 bits (611),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLG+S+ILAI+R F+VR EA RVMVA+P+IAFVTTHIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVALLGYSLILAIIRAFDVRLEAARVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQFDYG N KVC  M + +L +W VWAGV+RHPSRWKLWVVVIGG +A ++E++DF
Sbjct  239  YLNFYQFDYGWNMKVCVTMGILQLVVWAVWAGVTRHPSRWKLWVVVIGGALAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PYWG VDAHA+WHAT IPLTYL+WSFVRDD+EFRT+ L KK K
Sbjct  299  PPYWGLVDAHALWHATTIPLTYLWWSFVRDDTEFRTSVLIKKKK  342



>ref|XP_010035088.1| PREDICTED: post-GPI attachment to proteins factor 3 [Eucalyptus 
grandis]
 gb|KCW46381.1| hypothetical protein EUGRSUZ_K00216 [Eucalyptus grandis]
Length=342

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+VFHSRDVD TE+LD+SSAVALLGFS+ILA+LR FNVRDEA RVMVA+P+IAFVTTHIL
Sbjct  179  SSVFHSRDVDFTEKLDYSSAVALLGFSLILAVLRAFNVRDEAARVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L +W VWAGV+RHPSRWKLWVVV+GG  A ++E++DF
Sbjct  239  YLNFYKLDYGLNMKVCVAMGIGQLLLWAVWAGVTRHPSRWKLWVVVVGGAAAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPLTYL+WSF+RDD++F TT+L KK K
Sbjct  299  PPYLGYVDAHALWHATTIPLTYLWWSFIRDDADFMTTTLLKKKK  342



>ref|XP_006421842.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|ESR35082.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|KDO60108.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=254

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGF+ ILAILR F+VRDEA RVMVA+P+IAFVTTHIL
Sbjct  91   SAVFHSRDVELTEKLDCSSAVALLGFNFILAILRAFSVRDEAARVMVAAPLIAFVTTHIL  150

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D+GLN KVC  M +A+L IW +WAGV+RHPSRWKLW+VV+G  +A +++++DF
Sbjct  151  YLNFYKLDHGLNMKVCLAMGVAQLLIWAIWAGVTRHPSRWKLWLVVVGEGLAMLLQIYDF  210

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA++HA  IPLTYL+WSF+RDDSEFRTT+L KK K
Sbjct  211  PPYRGFVDAHALYHAANIPLTYLWWSFIRDDSEFRTTALLKKPK  254



>gb|KDO60109.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=255

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGF+ ILAILR F+VRDEA RVMVA+P+IAFVTTHIL
Sbjct  92   SAVFHSRDVELTEKLDCSSAVALLGFNFILAILRAFSVRDEAARVMVAAPLIAFVTTHIL  151

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D+GLN KVC  M +A+L IW +WAGV+RHPSRWKLW+VV+G  +A +++++DF
Sbjct  152  YLNFYKLDHGLNMKVCLAMGVAQLLIWAIWAGVTRHPSRWKLWLVVVGEGLAMLLQIYDF  211

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA++HA  IPLTYL+WSF+RDDSEFRTT+L KK K
Sbjct  212  PPYRGFVDAHALYHAANIPLTYLWWSFIRDDSEFRTTALLKKPK  255



>ref|XP_006422204.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006422205.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006490486.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X4 [Citrus sinensis]
 ref|XP_006490492.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X4 [Citrus sinensis]
 gb|ESR35444.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|ESR35445.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|KDO46708.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=344

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+ D+SSAVALLGFS+ILAILR+FNVRDEA RVMVA+P++AFVTTHIL
Sbjct  181  SAVFHSRDVDLTEKFDYSSAVALLGFSLILAILRSFNVRDEAARVMVAAPLLAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +A+L IW  WAG++RHPSRWKLWVVV GG +A ++E++DF
Sbjct  241  YLNFYKLDYGWNMKVCVVMAVAQLLIWATWAGITRHPSRWKLWVVVFGGALAMLLEIYDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY+G++DAHA+WHAT IPLTY++WSF+RDD+EF+T ++ KKAK
Sbjct  301  PPYYGFLDAHAIWHATTIPLTYIWWSFIRDDAEFQTANMLKKAK  344



>ref|XP_006422207.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006490484.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Citrus sinensis]
 ref|XP_006490490.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Citrus sinensis]
 gb|ESR35447.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|KDO46712.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
 gb|KDO46713.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=352

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+ D+SSAVALLGFS+ILAILR+FNVRDEA RVMVA+P++AFVTTHIL
Sbjct  189  SAVFHSRDVDLTEKFDYSSAVALLGFSLILAILRSFNVRDEAARVMVAAPLLAFVTTHIL  248

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +A+L IW  WAG++RHPSRWKLWVVV GG +A ++E++DF
Sbjct  249  YLNFYKLDYGWNMKVCVVMAVAQLLIWATWAGITRHPSRWKLWVVVFGGALAMLLEIYDF  308

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY+G++DAHA+WHAT IPLTY++WSF+RDD+EF+T ++ KKAK
Sbjct  309  PPYYGFLDAHAIWHATTIPLTYIWWSFIRDDAEFQTANMLKKAK  352



>ref|XP_009758149.1| PREDICTED: post-GPI attachment to proteins factor 3-like, partial 
[Nicotiana sylvestris]
Length=162

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  697  RDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFYQ  518
            RDVDLTE+LD+SSAVALLGFS+ILA+LR FNVRDEA RVM A+PI+AFVTTHILYLN YQ
Sbjct  5    RDVDLTEKLDYSSAVALLGFSLILAVLRVFNVRDEAARVMAAAPILAFVTTHILYLNCYQ  64

Query  517  FDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGY  338
             DYG N KVC  M M +L +W VWAGV+RHPSRWKLWVVVIGG +AT++E++DF PY G+
Sbjct  65   LDYGWNMKVCMSMGMLQLVLWAVWAGVTRHPSRWKLWVVVIGGGLATLLELYDFPPYRGF  124

Query  337  VDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            VDAHA+WHAT IPLT L+WSFVRDDSEFRTT+L KKAK
Sbjct  125  VDAHALWHATTIPLTCLWWSFVRDDSEFRTTTLIKKAK  162



>gb|KDP22331.1| hypothetical protein JCGZ_26162 [Jatropha curcas]
Length=345

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD+SSAVALLGF++ILAILR F VRDEA RVMVA+P IAF+TTHI+
Sbjct  182  SAVFHSRDVELTEKLDYSSAVALLGFTLILAILRAFCVRDEAARVMVAAPGIAFLTTHIM  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY FDYGLN KVC  M +A+L IW VWAG++RHPSRWKLWVVV+GG +AT++E++DF
Sbjct  242  YLNFYNFDYGLNMKVCTAMSIAQLLIWAVWAGITRHPSRWKLWVVVVGGGLATLLEIYDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHA+ IPLTYL+WSFVRDD+EFRT+SL KK K
Sbjct  302  PPYHGFVDAHALWHASTIPLTYLWWSFVRDDAEFRTSSLLKKTK  345



>gb|ABB86252.1| Per1-like family protein [Solanum tuberosum]
Length=342

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV LTE+LD+SSAVALLGF +ILA+LR FNV DEA RVMV++P++AFVTTHIL
Sbjct  179  SVVFHSRDVYLTEKLDYSSAVALLGFPLILAVLRVFNVTDEAARVMVSAPLVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYGLN KVC GM + +L +W VWAGV+RHPSRWKLWVVVIGG +A ++E++DF
Sbjct  239  YLNCYQLDYGLNMKVCLGMGILQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+WSFVRDDSEFRTT+L KKAK
Sbjct  299  PPYRGFVDAHALWHATTIPLTYLWWSFVRDDSEFRTTTLIKKAK  342



>ref|XP_009586779.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   238 bits (606),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLGFS+ILA+LR FNVRDEA RVM ++PI+AFVTTHIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVALLGFSLILAVLRVFNVRDEAARVMASAPILAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYG N KVC  M M +L +W VWAGV+RHPSRWKLWVVVIGG +AT++E++DF
Sbjct  239  YLNCYQLDYGWNMKVCMSMGMLQLILWAVWAGVTRHPSRWKLWVVVIGGGLATLLELYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLT L+WSFVRDDSEFRT +L KKAK
Sbjct  299  PPYRGFVDAHALWHATTIPLTCLWWSFVRDDSEFRTKTLIKKAK  342



>ref|XP_004234349.1| PREDICTED: post-GPI attachment to proteins factor 3 [Solanum 
lycopersicum]
Length=342

 Score =   238 bits (606),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDVDLTE+LD+SSAVALLGFS+ILA+LR F+V  EA RVMV++P++AFVTTHIL
Sbjct  179  SVVFHSRDVDLTEKLDYSSAVALLGFSLILAVLRVFSVTAEAARVMVSAPLVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYGLN KVC GM + +L +W VWAGV+RHPSRWKLWVVVIGG +A ++E++DF
Sbjct  239  YLNCYQLDYGLNMKVCLGMGILQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+WSFVRDDSEFRTT+L KKAK
Sbjct  299  PPYRGFVDAHALWHATTIPLTYLWWSFVRDDSEFRTTTLIKKAK  342



>gb|EYU25051.1| hypothetical protein MIMGU_mgv1a009430mg [Erythranthe guttata]
Length=342

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLGFS+ILAI+R FNVR EA RVMVA+P+IAFVTTHIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVALLGFSLILAIIRAFNVRLEAARVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ DYGLN KVC  M + ++ IW VWAG++RHP+RWKLWVVV+GG +A ++E++DF
Sbjct  239  YLNFYQLDYGLNIKVCVAMGIIQMVIWAVWAGITRHPARWKLWVVVLGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G VDAHA+WHAT IPLTYL+WSF RDDSEFRT +L KK K
Sbjct  299  PPYKGLVDAHALWHATTIPLTYLWWSFARDDSEFRTNALIKKTK  342



>ref|XP_002513401.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48804.1| conserved hypothetical protein [Ricinus communis]
Length=293

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+VFHSRDVDLTERLD+SSAVALLG+S+ILAILRT N+R EA RVMV++P+IAFV THI 
Sbjct  130  SSVFHSRDVDLTERLDYSSAVALLGYSLILAILRTLNIRVEAKRVMVSAPLIAFVITHIS  189

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            +LNFY+ DYG N KVC  M +A+L IW +WAGVSRHPSRWKLW+VV+GG +A ++E++DF
Sbjct  190  FLNFYKMDYGWNMKVCVVMGVAQLLIWAIWAGVSRHPSRWKLWMVVVGGGLAMLLEIYDF  249

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+WHAT IPLTY++WSF+RDD+EFRT+SL KKAK
Sbjct  250  PPYKGFIDAHALWHATTIPLTYIWWSFIRDDAEFRTSSLLKKAK  293



>emb|CDP05250.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +AVFHSRDV+LTE+LD+SSAVALLG+S++LAILR FN+RDEA RVMVA+P+IAF+TTHIL
Sbjct  182  NAVFHSRDVELTEKLDYSSAVALLGYSLLLAILRVFNIRDEAARVMVAAPVIAFLTTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYGLN KVC  + + +L +W VWA VS+HPSRWKLW+VV GG +  ++E+FDF
Sbjct  242  YLNIYQLDYGLNMKVCVALGVTQLLLWAVWASVSQHPSRWKLWLVVAGGAIGMLLEIFDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PYWG+VDAHA+WHAT IPLTYL+WSF +DDSEFRT+ L KK K
Sbjct  302  PPYWGFVDAHALWHATTIPLTYLWWSFAKDDSEFRTSILVKKIK  345



>ref|XP_002513400.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48803.1| conserved hypothetical protein [Ricinus communis]
Length=328

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+VFHSRDVDLTERLD+SSAVALLG+S+ILAILRT N+R EA RVMV++P+IAFV THI 
Sbjct  165  SSVFHSRDVDLTERLDYSSAVALLGYSLILAILRTLNIRVEAKRVMVSAPLIAFVITHIS  224

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            +LNFY+ DYG N KVC  M +A+L IW +WAGVSRHPSRWKLW+VV+GG +A ++E++DF
Sbjct  225  FLNFYKMDYGWNMKVCVVMGVAQLLIWAIWAGVSRHPSRWKLWMVVVGGGLAMLLEIYDF  284

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+WHAT IPLTY++WSF+RDD+EFRT+SL KKAK
Sbjct  285  PPYKGFIDAHALWHATTIPLTYIWWSFIRDDAEFRTSSLLKKAK  328



>ref|XP_007038582.1| Per1-like family protein [Theobroma cacao]
 gb|EOY23083.1| Per1-like family protein [Theobroma cacao]
Length=345

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD+SSAVAL+GFS+IL+ILR F+VRDEA RVMVA+P+IAFVTTHIL
Sbjct  182  SAVFHSRDVELTEKLDYSSAVALVGFSLILSILRAFDVRDEASRVMVAAPLIAFVTTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A+L IWGVWAGV+ HPSRWK+W+ V+GG +A ++E+++F
Sbjct  242  YLNFYKLDYGLNMKVCMAMGVAQLLIWGVWAGVTSHPSRWKVWLFVVGGSLAVLLEIYEF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHA  IPLTY+ WSFVRDD+EFRTT+L KK K
Sbjct  302  PPYRGFVDAHALWHAASIPLTYICWSFVRDDAEFRTTTLLKKIK  345



>ref|XP_011030037.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Populus euphratica]
Length=348

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGFS+ILAILR F++RDEA RVMV++PIIAFVTTHIL
Sbjct  185  SAVFHSRDVELTEKLDFSSAVALLGFSLILAILRAFSMRDEAARVMVSAPIIAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DYGLNRKVC  M +A+L IW VWAGV+ HPSR+KLWV ++GG +A ++E++DF
Sbjct  245  YLNFYNLDYGLNRKVCVAMGVAQLLIWAVWAGVTHHPSRFKLWVALVGGGLAILLEIYDF  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+WSFV+DD+EFRT+SL KK +
Sbjct  305  PPYHGFVDAHALWHATTIPLTYLWWSFVKDDAEFRTSSLLKKER  348



>ref|XP_006422206.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006490485.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X3 [Citrus sinensis]
 ref|XP_006490491.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X3 [Citrus sinensis]
 gb|ESR35446.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
Length=345

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+ D+SSAVALLGFS+ILAILR+FNVRDEA RVMVA+P++AFVTTHIL
Sbjct  181  SAVFHSRDVDLTEKFDYSSAVALLGFSLILAILRSFNVRDEAARVMVAAPLLAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +A+L IW  WAG++RHPSRWKLWVVV GG +A ++E++DF
Sbjct  241  YLNFYKLDYGWNMKVCVVMAVAQLLIWATWAGITRHPSRWKLWVVVFGGALAMLLEIYDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY+G++DAHA+WHAT IPLTY++WSF+RDD+EF+T ++ KK +
Sbjct  301  PPYYGFLDAHAIWHATTIPLTYIWWSFIRDDAEFQTANMLKKGR  344



>ref|XP_006490483.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006490489.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Citrus sinensis]
Length=353

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+ D+SSAVALLGFS+ILAILR+FNVRDEA RVMVA+P++AFVTTHIL
Sbjct  189  SAVFHSRDVDLTEKFDYSSAVALLGFSLILAILRSFNVRDEAARVMVAAPLLAFVTTHIL  248

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +A+L IW  WAG++RHPSRWKLWVVV GG +A ++E++DF
Sbjct  249  YLNFYKLDYGWNMKVCVVMAVAQLLIWATWAGITRHPSRWKLWVVVFGGALAMLLEIYDF  308

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY+G++DAHA+WHAT IPLTY++WSF+RDD+EF+T ++ KK +
Sbjct  309  PPYYGFLDAHAIWHATTIPLTYIWWSFIRDDAEFQTANMLKKGR  352



>ref|XP_010644976.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Vitis vinifera]
Length=343

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLGFS+ILAILR+FNVR EA RVMV++P++AFVTTHIL
Sbjct  180  SAVFHSRDVDLTEKLDYSSAVALLGFSLILAILRSFNVRVEAARVMVSAPLLAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FDYG N KVC  M +A+L IW +WAGV+RHPSRWKLW VV+GG +A ++E++DF
Sbjct  240  YLNFYKFDYGWNMKVCVVMGVAQLLIWAIWAGVTRHPSRWKLWTVVVGGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF++DD+EF+T +L KK K
Sbjct  300  PPYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK  343



>ref|XP_006421844.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 ref|XP_006490320.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Citrus 
sinensis]
 gb|ESR35084.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|KDO60106.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=342

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGF+ ILAILR F+VRDEA RVMVA+P+IAFVTTHIL
Sbjct  179  SAVFHSRDVELTEKLDCSSAVALLGFNFILAILRAFSVRDEAARVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D+GLN KVC  M +A+L IW +WAGV+RHPSRWKLW+VV+G  +A +++++DF
Sbjct  239  YLNFYKLDHGLNMKVCLAMGVAQLLIWAIWAGVTRHPSRWKLWLVVVGEGLAMLLQIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA++HA  IPLTYL+WSF+RDDSEFRTT+L KK K
Sbjct  299  PPYRGFVDAHALYHAANIPLTYLWWSFIRDDSEFRTTALLKKPK  342



>ref|XP_002266274.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X3 
[Vitis vinifera]
Length=342

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLGFS+ILAILR+FNVR EA RVMV++P++AFVTTHIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVALLGFSLILAILRSFNVRVEAARVMVSAPLLAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FDYG N KVC  M +A+L IW +WAGV+RHPSRWKLW VV+GG +A ++E++DF
Sbjct  239  YLNFYKFDYGWNMKVCVVMGVAQLLIWAIWAGVTRHPSRWKLWTVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF++DD+EF+T +L KK K
Sbjct  299  PPYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK  342



>emb|CAN65586.1| hypothetical protein VITISV_034376 [Vitis vinifera]
Length=342

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLGFS+ILAILR+FNVR EA RVMV++P++AFVTTHIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVALLGFSLILAILRSFNVRVEAARVMVSAPLLAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FDYG N KVC  M +A+L IW +WAGV+RHPSRWKLW VV+GG +A ++E++DF
Sbjct  239  YLNFYKFDYGWNMKVCVVMGVAQLLIWTIWAGVTRHPSRWKLWTVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF++DD+EF+T +L KK K
Sbjct  299  PPYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK  342



>ref|XP_010106800.1| hypothetical protein L484_005346 [Morus notabilis]
 gb|EXC11885.1| hypothetical protein L484_005346 [Morus notabilis]
Length=342

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD+SSAVAL+GFS+IL+I R FNVRDEA RVMVA+P+ AFVTTHIL
Sbjct  179  SAVFHSRDVELTEKLDYSSAVALIGFSLILSITRAFNVRDEAARVMVAAPLAAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC GM +A+L +W VWAGV+RHPSR KLWVVV+GG +A ++E++DF
Sbjct  239  YLNFYKLDYGLNMKVCAGMGIAQLLVWAVWAGVTRHPSRRKLWVVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAH +WHAT IP TYL+WSFVRDD+EFRT++L KK K
Sbjct  299  PPYRGFVDAHTLWHATTIPFTYLWWSFVRDDAEFRTSTLLKKGK  342



>ref|XP_004234347.1| PREDICTED: post-GPI attachment to proteins factor 3 [Solanum 
lycopersicum]
Length=343

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSR VDLTE+LD SSAVALLGFS+ILA+LR FNV DEA RVMV++P++AFVTTHIL
Sbjct  180  SVVSHSRYVDLTEKLDFSSAVALLGFSLILAVLRVFNVTDEAARVMVSAPLVAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYGLN KVC GM   +L +W VWAGV+RHPSRWKLWVVVIGG +A ++E++DF
Sbjct  240  YLNCYQLDYGLNMKVCLGMGTLQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+W+FVRDDSEFRTT+L KKAK
Sbjct  300  PPYRGFVDAHALWHATTIPLTYLWWNFVRDDSEFRTTTLIKKAK  343



>ref|XP_002266197.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Vitis vinifera]
 emb|CBI21760.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLGFS+ILAILR+FNVR EA RVMV++P++AFVTTHIL
Sbjct  216  SAVFHSRDVDLTEKLDYSSAVALLGFSLILAILRSFNVRVEAARVMVSAPLLAFVTTHIL  275

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FDYG N KVC  M +A+L IW +WAGV+RHPSRWKLW VV+GG +A ++E++DF
Sbjct  276  YLNFYKFDYGWNMKVCVVMGVAQLLIWAIWAGVTRHPSRWKLWTVVVGGGLAMLLEIYDF  335

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF++DD+EF+T +L KK K
Sbjct  336  PPYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK  379



>gb|KHN31540.1| Post-GPI attachment to proteins factor 3 [Glycine soja]
Length=276

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR V+LTE+LD SSAVALLGF++ILAILR FNVRDEA RVM+++P++AFVTTHI+
Sbjct  113  SAVFHSRAVELTEKLDFSSAVALLGFTLILAILRAFNVRDEATRVMISAPLLAFVTTHIM  172

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+  YGLNR VC GMV+ +L IW +WAG S HP+RWKLW VV+GG +A V+E +DF
Sbjct  173  YLNFYELAYGLNRIVCTGMVVVQLLIWAIWAGASNHPARWKLWAVVVGGGLAMVLETYDF  232

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPLT+ +W F+RDD+EFRTT+L KK K
Sbjct  233  PPYMGYVDAHALWHATSIPLTFFWWGFIRDDAEFRTTALLKKVK  276



>ref|XP_010278515.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nelumbo 
nucifera]
Length=342

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDVDLTE+LD+SSAVALLG+++ILAILRTFNV+DEA RVMVA+P+IAFVTTHIL
Sbjct  179  SAVFHTRDVDLTEKLDYSSAVALLGYTLILAILRTFNVKDEAARVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  + +A+L +W VWAG+S HPSRWKLWVVV+GG +A ++E++DF
Sbjct  239  YLNFYKLDYGLNVKVCVIIGIAQLLLWAVWAGLSGHPSRWKLWVVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHA  IPL+YL+WSF++DD+EFRT+SL KK K
Sbjct  299  PPYQGFVDAHALWHAATIPLSYLWWSFIKDDAEFRTSSLVKKVK  342



>ref|XP_002318250.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa]
 gb|ABK96708.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE96470.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa]
Length=348

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGFS+ILAILR F++RDEA RVMV++PIIAFVTTHIL
Sbjct  185  SAVFHSRDVELTEKLDCSSAVALLGFSLILAILRAFSMRDEAARVMVSAPIIAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DY LN KVC  M +A+L IW VWAGV+ HPSR KLWV V+GG +A ++E++DF
Sbjct  245  YLNFYNLDYDLNMKVCVAMGVAQLLIWAVWAGVTNHPSRLKLWVAVVGGGLAILLEIYDF  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTYL+WSFV+DD+EFRT+SL KKA+
Sbjct  305  PPYQGFVDAHALWHATTIPLTYLWWSFVKDDAEFRTSSLLKKAR  348



>gb|ACA64424.1| PERLD1 [Glycine max]
Length=342

 Score =   231 bits (590),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR V+LTE+LD SSAVALLGFS+ILAILR FNVRDEA RVM+++P+IAFVTTHI+
Sbjct  179  SAVFHSRAVELTEKLDFSSAVALLGFSLILAILRAFNVRDEATRVMISAPLIAFVTTHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+  YGLNR VC GMV+ +L IW +WAG S HP+RWKLW VV+GG +A V+E +DF
Sbjct  239  YLNFYELAYGLNRIVCTGMVVVQLLIWAIWAGASNHPARWKLWAVVVGGGLAMVLETYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPLT+ +W F+RDD+EFRTT++ KK K
Sbjct  299  PPYMGYVDAHALWHATSIPLTFFWWGFIRDDAEFRTTAMLKKVK  342



>ref|XP_003620227.1| Post-GPI attachment to proteins factor [Medicago truncatula]
Length=342

 Score =   231 bits (590),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVD+TE+LD+SSAV LLG+S+ILAILR+FN+RDEA RVMV++P+IAFV TH++
Sbjct  179  SAVFHSRDVDVTEKLDYSSAVILLGYSLILAILRSFNIRDEATRVMVSAPLIAFVITHVM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N  VC  M +A+LTIW VWAGVSRHPSRWKLW+VVI G +A ++E++DF
Sbjct  239  YLNFYKLDYGWNMIVCVVMAVAQLTIWAVWAGVSRHPSRWKLWLVVISGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+WHAT IPLTY++WSF+RDD+EFRT    KKAK
Sbjct  299  PPYEGFLDAHAIWHATTIPLTYVWWSFIRDDAEFRTARFLKKAK  342



>ref|XP_009625146.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV HSRDV+LTE+LD+SSAVAL+G+S+ILAILR FNVRDEA RVM+A+PI+AFVTTHIL
Sbjct  179  SAVSHSRDVELTEKLDYSSAVALVGYSLILAILRVFNVRDEAARVMIAAPIVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ D+GLN KVC  M M + T+W VWA  +RHPSRWKLW+VV GGV++T+++++DF
Sbjct  239  YLNFYQLDHGLNTKVCVAMSMVQFTLWAVWAAFTRHPSRWKLWLVVTGGVLSTLLKIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDA A+WHA  +PL YL WSFVRDDSEF TT+L KKAK
Sbjct  299  PPYMGYVDADALWHAISLPLAYLLWSFVRDDSEFGTTTLIKKAK  342



>gb|KHG15846.1| Post-GPI attachment tos factor 3 [Gossypium arboreum]
Length=345

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FHSRDV+LTE+LD+SSAVAL+G+ +ILAILR FN+RDEA RVMVA+P++AFVTTHIL
Sbjct  182  SAIFHSRDVELTEKLDYSSAVALVGYGLILAILRVFNLRDEASRVMVAAPLVAFVTTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A+L IWG+WAG++ HPSRWK+W+ V+ G +   +E++DF
Sbjct  242  YLNFYKLDYGLNMKVCMAMGVAQLLIWGIWAGITSHPSRWKVWLFVVWGSLVVFLEIYDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHA  IPLTY  WSFV+DD+EFRT++L KK K
Sbjct  302  PPYKGFVDAHALWHAVSIPLTYFCWSFVQDDAEFRTSTLLKKIK  345



>ref|XP_006353377.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
tuberosum]
Length=342

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSR VDLTE+LD SSAVALLGFS+ILA+LR FNV DEA RVMV++ ++AFVTTHIL
Sbjct  179  SVVFHSRYVDLTEKLDCSSAVALLGFSLILAVLRVFNVTDEAARVMVSALLVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYGLN KVC GM + +L +W VWAGV+RHPSRWKLWVVVIGG +A ++E++DF
Sbjct  239  YLNCYQLDYGLNMKVCLGMGILQLILWVVWAGVTRHPSRWKLWVVVIGGALAALLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLT+L+WSFVRDDSEFRTT+L KKAK
Sbjct  299  PPYRGFVDAHALWHATTIPLTFLWWSFVRDDSEFRTTTLIKKAK  342



>ref|XP_004240743.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
lycopersicum]
Length=342

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV HSRDV+LTE+LD+SS VA +G+S+++AILR FNVRDEA RVM+A+PI+AFVTTHIL
Sbjct  179  SAVSHSRDVELTEKLDYSSVVAFIGYSLLVAILRAFNVRDEASRVMIAAPIVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ DYGLN KVC GM M +  +W VWAG +RHPSRWKLWVVV GGV++T+++++DF
Sbjct  239  YLNFYQLDYGLNIKVCVGMTMLQFILWVVWAGFTRHPSRWKLWVVVAGGVLSTLIKIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDA A+WHA  IPLTYL+WSFVRDDSEF TT+L KKAK
Sbjct  299  PPYLGYVDADALWHAMSIPLTYLWWSFVRDDSEFGTTTLIKKAK  342



>ref|XP_007152345.1| hypothetical protein PHAVU_004G122200g [Phaseolus vulgaris]
 gb|ESW24339.1| hypothetical protein PHAVU_004G122200g [Phaseolus vulgaris]
Length=342

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR V+LTE+LD SSAVALLGFS+IL ILR FNVRDEA RVM+++P++AFVTTHI+
Sbjct  179  SAVFHSRAVELTEKLDLSSAVALLGFSLILTILRGFNVRDEATRVMISAPLLAFVTTHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+  YGLNR VC GMV+ +L IW +WAG S HP+RWKLW+VV+GG +A V+E +DF
Sbjct  239  YLNFYKLAYGLNRIVCMGMVVVQLLIWAIWAGASNHPARWKLWIVVVGGGLAMVLETYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPLT+L+WSFVRDD+EFRT+++ KK K
Sbjct  299  PPYMGYVDAHALWHATSIPLTFLWWSFVRDDAEFRTSAMLKKVK  342



>ref|XP_010061579.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Eucalyptus 
grandis]
 gb|KCW90760.1| hypothetical protein EUGRSUZ_A02835 [Eucalyptus grandis]
Length=343

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD+SSAVALLGFS+I+A+LR  N+RDEA RVM ++P+IAFVTTHIL
Sbjct  180  SAVFHSRDVELTEKLDYSSAVALLGFSLIVALLRALNIRDEASRVMFSAPVIAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQFDYG N KVC  M +A+L IW +WAGV+RHPSRWKLWVVV+GG +A ++E++DF
Sbjct  240  YLNFYQFDYGWNMKVCVAMGIAQLLIWAIWAGVTRHPSRWKLWVVVVGGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WH T IP +YL+WSF+RDD+E RT +L KK K
Sbjct  300  PPYMGFVDAHALWHTTAIPFSYLWWSFIRDDAELRTRTLLKKVK  343



>ref|XP_008234299.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Prunus 
mume]
Length=342

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV+LTE+LD SSAVALLGFS+ILA+LR FNVRDEA RVMV++P+IAFVTTHIL
Sbjct  179  SGVFHSRDVELTEKLDISSAVALLGFSLILALLRAFNVRDEAARVMVSAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A+L  W VWAGV+RHPSRWKLWVVV GG +A V E++DF
Sbjct  239  YLNFYKLDYGLNMKVCMAMGIAQLLTWAVWAGVTRHPSRWKLWVVVAGGGLAMVFEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DA A+W+A  IPLTYL+WSFVRDD+EF T++L KKAK
Sbjct  299  PPYRGYIDALALWNAINIPLTYLWWSFVRDDAEFMTSALLKKAK  342



>ref|XP_003549124.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Glycine 
max]
Length=342

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR V+LTE+LD SSAVALLGF++ILAILR FNVRDEA RVM+++P++AFVTTHI+
Sbjct  179  SAVFHSRAVELTEKLDFSSAVALLGFTLILAILRAFNVRDEATRVMISAPLLAFVTTHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+  YGLNR VC GMV+ +L IW +WAG S HP+RWKLW VV+GG +A V+E +DF
Sbjct  239  YLNFYELAYGLNRIVCTGMVVVQLLIWAIWAGASNHPARWKLWAVVVGGGLAMVLETYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPLT+ +W F+RDD+EFRTT+L KK K
Sbjct  299  PPYMGYVDAHALWHATSIPLTFFWWGFIRDDAEFRTTALLKKVK  342



>ref|XP_007218263.1| hypothetical protein PRUPE_ppa008189mg [Prunus persica]
 gb|EMJ19462.1| hypothetical protein PRUPE_ppa008189mg [Prunus persica]
Length=342

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV+LTE+LD SSAVALLGFS+ILA+LR FNVRDEA RVMV++P+IAFVTTH+L
Sbjct  179  SGVFHSRDVELTEKLDISSAVALLGFSLILALLRAFNVRDEAARVMVSAPLIAFVTTHVL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A+L  W VWAGV+RHPSRWKLWVVV GG +A V E++DF
Sbjct  239  YLNFYKLDYGLNMKVCMAMGIAQLLTWAVWAGVTRHPSRWKLWVVVAGGGLAMVFEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DA A+W+A  IPLTYL+WSFVRDD+EF T++L KKAK
Sbjct  299  PPYRGYIDALALWNAINIPLTYLWWSFVRDDAEFMTSALLKKAK  342



>gb|KJB52864.1| hypothetical protein B456_008G280700 [Gossypium raimondii]
Length=345

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FHSRDV+LTE+LD+SSAVAL+G+S+ILAILR F++RDEA RVMVA+P++AFVTTHIL
Sbjct  182  SAIFHSRDVELTEKLDYSSAVALVGYSLILAILRVFDLRDEASRVMVAAPLVAFVTTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A+L IWG+WAG++ HPSRWK+W+ V+ G +   +E+ DF
Sbjct  242  YLNFYKLDYGLNMKVCMAMGVAQLLIWGIWAGITSHPSRWKVWLFVVWGSLVVFLEILDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHA  IPLTY  WSFV+DD+EFRT++L KK K
Sbjct  302  PPYKGFVDAHALWHAVSIPLTYFCWSFVQDDAEFRTSTLLKKIK  345



>ref|XP_011014824.1| PREDICTED: post-GPI attachment to proteins factor 3 [Populus 
euphratica]
Length=341

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVA LG+S+I++ILR+FNVRDEA RVMVA+P++AF+TTHIL
Sbjct  178  SAVFHSRDVDLTEKLDYSSAVAFLGYSLIMSILRSFNVRDEAARVMVAAPLLAFLTTHIL  237

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            ++NFY+ DYG N +VC  M +A+L +W +WAGV+ HPSRWKLWVVVIGG +A ++E++DF
Sbjct  238  FINFYKLDYGWNMQVCVVMAVAQLLLWAIWAGVTGHPSRWKLWVVVIGGGLAMLLEIYDF  297

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPLTY++WSF+RDD+EFRT++L KK K
Sbjct  298  PPYEGYVDAHALWHATTIPLTYIWWSFIRDDAEFRTSNLLKKVK  341



>ref|XP_006340525.1| PREDICTED: protein PER1 homolog [Solanum tuberosum]
Length=342

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV HSRDV+LTE+LD+SS VA +G+S+++AILR FNVRDEA RVM+A+PI+AFVTTHIL
Sbjct  179  SAVSHSRDVELTEKLDYSSVVAFIGYSLLVAILRAFNVRDEASRVMIAAPIVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ DYGLN KVC  M M +  +W VWAG +RHPSRWKLWVVV GG+++T+++++DF
Sbjct  239  YLNFYQLDYGLNIKVCVAMTMLQFILWVVWAGFTRHPSRWKLWVVVAGGILSTLIKIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDA A+WHA  IPLTYL+WSFVRDDS+F TT+L+KKAK
Sbjct  299  PPYMGYVDADALWHAMSIPLTYLWWSFVRDDSQFGTTTLTKKAK  342



>ref|XP_002310105.1| Per1-like family protein [Populus trichocarpa]
 gb|EEE90555.1| Per1-like family protein [Populus trichocarpa]
Length=342

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVA LG+S+I++ILR+FNVRDEA RVMVA+P++AF+TTHIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVAFLGYSLIMSILRSFNVRDEAARVMVAAPLLAFLTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            ++NFY+ DYG N +VC  M +A+L +W +WAGV+ HPSRWKLWVVVIGG +A ++E++DF
Sbjct  239  FINFYKLDYGWNMQVCVVMAVAQLLLWAIWAGVTGHPSRWKLWVVVIGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPLTY++WSF+RDD+EFRT++L KK K
Sbjct  299  PPYEGYVDAHALWHATTIPLTYIWWSFIRDDAEFRTSNLLKKTK  342



>ref|XP_010249649.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Nelumbo nucifera]
Length=343

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLG+++ILAILRTFNVR EA RVMV++P+IAFVTTHIL
Sbjct  180  SAVFHSRDVDLTEKLDYSSAVALLGYTLILAILRTFNVRAEAARVMVSAPLIAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L +W VWAG++ HPSRWKLWVVV+GG +A ++E++DF
Sbjct  240  YLNFYKLDYGLNMKVCVSMGVVQLLLWAVWAGLTHHPSRWKLWVVVVGGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLT L+WSF++DD++FRT +L KK +
Sbjct  300  PPYKGFVDAHALWHATTIPLTNLWWSFIKDDAKFRTMNLVKKVR  343



>gb|KDP25109.1| hypothetical protein JCGZ_22644 [Jatropha curcas]
Length=342

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLGFS+ILA+LR+F+VR EA RVMVA+P++AFVTTHIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVALLGFSLILAVLRSFDVRLEAARVMVAAPLLAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            +LNFY+ DYG N  VC  M +A+L IW +WAGVSRHPSRWKLWVVV+GG +A ++E++DF
Sbjct  239  FLNFYKLDYGWNMIVCVIMAVAQLLIWAIWAGVSRHPSRWKLWVVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF+RDD+E  T++L KKAK
Sbjct  299  PPYKGFVDAHALWHATTIPLTYIWWSFIRDDTELGTSNLLKKAK  342



>gb|KCW90758.1| hypothetical protein EUGRSUZ_A02835 [Eucalyptus grandis]
Length=382

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD+SSAVALLGFS+I+A+LR  N+RDEA RVM ++P+IAFVTTHIL
Sbjct  180  SAVFHSRDVELTEKLDYSSAVALLGFSLIVALLRALNIRDEASRVMFSAPVIAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQFDYG N KVC  M +A+L IW +WAGV+RHPSRWKLWVVV+GG +A ++E++DF
Sbjct  240  YLNFYQFDYGWNMKVCVAMGIAQLLIWAIWAGVTRHPSRWKLWVVVVGGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKA  227
             PY G+VDAHA+WH T IP +YL+WSF+RDD+E RT +L KK 
Sbjct  300  PPYMGFVDAHALWHTTAIPFSYLWWSFIRDDAELRTRTLLKKG  342



>ref|XP_010249648.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Nelumbo nucifera]
Length=347

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLG+++ILAILRTFNVR EA RVMV++P+IAFVTTHIL
Sbjct  184  SAVFHSRDVDLTEKLDYSSAVALLGYTLILAILRTFNVRAEAARVMVSAPLIAFVTTHIL  243

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L +W VWAG++ HPSRWKLWVVV+GG +A ++E++DF
Sbjct  244  YLNFYKLDYGLNMKVCVSMGVVQLLLWAVWAGLTHHPSRWKLWVVVVGGGLAMLLEIYDF  303

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLT L+WSF++DD++FRT +L KK +
Sbjct  304  PPYKGFVDAHALWHATTIPLTNLWWSFIKDDAKFRTMNLVKKVR  347



>gb|KDO60107.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=347

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 144/169 (85%), Gaps = 5/169 (3%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGF+ ILAILR F+VRDEA RVMVA+P+IAFVTTHIL
Sbjct  179  SAVFHSRDVELTEKLDCSSAVALLGFNFILAILRAFSVRDEAARVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDY-----GLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvv  371
            YLNFY+ D+     GLN KVC  M +A+L IW +WAGV+RHPSRWKLW+VV+G  +A ++
Sbjct  239  YLNFYKLDHVNHIAGLNMKVCLAMGVAQLLIWAIWAGVTRHPSRWKLWLVVVGEGLAMLL  298

Query  370  eVFDFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            +++DF PY G+VDAHA++HA  IPLTYL+WSF+RDDSEFRTT+L KK K
Sbjct  299  QIYDFPPYRGFVDAHALYHAANIPLTYLWWSFIRDDSEFRTTALLKKPK  347



>emb|CDP13593.1| unnamed protein product [Coffea canephora]
Length=342

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV LTERLD+SSAVALLG+S+ILAILR+FNVRDEA RVMVA+P++AF+TTHIL
Sbjct  179  SAVFHSRDVVLTERLDYSSAVALLGYSLILAILRSFNVRDEAGRVMVAAPLLAFITTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN Y+ DYG N +VC  M + +L +W VWAGV+ HPSRWKLW+VV+GG +A ++E++DF
Sbjct  239  YLNNYKMDYGWNMQVCVVMAVTQLVVWAVWAGVTHHPSRWKLWIVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT +PLT+++WSF+RDD+EFRT++L KK K
Sbjct  299  PPYKGYVDAHALWHATTVPLTFIWWSFIRDDAEFRTSNLIKKVK  342



>ref|XP_006857922.1| hypothetical protein AMTR_s00069p00146030 [Amborella trichopoda]
 gb|ERN19389.1| hypothetical protein AMTR_s00069p00146030 [Amborella trichopoda]
Length=326

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVAL+G+++I+AI+RTFNVRDEA +V++A+P+ AFVTTHIL
Sbjct  157  SAVFHSRDVDLTEKLDYSSAVALVGYALIVAIIRTFNVRDEAVKVIIAAPLAAFVTTHIL  216

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQFDYGLN KVC  M +A+L +W VWAGV++HPSR+KLW VV+ G +A ++E++DF
Sbjct  217  YLNLYQFDYGLNMKVCVTMGVAQLLLWAVWAGVTKHPSRFKLWAVVLFGGLAMLLEIYDF  276

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK*DG  215
             P+WGYVDAHA+WHAT IPLTYL+WSF++DD++F T S   +A  DG
Sbjct  277  PPFWGYVDAHALWHATTIPLTYLWWSFIKDDAKFSTFSRQGEAN-DG  322



>ref|XP_003528854.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Glycine 
max]
 gb|KHN26964.1| Post-GPI attachment to proteins factor 3 [Glycine soja]
Length=343

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAV LLG+S+ILAILRTF++RDEA RVMVA+P+IAFVTTH++
Sbjct  180  SAVFHSRDVDLTEKLDYSSAVVLLGYSLILAILRTFSIRDEATRVMVAAPLIAFVTTHVM  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY  DYG N  VC  M +A+L++W VWAGVS HPSRWKLW+VVI G +A ++E++DF
Sbjct  240  YINFYLLDYGWNMIVCVVMAVAQLSMWAVWAGVSNHPSRWKLWLVVIAGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P+ G  DAHA+WHAT IPLTY++WSF+RDD+EFRT++L KKAK
Sbjct  300  PPHQGLFDAHALWHATTIPLTYIWWSFIRDDAEFRTSNLLKKAK  343



>ref|XP_004968454.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Setaria 
italica]
Length=346

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD+DLTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  183  SSIFHTRDIDLTEKLDYSSAVALLGYSLILSLLRAFNVKDEATRVMFAAPILAFVTTHIL  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M + +L  W +WAGV+RHPSR KLW VV GG +A ++E++DF
Sbjct  243  YLNFYELDYGWNMKVCVVMAVVQLLTWAIWAGVTRHPSRLKLWTVVFGGALAMLLELYDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+WSF++DD+EFRT++L KKAK
Sbjct  303  PPYMGYADAHSLWHASTIPLTYLWWSFIKDDAEFRTSTLIKKAK  346



>ref|XP_006664912.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Oryza 
brachyantha]
Length=351

 Score =   227 bits (578),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD+DLTE+LD+SSAVALLG+S+IL++LRTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  188  SSIFHTRDIDLTEKLDYSSAVALLGYSLILSLLRTFNVKDEATRVMFAAPILAFVTTHIL  247

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M + +L  W +WAGV+RHPSR+KLWVVV GG +A ++E++DF
Sbjct  248  YLNFYELDYGWNMKVCVVMAVVQLLAWAIWAGVTRHPSRFKLWVVVFGGALAMLLELYDF  307

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+WSF++DD+EFRT++L KKAK
Sbjct  308  PPYKGYADAHSLWHASTIPLTYLWWSFIKDDAEFRTSTLIKKAK  351



>ref|XP_009775256.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
sylvestris]
Length=342

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV HSRDV+LTE+LD+SS  AL+G+S+ILAILR FNVRDEA RVM+A+PI+AFVTTHIL
Sbjct  179  SAVSHSRDVELTEKLDYSSGGALVGYSLILAILRVFNVRDEAARVMIAAPIVAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ D+GLN KVC  M M + T+W VWA  +RHPSRWKLW+VV GGV++T+++++DF
Sbjct  239  YLNFYQLDHGLNTKVCVAMSMLQFTLWAVWAAFTRHPSRWKLWLVVTGGVLSTLLKIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDA A+WH   +PL YL WSFVRDDSEF TT+L KKAK
Sbjct  299  PPYMGYVDADALWHTISLPLAYLLWSFVRDDSEFGTTTLIKKAK  342



>gb|ACJ84406.1| unknown [Medicago truncatula]
Length=342

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR VDLTE+L++SSAVALLGFS+ILAILR FNVRDEA RVMV++P++AFVTTHI+
Sbjct  179  SAVFHSRAVDLTEKLNYSSAVALLGFSLILAILRAFNVRDEATRVMVSAPLVAFVTTHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ +YGLN KV   M + +L IW +WAGVS HP+RWKLW VV+GGVVA ++E +DF
Sbjct  239  YLNFYELNYGLNMKVSMLMAVVQLLIWAIWAGVSSHPARWKLWTVVVGGVVAMILETYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHAVW+A  IPLT+L+WS++RDD+EFRT++L KK K
Sbjct  299  PPYMGYVDAHAVWNAANIPLTFLWWSYIRDDAEFRTSALLKKVK  342



>ref|NP_001147973.1| CAB2 precursor [Zea mays]
 gb|ACG29294.1| CAB2 [Zea mays]
 gb|ACG38027.1| CAB2 [Zea mays]
Length=346

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD++LTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  183  SSIFHTRDIELTEKLDYSSAVALLGYSLILSLLRAFNVKDEASRVMFAAPILAFVTTHIL  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M   +L  W VWAGVSRHPSR KLW VV GG +  ++E++DF
Sbjct  243  YLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKLWTVVFGGALVMLLELYDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+ DAH++WHA+ IPLTYL+WSF++DD++FRT++LSKKAK
Sbjct  303  PPYMGFADAHSLWHASTIPLTYLWWSFIKDDAKFRTSTLSKKAK  346



>ref|XP_006576320.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Glycine max]
Length=346

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVD+TE+LD+SSAV LLG+S+ILAILRTF++RDEA RVMVA+P+IAFVTTH++
Sbjct  183  SAVFHSRDVDITEKLDYSSAVVLLGYSLILAILRTFSIRDEATRVMVAAPLIAFVTTHVM  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY  DYG N  VC  M MA+L++W VWAGVS HPSRWKLW+VVI G +A ++E++DF
Sbjct  243  YINFYLLDYGWNMIVCVVMAMAQLSMWAVWAGVSNHPSRWKLWLVVISGGLAMLLEIYDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY    DAHA+WH T IPLTY++WSF+RDD+EFRT++L KKAK
Sbjct  303  PPYEELFDAHALWHVTTIPLTYIWWSFIRDDAEFRTSNLLKKAK  346



>gb|AFK39392.1| unknown [Medicago truncatula]
Length=342

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR VDLTE+L++SSAVALLGFS+ILAILR FNVRDEA RVMV++P++AFVTTHI+
Sbjct  179  SAVFHSRAVDLTEKLNYSSAVALLGFSLILAILRAFNVRDEATRVMVSAPLVAFVTTHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ +YGLN KV   M + +L IW +WAGVS HP+RWKLW VV+GGVVA ++E +DF
Sbjct  239  YLNFYELNYGLNMKVSMLMAVVQLLIWAIWAGVSSHPARWKLWTVVVGGVVAMILETYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHAVW+A  IPLT+L+WS++RDD+EFRT++L KK K
Sbjct  299  PPYMGYVDAHAVWNAANIPLTFLWWSYIRDDAEFRTSALLKKVK  342



>ref|XP_008661897.1| PREDICTED: CAB2 isoform X1 [Zea mays]
 gb|ACN34014.1| unknown [Zea mays]
Length=346

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD++LTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  183  SSIFHTRDIELTEKLDYSSAVALLGYSLILSLLRAFNVKDEASRVMFAAPILAFVTTHIL  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M   +L  W VWAGVSRHPSR KLW VV GG +  ++E++DF
Sbjct  243  YLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKLWTVVFGGALVMLLELYDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+ DAH++WHA+ IPLTYL+WSF++DD++FRT++LSKKAK
Sbjct  303  PPYMGFADAHSLWHASTIPLTYLWWSFIKDDAKFRTSTLSKKAK  346



>gb|ACN35025.1| unknown [Zea mays]
Length=346

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD++LTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  183  SSIFHTRDIELTEKLDYSSAVALLGYSLILSLLRAFNVKDEASRVMFAAPILAFVTTHIL  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M   +L  W VWAGVSRHPSR KLW VV GG +  ++E++DF
Sbjct  243  YLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKLWTVVFGGALVMLLELYDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+ DAH++WHA+ IPLTYL+WSF++DD++FRT++LSKKAK
Sbjct  303  PPYMGFADAHSLWHASTIPLTYLWWSFIKDDAKFRTSTLSKKAK  346



>gb|AFW58545.1| hypothetical protein ZEAMMB73_490076 [Zea mays]
Length=396

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD++LTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  233  SSIFHTRDIELTEKLDYSSAVALLGYSLILSLLRAFNVKDEASRVMFAAPILAFVTTHIL  292

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M   +L  W VWAGVSRHPSR KLW VV GG +  ++E++DF
Sbjct  293  YLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKLWTVVFGGALVMLLELYDF  352

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+ DAH++WHA+ IPLTYL+WSF++DD++FRT++LSKKAK
Sbjct  353  PPYMGFADAHSLWHASTIPLTYLWWSFIKDDAKFRTSTLSKKAK  396



>gb|KEH26587.1| post-GPI attachment-like factor-protein [Medicago truncatula]
Length=342

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR VDLTE+L++SSAVALLGFS+ILAILR FNVRDEA RVMV++P++AFVTTHI+
Sbjct  179  SAVFHSRAVDLTEKLNYSSAVALLGFSLILAILRAFNVRDEATRVMVSAPLVAFVTTHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ +YGLN KV   M + +L IW +WAGVS HP+RWKLW VV+GGVVA ++E +DF
Sbjct  239  YLNFYELNYGLNMKVSMLMAVVQLLIWAIWAGVSSHPARWKLWTVVVGGVVAMILETYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHAVW+A  IPLT+L+WS++RDD+EFRT++L KK K
Sbjct  299  PPYMGYVDAHAVWNAANIPLTFLWWSYIRDDAEFRTSALLKKVK  342



>ref|NP_001054945.1| Os05g0220100 [Oryza sativa Japonica Group]
 gb|AAT07554.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT07622.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16859.1| Os05g0220100 [Oryza sativa Japonica Group]
 gb|EAY97004.1| hypothetical protein OsI_18926 [Oryza sativa Indica Group]
 dbj|BAH00766.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62778.1| hypothetical protein OsJ_17581 [Oryza sativa Japonica Group]
Length=349

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD+DLTE+LD+SSAVALLG+S+IL++LRTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  186  SSIFHTRDIDLTEKLDYSSAVALLGYSLILSLLRTFNVKDEATRVMFAAPILAFVTTHIL  245

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M + +L  W +WAG+++HPSR+KLWVVV GG +A ++EV+DF
Sbjct  246  YLNFYELDYGWNMKVCVVMAVVQLLAWAIWAGITQHPSRFKLWVVVFGGALAMLLEVYDF  305

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+WSF++DD+EFRT++L KKAK
Sbjct  306  PPYKGYADAHSLWHASTIPLTYLWWSFIKDDAEFRTSTLIKKAK  349



>ref|XP_004512796.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cicer 
arietinum]
Length=342

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAV LLG+S+ILAILR+FNVRDEA RVMV++P+ AF  TH++
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVILLGYSLILAILRSFNVRDEATRVMVSAPLSAFAITHVM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N KVC  M +A+L IW VWAGVSRHPSRWKLW+VV  G +A ++E++DF
Sbjct  239  YINFYKLDYGWNMKVCVVMAVAQLAIWAVWAGVSRHPSRWKLWLVVFAGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G  DAHA+WHA+ IPLTY++WSF+RDD+ FRTT + KKA+
Sbjct  299  PPYEGLFDAHAIWHASTIPLTYIWWSFIRDDAHFRTTKILKKAR  342



>ref|XP_003521884.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Glycine max]
Length=343

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVD+TE+LD+SSAV LLG+S+ILAILRTF++RDEA RVMVA+P+IAFVTTH++
Sbjct  180  SAVFHSRDVDITEKLDYSSAVVLLGYSLILAILRTFSIRDEATRVMVAAPLIAFVTTHVM  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY  DYG N  VC  M MA+L++W VWAGVS HPSRWKLW+VVI G +A ++E++DF
Sbjct  240  YINFYLLDYGWNMIVCVVMAMAQLSMWAVWAGVSNHPSRWKLWLVVISGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY    DAHA+WH T IPLTY++WSF+RDD+EFRT++L KKAK
Sbjct  300  PPYEELFDAHALWHVTTIPLTYIWWSFIRDDAEFRTSNLLKKAK  343



>ref|XP_004513683.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cicer 
arietinum]
Length=342

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+VFHSR V+LTE+L++SSAVALLGFS+ILAILR FNVRDEA RVMV++P++AFVTTH+L
Sbjct  179  SSVFHSRAVELTEKLNYSSAVALLGFSLILAILRAFNVRDEATRVMVSAPLVAFVTTHVL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ +YGLN KVC  M + +L IW +WAGVS HP+RWKLWVVV+GGV A V+E +DF
Sbjct  239  YLNFYELNYGLNTKVCMLMAVVQLLIWAIWAGVSSHPARWKLWVVVVGGVFAMVLETYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDA+A+W+AT IPLT+L+WS++RDD+EFRT++L KK K
Sbjct  299  PPYMGYVDANALWNATNIPLTFLWWSYIRDDAEFRTSALLKKVK  342



>gb|KEH26588.1| post-GPI attachment-like factor-protein [Medicago truncatula]
Length=349

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSR VDLTE+L++SSAVALLGFS+ILAILR FNVRDEA RVMV++P++AFVTTHI+
Sbjct  186  SAVFHSRAVDLTEKLNYSSAVALLGFSLILAILRAFNVRDEATRVMVSAPLVAFVTTHIM  245

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ +YGLN KV   M + +L IW +WAGVS HP+RWKLW VV+GGVVA ++E +DF
Sbjct  246  YLNFYELNYGLNMKVSMLMAVVQLLIWAIWAGVSSHPARWKLWTVVVGGVVAMILETYDF  305

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHAVW+A  IPLT+L+WS++RDD+EFRT++L KK K
Sbjct  306  PPYMGYVDAHAVWNAANIPLTFLWWSYIRDDAEFRTSALLKKVK  349



>ref|XP_008456335.1| PREDICTED: post-GPI attachment to proteins factor 3 [Cucumis 
melo]
Length=342

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVA+LGFS+ILAILR+FNVR EA RVMVA+P++AF  THIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVAVLGFSLILAILRSFNVRHEATRVMVAAPLLAFALTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L IW +WAGV+ HPSRWKLW VV+GG +A ++E++DF
Sbjct  239  YINFYELDYGWNMIVCVTMGVSQLLIWAIWAGVTHHPSRWKLWTVVVGGGLALLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF+RDD+EF+T++L KK+K
Sbjct  299  PPYEGFVDAHALWHATTIPLTYIWWSFIRDDAEFQTSNLLKKSK  342



>ref|XP_004171793.1| PREDICTED: post-GPI attachment to proteins factor 3-like, partial 
[Cucumis sativus]
Length=341

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +A FH RDV+LTE+LD+SSAVA +GFS+I+AILR  NVRDEA +VMV++PII+FVTTHIL
Sbjct  178  NAAFHCRDVELTEKLDYSSAVAFIGFSLIVAILRALNVRDEAAKVMVSAPIISFVTTHIL  237

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L +W VWA +SRHPS+WKLW++V GG VA ++E FDF
Sbjct  238  YLNFYKLDYGLNAKVCLVMGITQLLVWAVWAVLSRHPSQWKLWILVFGGAVAILLEAFDF  297

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPL+Y++WSFVRDD+EFRT++L KK K
Sbjct  298  PPYGGYVDAHALWHATSIPLSYIWWSFVRDDAEFRTSALLKKVK  341



>ref|XP_004143181.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cucumis 
sativus]
 gb|KGN46820.1| hypothetical protein Csa_6G139200 [Cucumis sativus]
Length=342

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVA+LGFS+ILAILR+FNVR EA RVMVA+P++AF  THIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVAVLGFSLILAILRSFNVRHEATRVMVAAPLLAFALTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L IW +WAGV+ HPSRWKLW VV+GG +A ++E++DF
Sbjct  239  YINFYELDYGWNMIVCVTMGVSQLLIWAIWAGVTHHPSRWKLWTVVVGGGLALLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF+RDD+EF+T++L KK+K
Sbjct  299  PPYKGFVDAHALWHATTIPLTYIWWSFIRDDAEFQTSNLLKKSK  342



>gb|KJB39383.1| hypothetical protein B456_007G010000 [Gossypium raimondii]
Length=345

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV H+RDV+LTE+LD+SSAVAL+GFS IL ILRTF+VRDEA RVMVA+P+IAFV THIL
Sbjct  182  SAVCHTRDVELTEKLDYSSAVALVGFSFILTILRTFDVRDEASRVMVAAPLIAFVMTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A L IWGVWAG++ HPSRWK+W+  +GG +A ++E++DF
Sbjct  242  YLNFYKLDYGLNTKVCMAMGVANLLIWGVWAGITSHPSRWKVWLFNVGGTIALLLEIYDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+WHA  IPL Y+ WSFVRDD+ FRT++L KK K
Sbjct  302  PPYKGFIDAHALWHAANIPLAYISWSFVRDDAVFRTSTLLKKTK  345



>ref|XP_004294129.1| PREDICTED: post-GPI attachment to proteins factor 3 [Fragaria 
vesca subsp. vesca]
Length=348

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+S+AVAL+G+S+ILAILR+F+VR +A RVMVA+P++AFVTTHIL
Sbjct  181  SAVFHSRDVDLTEKLDYSAAVALIGYSLILAILRSFDVRHDAVRVMVAAPLLAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +A+L IW VWAG++RHPSRWKLW+VV+GG +A ++E++DF
Sbjct  241  YLNFYKLDYGWNMKVCVIMAVAQLLIWAVWAGITRHPSRWKLWLVVVGGGLAMLLEIYDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTS----LSKKAK  224
             PY G++DAHAVWHAT IPLTY++WSF+RDD+EF T++    L+KKAK
Sbjct  301  PPYEGFLDAHAVWHATTIPLTYIWWSFIRDDAEFLTSNQVKKLAKKAK  348



>ref|XP_008439161.1| PREDICTED: post-GPI attachment to proteins factor 3 [Cucumis 
melo]
Length=344

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +A FH RDV+LTE+LD+SSAVA +GFS+I+AILR  NVRDEA +VMV++PI++FVTTHIL
Sbjct  181  NAAFHCRDVELTEKLDYSSAVAFIGFSLIVAILRALNVRDEAAKVMVSAPIVSFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L +W VWA +SRHPS+WKLW++V GG VA ++E FDF
Sbjct  241  YLNFYKLDYGLNAKVCLVMGITQLLVWAVWAVLSRHPSQWKLWILVFGGAVAILLEAFDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPL+Y++WSFVRDD+EFRT++L KK K
Sbjct  301  PPYGGYVDAHALWHATSIPLSYIWWSFVRDDAEFRTSALLKKVK  344



>ref|XP_008226095.1| PREDICTED: post-GPI attachment to proteins factor 3 [Prunus mume]
Length=353

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVA+LG+S+IL+ILR+F+V+D+A RVMVA+P++AFVTTHIL
Sbjct  181  SAVFHSRDVDLTEKLDYSSAVAILGYSLILSILRSFDVKDDAVRVMVAAPLLAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N +VC  M + +L +W +WAGV+RHPSRWKLW+VV+ G +A ++E++DF
Sbjct  241  YLNFYKLDYGWNMQVCVVMAVVQLLLWAIWAGVTRHPSRWKLWLVVVAGGLAMLLEIYDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK*DGSAK  206
             PY G+VDAHA WHAT IPLTY++WSF+RDD+EF T++  K+ K    AK
Sbjct  301  PPYQGFVDAHAAWHATTIPLTYVWWSFIRDDAEFLTSNQMKRLKTSNLAK  350



>ref|XP_010915760.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Elaeis 
guineensis]
Length=343

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH+RD DLTE+LD+SSAVA LGFS+IL +LRTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  180  SAIFHTRDFDLTEKLDYSSAVASLGFSLILCLLRTFNVKDEASRVMFAAPILAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ DYG N KVC  M +  L +W +WAG++RHPSR KLWV V G  ++ ++E++DF
Sbjct  240  YLNFYQLDYGWNMKVCLVMGVTTLLVWAIWAGITRHPSRVKLWVTVFGIALSMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAHA+WHA  IPLTYL+WSF++DD+ FRT++L KKAK
Sbjct  300  PPYMGYADAHALWHAATIPLTYLWWSFIKDDAVFRTSALVKKAK  343



>ref|XP_008805643.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Phoenix 
dactylifera]
Length=343

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH+RD DLTE+LD+SSAV+ LGFS+IL +LRTFNV+DEA RVM+A+PI+AFVTTHIL
Sbjct  180  SAIFHTRDFDLTEKLDYSSAVSSLGFSLILCLLRTFNVKDEASRVMLAAPILAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ DYG N KVC  M +  L +W +WAG++RHPSR KLWV VIG  +A ++E++DF
Sbjct  240  YLNFYQLDYGWNMKVCLAMGVTTLLVWAIWAGITRHPSRIKLWVNVIGIALAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAHA+WHA  IPLTYL+WSF++DD+ FRT++L KK K
Sbjct  300  PPYMGYADAHALWHAATIPLTYLWWSFIKDDAVFRTSALVKKTK  343



>gb|KHG02645.1| Post-GPI attachment tos factor 3 [Gossypium arboreum]
Length=345

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV H+RDV+LTE+LD+SSAVAL+GFS IL ILRTF+VRDEA RVMVA+P+IAFV THIL
Sbjct  182  SAVCHTRDVELTEKLDYSSAVALVGFSFILTILRTFDVRDEASRVMVAAPLIAFVMTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A L IWGVWAG++ HPSRWK+W+  +GG +A ++E++DF
Sbjct  242  YLNFYKLDYGLNTKVCMAMGVANLLIWGVWAGITSHPSRWKVWLFNVGGTIALLLEIYDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+WHA  IPL Y+ WSFVRDD+ FRT++L  K K
Sbjct  302  PPYKGFIDAHALWHAANIPLAYICWSFVRDDAVFRTSTLLNKTK  345



>ref|XP_003562375.1| PREDICTED: post-GPI attachment to proteins factor 3 [Brachypodium 
distachyon]
Length=348

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD+DLTE+LD+SSAVALLG+S+IL+++RTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  185  SSIFHTRDIDLTEKLDYSSAVALLGYSLILSLIRTFNVKDEATRVMFAAPILAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DYG N KVC  M + +L  W +WAGV+ HPSR+KLW VV  G ++ ++EV+DF
Sbjct  245  YLNFYDLDYGWNMKVCVVMAVVQLLAWAIWAGVTCHPSRFKLWFVVFVGALSMLLEVYDF  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLTYL+WSF++DD+EFRT++L KKAK
Sbjct  305  PPYKGYADAHSLWHACTIPLTYLWWSFIKDDAEFRTSTLIKKAK  348



>emb|CDY68708.1| BnaA06g38370D [Brassica napus]
Length=343

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVD+TERLD+SSA+A+LGFS+ILAILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  176  SAVFHSRDVDITERLDYSSAIAVLGFSLILAILRTFDVRVEAARVMVSAPILAFVTTHIL  235

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +A+L +W  WA VSRHPS WKLWVVV+ G +A ++E++DF
Sbjct  236  YINFYKLDYGWNMIVCVTMGVAQLLLWARWAAVSRHPSSWKLWVVVVAGGLAMLLEIYDF  295

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  296  PPYEGYFDAHSIWHAITIPLTVLWWSFIRDDAEFRTSSLLKKSK  339



>ref|XP_009149093.1| PREDICTED: post-GPI attachment to proteins factor 3 [Brassica 
rapa]
Length=343

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVD+TERLD+SSA+A+LGFS+ILAILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  176  SAVFHSRDVDITERLDYSSAIAVLGFSLILAILRTFDVRVEAARVMVSAPILAFVTTHIL  235

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +A+L +W  WA VSRHPS WKLWVVV+ G +A ++E++DF
Sbjct  236  YINFYKLDYGWNMIVCVTMGVAQLLLWARWAAVSRHPSSWKLWVVVVAGGLAMLLEIYDF  295

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  296  PPYEGYFDAHSIWHAITIPLTVLWWSFIRDDAEFRTSSLLKKSK  339



>ref|XP_010094756.1| hypothetical protein L484_019966 [Morus notabilis]
 gb|EXB56921.1| hypothetical protein L484_019966 [Morus notabilis]
Length=342

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FHSRDVDLTE+LD+SSAVALLG+S IL+ILR+FNV+ EA RVMVA+P ++F+ THI+
Sbjct  179  SAIFHSRDVDLTEKLDYSSAVALLGYSFILSILRSFNVKAEASRVMVAAPFLSFIATHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            +LNFY+ DYG N KVC  + +A+L IW ++AGV+RHPSRWKLW+VV+GG +A ++E++DF
Sbjct  239  FLNFYKLDYGWNMKVCVVLAVAQLLIWAIFAGVTRHPSRWKLWLVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WHAT IPLTY++WSF+RDD+EF+T++L KKAK
Sbjct  299  PPYQGFVDAHALWHATTIPLTYIWWSFIRDDAEFQTSNLLKKAK  342



>ref|XP_006416803.1| hypothetical protein EUTSA_v10008113mg [Eutrema salsugineum]
 gb|ESQ35156.1| hypothetical protein EUTSA_v10008113mg [Eutrema salsugineum]
Length=342

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+IL+ILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  175  SAVFHSRDVDLTERLDYSSAVAVLGFSLILSILRTFDVRVEAARVMVSAPILAFVTTHIL  234

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VSRHPS WKLWVVVI G +A ++E++DF
Sbjct  235  YINFYKLDYGWNMIVCVAMGVSQLLLWARWAAVSRHPSNWKLWVVVIAGGLAMLLEIYDF  294

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  295  PPYEGYFDAHSIWHAATIPLTILWWSFIRDDAEFRTSSLLKKSK  338



>emb|CDY40049.1| BnaC05g12660D [Brassica napus]
Length=343

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVD+TERLD+SSA+A+LGFS+ILAILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  176  SAVFHSRDVDITERLDYSSAIAVLGFSLILAILRTFDVRVEAARVMVSAPILAFVTTHIL  235

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +A+L +W  WA VSRHPS WKLWVVV+ G +A ++E++DF
Sbjct  236  YINFYKLDYGWNMIVCVTMGVAQLLLWARWAAVSRHPSSWKLWVVVVAGGLAMLLEIYDF  295

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  +PLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  296  PPYEGYFDAHSIWHAITVPLTVLWWSFIRDDAEFRTSSLLKKSK  339



>ref|XP_002448009.1| hypothetical protein SORBIDRAFT_06g019590 [Sorghum bicolor]
 gb|EES12337.1| hypothetical protein SORBIDRAFT_06g019590 [Sorghum bicolor]
Length=346

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S +FH+RD+DLTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  183  STIFHTRDIDLTEKLDYSSAVALLGYSLILSLLRAFNVKDEATRVMFAAPILAFVTTHIL  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M   +L  W VWAGVSRHPSR KLW VV GG +A ++E+ DF
Sbjct  243  YLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKLWTVVFGGALAMLLELNDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+WSF++DD+ FRT++L KKAK
Sbjct  303  PPYMGYADAHSLWHASTIPLTYLWWSFIKDDAIFRTSTLVKKAK  346



>tpg|DAA37379.1| TPA: hypothetical protein ZEAMMB73_215322 [Zea mays]
Length=348

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD+DLTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  185  SSIFHTRDIDLTEKLDYSSAVALLGYSLILSLLRAFNVKDEASRVMFAAPILAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M   +L  W VWAGVSRHPSR K+W VV GG +A ++E++DF
Sbjct  245  YLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKVWTVVFGGALAMLLELYDF  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLT L WSF++DD++FRT +L KKAK
Sbjct  305  PPYMGYADAHSLWHASTIPLTCLLWSFIKDDAKFRTATLVKKAK  348



>gb|KJB82126.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82127.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82128.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82129.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82130.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
Length=343

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLG+S+I++ILR+FNVR EA RVMVA+P +AFVTTHIL
Sbjct  180  SAVFHSRDVDLTEKLDYSSAVALLGYSLIVSILRSFNVRVEAARVMVAAPFLAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY FDYG N KVC  + +A+L IW +W G++ HPSRWKLWVVV+GG +A ++E++DF
Sbjct  240  YLNFYTFDYGWNMKVCVAIGVAQLLIWAIWVGITCHPSRWKLWVVVVGGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+ DAHA+WHAT IPLT L+WSF+RDD++F+T+ L KKAK
Sbjct  300  PPYQGFFDAHAIWHATTIPLTCLWWSFIRDDAKFQTSILLKKAK  343



>ref|XP_009341265.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
Length=342

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV+LTE+LD+SS+VALLGFS+I+ ++R F+VRDEA RVMV +P+IAFVTTHIL
Sbjct  179  SGVFHSRDVELTEKLDYSSSVALLGFSLIVTLIRAFDVRDEAARVMVCAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L  W VWAGVS HPSRWKLW VV G  +A + E++DF
Sbjct  239  YLNFYKLDYGLNMKVCMAMGIIQLLTWAVWAGVSCHPSRWKLWAVVAGEALALLFEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+W+A  IP+TYL+WSFVRDD+EF T++L KKAK
Sbjct  299  PPYRGFIDAHALWNAINIPITYLWWSFVRDDAEFVTSALLKKAK  342



>ref|NP_001141953.1| hypothetical protein precursor [Zea mays]
 ref|XP_008667582.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87368.1| unknown [Zea mays]
 tpg|DAA37380.1| TPA: hypothetical protein ZEAMMB73_215322 [Zea mays]
Length=346

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++FH+RD+DLTE+LD+SSAVALLG+S+IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  183  SSIFHTRDIDLTEKLDYSSAVALLGYSLILSLLRAFNVKDEASRVMFAAPILAFVTTHIL  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M   +L  W VWAGVSRHPSR K+W VV GG +A ++E++DF
Sbjct  243  YLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKVWTVVFGGALAMLLELYDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLT L WSF++DD++FRT +L KKAK
Sbjct  303  PPYMGYADAHSLWHASTIPLTCLLWSFIKDDAKFRTATLVKKAK  346



>ref|XP_010497975.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
 ref|XP_010497976.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=342

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+ILAILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  175  SAVFHSRDVDLTERLDYSSAVAVLGFSLILAILRTFDVRVEAARVMVSAPILAFVTTHIL  234

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  235  YINFYKLDYGWNMIVCVAMGVSQLLLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  294

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  295  PPYEGYFDAHSIWHAATIPLTVLWWSFIRDDAEFRTSSLLKKSK  338



>ref|XP_004140795.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cucumis 
sativus]
Length=346

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +A FH RDV+LTE+LD+SSAVA +GFS+I+AILR  NVRDEA +VMV++PII+FVTTHIL
Sbjct  183  NAAFHCRDVELTEKLDYSSAVAFIGFSLIVAILRALNVRDEAAKVMVSAPIISFVTTHIL  242

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L +W VWA +SRH S+WKLW++V GG VA ++E FDF
Sbjct  243  YLNFYKLDYGLNAKVCLVMGITQLLVWAVWAVLSRHLSQWKLWILVFGGAVAILLEAFDF  302

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPL+Y++WSFVRDD+EFRT++L KK K
Sbjct  303  PPYGGYVDAHALWHATSIPLSYIWWSFVRDDAEFRTSALLKKVK  346



>gb|KGN57336.1| hypothetical protein Csa_3G180250 [Cucumis sativus]
Length=347

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +A FH RDV+LTE+LD+SSAVA +GFS+I+AILR  NVRDEA +VMV++PII+FVTTHIL
Sbjct  184  NAAFHCRDVELTEKLDYSSAVAFIGFSLIVAILRALNVRDEAAKVMVSAPIISFVTTHIL  243

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L +W VWA +SRH S+WKLW++V GG VA ++E FDF
Sbjct  244  YLNFYKLDYGLNAKVCLVMGITQLLVWAVWAVLSRHLSQWKLWILVFGGAVAILLEAFDF  303

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+WHAT IPL+Y++WSFVRDD+EFRT++L KK K
Sbjct  304  PPYGGYVDAHALWHATSIPLSYIWWSFVRDDAEFRTSALLKKVK  347



>ref|XP_010459200.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
 ref|XP_010459201.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=342

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+ILAILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  175  SAVFHSRDVDLTERLDYSSAVAVLGFSLILAILRTFDVRVEAARVMVSAPILAFVTTHIL  234

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  235  YINFYKLDYGWNMIVCVAMGVSQLLLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  294

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT++L KK+K
Sbjct  295  PPYEGYFDAHSIWHAATIPLTILWWSFIRDDAEFRTSTLLKKSK  338



>ref|XP_004308119.1| PREDICTED: post-GPI attachment to proteins factor 3 [Fragaria 
vesca subsp. vesca]
Length=344

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVF SRDV+LTE+LD SSAVALLGFS+ILAILR FNVRDEA RVMV +P+IAFVTTHIL
Sbjct  181  SAVFQSRDVELTEKLDISSAVALLGFSLILAILRAFNVRDEAARVMVCAPVIAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  M + +L  W +WAG +RHPSRWKLWVVV GG +  ++E++DF
Sbjct  241  YLNFYKLDCGLNMKVCIAMGVLQLLTWAIWAGTTRHPSRWKLWVVVAGGSITMLLEIYDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+ +A  IPLTYL+WSFV+DD+EF T +L KKAK
Sbjct  301  PPYRGFIDAHAISNAITIPLTYLWWSFVKDDAEFMTAALLKKAK  344



>ref|XP_010476769.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
 ref|XP_010476770.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=342

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSA+A+LGFS+ILAILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  175  SAVFHSRDVDLTERLDYSSAIAVLGFSLILAILRTFDVRVEAARVMVSAPILAFVTTHIL  234

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  235  YINFYKLDYGWNMIVCVAMGVSQLLLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  294

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  +PLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  295  PPYEGYFDAHSIWHAATVPLTILWWSFIRDDAEFRTSSLLKKSK  338



>ref|XP_008377107.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Malus 
domestica]
Length=342

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV+LTE+LD+SS+VALLGFS+I+ ++R FNVRDEA RVMV +P+IAFVTTHIL
Sbjct  179  SGVFHSRDVELTEKLDYSSSVALLGFSLIVTLIRAFNVRDEAARVMVCAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L  W VWAGVS HPSR KLW VV G  +A + E++DF
Sbjct  239  YLNFYKLDYGLNMKVCMAMGIIQLLTWAVWAGVSCHPSRCKLWAVVAGEALALLFEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+W+A  IP+TYL+WSFVRDD+EF T++L KKAK
Sbjct  299  PPYQGFIDAHALWNAINIPITYLWWSFVRDDAEFVTSALLKKAK  342



>ref|XP_009383493.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009383494.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH+RD DLTE+LD+SSAVA+LG+S IL++LR FNV+DEA RVM A+PI+AFVTTHIL
Sbjct  180  SAIFHTRDFDLTEKLDYSSAVAVLGYSFILSLLRIFNVKDEASRVMFAAPILAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M ++++ +W +W GV+RHPSR+KLW  +IG  +A ++E++DF
Sbjct  240  YLNFYEMDYGWNMKVCLVMGVSQILMWVIWGGVTRHPSRFKLWTAMIGCALAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P+ GYVDAHA+WHAT IPLTYL+WSF++DD++FRT++L KK K
Sbjct  300  PPFHGYVDAHALWHATTIPLTYLWWSFIKDDAKFRTSTLVKKVK  343



>ref|XP_006305176.1| hypothetical protein CARUB_v10009543mg, partial [Capsella rubella]
 gb|EOA38074.1| hypothetical protein CARUB_v10009543mg, partial [Capsella rubella]
Length=358

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+I+AILRTF+VR EA RVMV++PI+AFVTTHIL
Sbjct  191  SAVFHSRDVDLTERLDYSSAVAVLGFSLIVAILRTFDVRVEAARVMVSAPILAFVTTHIL  250

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  251  YINFYKLDYGWNMIVCVAMGVSQLLLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  310

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  311  PPYEGYFDAHSIWHAATIPLTILWWSFIRDDAEFRTSSLLKKSK  354



>ref|XP_007022223.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022224.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022225.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022227.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022229.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13748.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13749.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13750.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13752.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13754.1| Per1-like family protein isoform 2 [Theobroma cacao]
Length=343

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLG+S++L ILR+FNVRDEA RVMVA+P++AF TTHIL
Sbjct  180  SAVFHSRDVDLTEKLDYSSAVALLGYSLLLTILRSFNVRDEAARVMVAAPLLAFTTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            +LNFY  DYG N KVC  M +A+L IW +WAG + HPSRWKLWVVV GG +A ++E++DF
Sbjct  240  FLNFYSLDYGWNMKVCVVMGVAQLLIWAIWAGRTHHPSRWKLWVVVFGGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+ DAHA+WHAT IPLT ++WSF+RDD++ RT+ L KKAK
Sbjct  300  PPYQGFFDAHALWHATTIPLTCIWWSFIRDDAKLRTSVLLKKAK  343



>ref|XP_007133380.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
 ref|XP_007133381.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
 gb|ESW05374.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
 gb|ESW05375.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
Length=343

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDVDLTE+LD+SSAV LLG+S+ILAILRTF+VRDEA RVMVA+P IAFVTTH++
Sbjct  180  SGVFHSRDVDLTEKLDYSSAVVLLGYSLILAILRTFSVRDEATRVMVAAPFIAFVTTHVM  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY  DYG N  VC  M +A+L++W VWAG S+HPSRWKL  VV  G +A ++E++DF
Sbjct  240  YINFYLLDYGWNMIVCVVMAVAQLSMWAVWAGCSKHPSRWKLLFVVFSGGLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G  DAHA+WHAT IPLTY++WSF+RDD+ FRT++L KKAK
Sbjct  300  PPYHGLFDAHAIWHATTIPLTYIWWSFIRDDAVFRTSNLVKKAK  343



>ref|XP_009615087.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRD+D TE+LD+SSAVALLGFS+I++ILR+F+V++EA RV+VA+P++AF  THIL
Sbjct  179  SAVFHSRDMDFTEKLDYSSAVALLGFSLIISILRSFSVKNEAARVLVAAPLLAFTVTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYG N KVC  + +++L IW +WAG+SRHPSRWKLW VV+GG +A ++E++DF
Sbjct  239  YLNNYQMDYGWNMKVCVVIAVSQLLIWAIWAGISRHPSRWKLWTVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G VDAHA+WHAT IPLTY++WSF++DD++F T++LSKK K
Sbjct  299  PPYQGLVDAHALWHATTIPLTYIWWSFIKDDAKFGTSNLSKKVK  342



>ref|XP_009366488.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009366489.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009366490.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009350544.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009350545.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009350546.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
Length=353

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FHS+DVDLTE+LD+S AVA+LG+S+IL+ILR+F+V+D+A RVMVA+P++AFVTTHIL
Sbjct  181  SALFHSKDVDLTEKLDYSCAVAILGYSLILSILRSFDVKDDAVRVMVAAPLLAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N +VC  M + +L +W VWAGV+RHPSRWKLWVVV+GG +A ++E++DF
Sbjct  241  YLNFYKLDYGWNMQVCVVMAVVQLLLWAVWAGVTRHPSRWKLWVVVVGGGLAMLLEIYDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK*DGSAK  206
             PY+G++DAHA WHAT IPLTY++WSF+RDD+EF T++  K+ +    AK
Sbjct  301  PPYYGFLDAHAAWHATTIPLTYIWWSFIRDDAEFVTSNQVKRLRNSNVAK  350



>ref|XP_009404456.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH+RD DLTE+LD+SSAVA+LG+S+IL +LR F+V+DEA RVM A+PI+AFVTTHIL
Sbjct  180  SAIFHTRDFDLTEKLDYSSAVAVLGYSLILCLLRVFDVKDEASRVMFAAPILAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +++L +W +W GV+RHPSR+KLW VV G  +A ++E++DF
Sbjct  240  YLNFYEMDYGWNMKVCLLMGVSQLLMWAIWGGVTRHPSRFKLWAVVFGCSLAMLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P+ GY DAHA+WHAT IPLTYL+WSF++DD++FRT++L KK K
Sbjct  300  PPFHGYADAHALWHATTIPLTYLWWSFIKDDAKFRTSALVKKVK  343



>ref|XP_002322440.1| hypothetical protein POPTR_0015s13810g [Populus trichocarpa]
 gb|EEF06567.1| hypothetical protein POPTR_0015s13810g [Populus trichocarpa]
Length=345

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+L  SSAVALLGFS+ILAILR F+VR+EA RVMV++P+IAFVTTHIL
Sbjct  182  SAVFHSRDVELTEKLHFSSAVALLGFSLILAILRAFSVRNEASRVMVSTPVIAFVTTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN Y  DYGLN KVC  M +A+L IW VWAGV+ HPS  KLWV V+GG +A ++E++DF
Sbjct  242  YLNCYNLDYGLNIKVCVTMGVAQLLIWAVWAGVTHHPSWSKLWVAVVGGGLAMLLEIYDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY  +VDAHA+WHAT IPLTYL+WSF +DD+EFRT+SL KKAK
Sbjct  302  PPYHRFVDAHALWHATTIPLTYLWWSFAKDDAEFRTSSLHKKAK  345



>ref|XP_009117756.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Brassica 
rapa]
 ref|XP_009117757.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Brassica 
rapa]
 emb|CDY50998.1| BnaA09g56270D [Brassica napus]
Length=344

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDVD+TERLD+SSA+A++GFS+I++ILRTF+VR EA RVMV++P++AFVTTHIL
Sbjct  177  SAVFHTRDVDITERLDYSSAIAVIGFSLIVSILRTFDVRVEAARVMVSAPVLAFVTTHIL  236

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +A+L +W  WA VSRHPS WKLW+VVI   +A ++E++DF
Sbjct  237  YINFYKLDYGWNMIVCVAMGVAQLLLWARWAAVSRHPSNWKLWMVVIASGLAMLLEIYDF  296

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  297  PPYEGYFDAHSIWHAATIPLTVLWWSFIRDDAEFRTSSLLKKSK  340



>ref|XP_008376516.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Malus 
domestica]
Length=342

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV+LTE+LD+SS+VALLGFS+IL + R FNVRDEA RVMV++P+IAFVTTHIL
Sbjct  179  SGVFHSRDVELTEKLDYSSSVALLGFSLILTLFRAFNVRDEAARVMVSAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L  W VWAG+S HPSRWKLWVVV GG +A   E++D 
Sbjct  239  YLNFYKLDYGLNVKVCMAMGIVQLLTWAVWAGISCHPSRWKLWVVVAGGALALFFEIYDL  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+W+A  IP+TYL+WSFVRDD+EF T++  KKAK
Sbjct  299  PPYRGFIDAHALWNAINIPVTYLWWSFVRDDAEFVTSAHLKKAK  342



>ref|XP_009411454.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=342

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
             A+FH+R  DLTE+LD+SS+VALLGFS+ILA+LRTFNV++EA RVMVA+P++AF+TTHIL
Sbjct  179  GAIFHTRGFDLTEKLDYSSSVALLGFSLILAVLRTFNVKNEASRVMVAAPLLAFLTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A++  W VWAG++ HPSR+K+W VV+GG +A ++E++DF
Sbjct  239  YLNFYELDYGLNVKVCITMGIAQVLFWAVWAGITHHPSRFKIWAVVVGGAMAILLELYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVD+HA+WHAT IPL YL+WSFV +D++FRT++++KK++
Sbjct  299  PPYKGYVDSHALWHATNIPLAYLWWSFVYEDAKFRTSTITKKSR  342



>ref|XP_009802480.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
sylvestris]
Length=342

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRD+D TE+LD+SSAVALLGFS+I++ILR+F+V++EA RV+VA+P++AF  THIL
Sbjct  179  SAVFHSRDMDFTEKLDYSSAVALLGFSLIISILRSFSVKNEAARVLVAAPLLAFTVTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYG N KVC  + +++L IW  WAG+SRHPSRWKLW VV GG +A ++E++DF
Sbjct  239  YLNNYQMDYGWNMKVCVVIAVSQLLIWAFWAGISRHPSRWKLWTVVGGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G VDAHA+WHAT IPLTY++WSF++DD++F T++LSKK K
Sbjct  299  PPYQGLVDAHALWHATTIPLTYIWWSFIKDDAKFGTSNLSKKVK  342



>ref|XP_010676806.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Beta 
vulgaris subsp. vulgaris]
Length=361

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRD+DLTE+LD+SSAVA+LG+S+I++I+R+F+VRDEA RVMVA+P++AF+TTHIL
Sbjct  198  SAVFHSRDIDLTEKLDYSSAVAVLGYSLIVSIMRSFHVRDEAARVMVAAPLLAFITTHIL  257

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN Y+ DYG N +VC  M + +L  W +WAGV+ HPSRWKLW VV+ G  A ++EV+DF
Sbjct  258  YLNNYKMDYGWNMQVCVVMAVVQLLTWAIWAGVTHHPSRWKLWFVVVAGGFAMLLEVYDF  317

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G VDAHA+WHAT IPLT+L+WSF++DD+++RTT L++K K
Sbjct  318  PPYEGLVDAHALWHATTIPLTHLWWSFIKDDAKYRTTDLTRKIK  361



>dbj|BAK02712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+VFH+RD+DLTE+LD+SSAVA+LG+S+IL +LR FNV+D A RVM A+PI+AFVTTHIL
Sbjct  190  SSVFHTRDIDLTEKLDYSSAVAVLGYSLILTLLRIFNVKDAAARVMFAAPILAFVTTHIL  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M + ++  W  WAGV+RHPSR+KLWVVV GG +A ++EVFDF
Sbjct  250  YLNFYELDYGWNMKVCVAMGVVQIVAWATWAGVTRHPSRFKLWVVVFGGALAMLLEVFDF  309

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLS--KKAK  224
             PY GY DAH++WHA+ +PLTYL+WSF++DD+EFRT++L+  KKA+
Sbjct  310  PPYKGYADAHSLWHASTVPLTYLWWSFIKDDAEFRTSTLTLVKKAR  355



>ref|NP_001031058.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AEE29471.1| Per1-like family protein [Arabidopsis thaliana]
Length=287

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+ILAILRTF++R EA RVMV++PI+AFVTTHIL
Sbjct  120  SAVFHSRDVDLTERLDYSSAVAILGFSLILAILRTFDIRVEAARVMVSAPILAFVTTHIL  179

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  180  YINFYKLDYGWNMIVCVAMGVSQLFLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  239

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTS  242
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+S
Sbjct  240  PPYEGYFDAHSIWHAATIPLTILWWSFIRDDAEFRTSS  277



>ref|XP_009411453.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
             A+FH+R  DLTE+LD+SS+VALLGFS+ILA+LRTFNV++EA RVMVA+P++AF+TTHIL
Sbjct  179  GAIFHTRGFDLTEKLDYSSSVALLGFSLILAVLRTFNVKNEASRVMVAAPLLAFLTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M +A++  W VWAG++ HPSR+K+W VV+GG +A ++E++DF
Sbjct  239  YLNFYELDYGLNVKVCITMGIAQVLFWAVWAGITHHPSRFKIWAVVVGGAMAILLELYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK*DGSAKLL  200
             PY GYVD+HA+WHAT IPL YL+WSFV +D++FRT++++KK+    S  L+
Sbjct  299  PPYKGYVDSHALWHATNIPLAYLWWSFVYEDAKFRTSTITKKSSFHSSFGLM  350



>ref|XP_008795943.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Phoenix 
dactylifera]
Length=343

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH+R  DLTE+LD+SSAVA LGFS IL +LRTFNV+DEA RVM+A+PI+AFVTTHIL
Sbjct  180  SAIFHTRGFDLTEKLDYSSAVASLGFSFILCLLRTFNVKDEASRVMLAAPILAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ DYG N KVC  M +  L +W +WAG++ HPSR KLWV V G  +A ++E++DF
Sbjct  240  YLNFYQLDYGWNMKVCVTMGVTTLLVWAIWAGITYHPSRIKLWVNVFGVALALLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAHAVWHA  IPLTYL+WSF++DD+ FRT+ L KK K
Sbjct  300  PPYMGYADAHAVWHAATIPLTYLWWSFIKDDAVFRTSVLIKKVK  343



>dbj|BAJ93369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S +FH+RD+DLTE+LD+SSAVA LG+S+IL +LRTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  185  STIFHTRDIDLTEKLDYSSAVAQLGYSLILTLLRTFNVKDEAGRVMFAAPILAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DYG N KVC  M +  +  W +WA ++ HPSR+K+W+V+ GG +A ++EV+DF
Sbjct  245  YLNFYDLDYGWNMKVCVAMGVVHVVAWSIWAAMTHHPSRFKVWIVIFGGALAMLLEVYDF  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+W+FVRDD+EFRT++L KKAK
Sbjct  305  PPYKGYADAHSLWHASTIPLTYLWWTFVRDDAEFRTSTLVKKAK  348



>dbj|BAK01927.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S +FH+RD+DLTE+LD+SSAVA LG+S+IL +LRTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  185  STIFHTRDIDLTEKLDYSSAVAQLGYSLILTLLRTFNVKDEAGRVMFAAPILAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DYG N KVC  M +  +  W +WA ++ HPSR+K+W+V+ GG +A ++EV+DF
Sbjct  245  YLNFYDLDYGWNMKVCVAMGVVHVVAWSIWAAMTHHPSRFKVWIVIFGGALAMLLEVYDF  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+W+FVRDD+EFRT++L KKAK
Sbjct  305  PPYKGYADAHSLWHASTIPLTYLWWTFVRDDAEFRTSTLVKKAK  348



>gb|EMT11964.1| hypothetical protein F775_08311 [Aegilops tauschii]
Length=343

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S +FH+RD+DLTE+LD+SSAVA LG+S+IL +LRTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  180  STIFHTRDIDLTEKLDYSSAVAQLGYSLILTLLRTFNVKDEAGRVMFAAPILAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +  +  W  WA V+ HPSR+K+W+V+ GG +A ++EV+DF
Sbjct  240  YLNFYELDYGWNMKVCVAMGVVHIVAWTTWAVVTHHPSRFKVWIVIFGGALAMLLEVYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+W+FVRDD+EFRT++L KKAK
Sbjct  300  PPYKGYADAHSLWHASTIPLTYLWWTFVRDDAEFRTSTLVKKAK  343



>gb|EPS57354.1| hypothetical protein M569_17464 [Genlisea aurea]
Length=345

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH RDVD+TE++D+SSAVA LG+S+ LA++R F+VR EA RVMVA+P+ AFVTTHIL
Sbjct  182  SAVFHMRDVDITEKIDYSSAVAFLGYSLFLAVIRAFSVRVEAARVMVAAPVFAFVTTHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNF+ FDYG N KVC  M + ++ +W VWAGVSRHPSRWK+W VV GG  A ++EV+DF
Sbjct  242  YLNFFFFDYGWNMKVCVAMGLIQMVLWAVWAGVSRHPSRWKVWAVVFGGGAAMLLEVYDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKK  230
             PYWG  DAHA+WH + IPLTYL+WSF RDD+EFRT +L KK
Sbjct  302  PPYWGVFDAHALWHLSTIPLTYLWWSFARDDTEFRTRALMKK  343



>ref|XP_010925813.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Elaeis 
guineensis]
Length=343

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH+RD D TE+LD+SSAVA LGFS IL +LRTFNV+ EA RVM A+PI+AFVTTHIL
Sbjct  180  SAIFHTRDFDWTEKLDYSSAVASLGFSFILCLLRTFNVKVEASRVMFAAPILAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ DYG N KVC  M +A L +W +WAG++RHPSR KLWV V G  +A ++E++DF
Sbjct  240  YLNFYQLDYGWNMKVCVTMGVATLLVWAIWAGITRHPSRIKLWVNVFGVALALLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAHA+WHA  IPLTYL+WSF++DD+ FRT+ L KK K
Sbjct  300  PPYMGYADAHALWHAATIPLTYLWWSFIKDDAVFRTSVLIKKVK  343



>ref|XP_002510848.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51450.1| conserved hypothetical protein [Ricinus communis]
Length=341

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  709  VFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYL  530
            +F   DV+ TE+LD+SSAVALLGF+ ILAILR F++RDEA RVMVA+P+IAF+TTHI+YL
Sbjct  180  LFAITDVEFTEKLDYSSAVALLGFTFILAILRAFSIRDEAARVMVAAPVIAFLTTHIMYL  239

Query  529  NFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAP  350
            NFY  DYGLN KVC  M +A+L IW VWAG++ HPSRWKLWVVV+GG +A ++E++DF P
Sbjct  240  NFYNLDYGLNLKVCTAMGIAQLLIWAVWAGITGHPSRWKLWVVVVGGGLAMLLEIYDFPP  299

Query  349  YWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            Y G+VDAHA+WHA+ IP  YL+W FVRDD+EFRT+ L KK K
Sbjct  300  YHGFVDAHALWHASTIPFAYLWWRFVRDDAEFRTSCLLKKTK  341



>gb|KJB26985.1| hypothetical protein B456_004G270100 [Gossypium raimondii]
Length=342

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+R+VDLTE LD+SSAVALLG+S+IL+ILR+FNVRDEA RVMVA+P +AF TTHIL
Sbjct  179  SIVFHTREVDLTESLDYSSAVALLGYSLILSILRSFNVRDEAGRVMVAAPFLAFFTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DYG N KVC  M +A+L +W +WAGV+RHPSRWKLW VV G  +A ++E +DF
Sbjct  239  YLNFYNLDYGWNVKVCAIMGVAQLLVWAIWAGVTRHPSRWKLWTVVFGSGLAMLLEFYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P++G  DAH++WH T +PLT+L+WSF+RDD+E RT    KK K
Sbjct  299  PPHYGVFDAHSLWHGTTVPLTFLWWSFIRDDAEIRTLDFIKKIK  342



>ref|XP_009371276.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
Length=342

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRDV+LTE+LD+SS+VALLGFS+IL + R FNVRDEA RVMV++P+IAFVTTHIL
Sbjct  179  SGVFHSRDVELTEKLDYSSSVALLGFSLILTLFRAFNVRDEAARVMVSAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  M + +L  W VWAG++ HPSR +LWVVV GG +A   E++DF
Sbjct  239  YLNFYKLDYGLNVKVCMAMGIVQLLTWAVWAGINHHPSRVQLWVVVAGGALALFFEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G++DAHA+W+A  IP+TYL+WSFVRDD+EF T++  KKAK
Sbjct  299  PPYRGFIDAHALWNAINIPVTYLWWSFVRDDAEFVTSAHLKKAK  342



>emb|CDX81768.1| BnaC08g38330D [Brassica napus]
Length=410

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDVD+TERLD+SSA+A++GFS+I++ILRTF+VR EA RVMV++P++AFVTTHIL
Sbjct  243  SAVFHTRDVDITERLDYSSAIAVIGFSLIVSILRTFDVRVEAARVMVSAPVLAFVTTHIL  302

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +A+L +W  WA VSRHPS WKLWVVV+   +A ++E++DF
Sbjct  303  YINFYKLDYGWNMIVCVVMGVAQLLLWARWAVVSRHPSNWKLWVVVLASGLAMLLEIYDF  362

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA  +PLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  363  PPYEGYFDAHSIWHAATVPLTVLWWSFIRDDAEFRTSSLLKKSK  406



>gb|EMS64956.1| hypothetical protein TRIUR3_20884 [Triticum urartu]
Length=357

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S +FH+RD+DLTE++D+SSAVA LG+S+IL +LRTFNV+DEA RVM A+PI+AFVTTHIL
Sbjct  194  STIFHTRDIDLTEKMDYSSAVAQLGYSLILTLLRTFNVKDEAGRVMFAAPILAFVTTHIL  253

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M +  +  W  WA V+ HPSR+K+W+V+ GG +A ++EV+DF
Sbjct  254  YLNFYELDYGWNMKVCVAMGVVHIVAWTTWAVVTHHPSRFKVWIVIFGGALAVLLEVYDF  313

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WHA+ IPLTYL+W+FVRDD+EFRT++L KKAK
Sbjct  314  PPYKGYADAHSLWHASTIPLTYLWWTFVRDDAEFRTSTLVKKAK  357



>ref|NP_173104.1| Per1-like family protein [Arabidopsis thaliana]
 ref|NP_973842.1| Per1-like family protein [Arabidopsis thaliana]
 ref|NP_973843.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AAG10825.1|AC011808_13 Unknown protein [Arabidopsis thaliana]
 dbj|BAH20175.1| AT1G16560 [Arabidopsis thaliana]
 gb|AEE29468.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AEE29469.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AEE29470.1| Per1-like family protein [Arabidopsis thaliana]
Length=342

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+ILAILRTF++R EA RVMV++PI+AFVTTHIL
Sbjct  175  SAVFHSRDVDLTERLDYSSAVAILGFSLILAILRTFDIRVEAARVMVSAPILAFVTTHIL  234

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  235  YINFYKLDYGWNMIVCVAMGVSQLFLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  294

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTS  242
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+S
Sbjct  295  PPYEGYFDAHSIWHAATIPLTILWWSFIRDDAEFRTSS  332



>dbj|BAH19866.1| AT1G16560 [Arabidopsis thaliana]
Length=337

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+ILAILRTF++R EA RVMV++PI+AFVTTHIL
Sbjct  170  SAVFHSRDVDLTERLDYSSAVAILGFSLILAILRTFDIRVEAARVMVSAPILAFVTTHIL  229

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M +++L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  230  YINFYKLDYGWNMIVCVAMGVSQLFLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  289

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTS  242
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+S
Sbjct  290  PPYEGYFDAHSIWHAATIPLTILWWSFIRDDAEFRTSS  327



>ref|XP_004250185.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
lycopersicum]
Length=342

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH RD+D TE+LD+SSAVALLGFS+I+++LR+F+V++EA RV+VA+P++AF TTHIL
Sbjct  179  SAIFHGRDMDFTEKLDYSSAVALLGFSLIVSVLRSFSVKNEATRVLVAAPLLAFTTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYG N KVC  + +++L IW +WAG+S HPSRWKLW VV+GG +A ++E++DF
Sbjct  239  YLNNYQMDYGWNMKVCVVIAVSQLLIWSIWAGISHHPSRWKLWTVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKK  230
             PY G VDAHA+WHAT IPLTY++WSF++DD++F T++ SKK
Sbjct  299  PPYQGLVDAHALWHATTIPLTYIWWSFIKDDAKFGTSNSSKK  340



>gb|EMT06679.1| hypothetical protein F775_25984 [Aegilops tauschii]
Length=358

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+VFH+RD+DLTE+LD+SSAVA+LG+S+IL +LR FNV++ A RVM A+PI+AFVTTHIL
Sbjct  193  SSVFHTRDIDLTEKLDYSSAVAVLGYSLILTLLRIFNVKEGATRVMFAAPILAFVTTHIL  252

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M + ++  W +WAGV+ HPSR KLWVVV GG +A ++EVFDF
Sbjct  253  YLNFYELDYGWNMKVCVAMGVVQIVAWAIWAGVTHHPSRLKLWVVVFGGALAMLLEVFDF  312

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLS--KKAK  224
             PY GY DAH++WHA+ +PLTYL+WSF++DD++FRT++L+  KKA+
Sbjct  313  PPYKGYADAHSLWHASTVPLTYLWWSFIKDDAQFRTSTLTLVKKAR  358



>ref|XP_002890173.1| hypothetical protein ARALYDRAFT_471855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66432.1| hypothetical protein ARALYDRAFT_471855 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTERLD+SSAVA+LGFS+ILAILRTF++R EA RVMV++PI+AFVTTHIL
Sbjct  175  SAVFHSRDVDLTERLDYSSAVAVLGFSLILAILRTFDIRVEATRVMVSAPILAFVTTHIL  234

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DYG N  VC  M + +L +W  WA VS HPS WKLWVVVI G +A ++E++DF
Sbjct  235  YINFYKLDYGWNMIVCVTMGVTQLFLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDF  294

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTS  242
             PY GY DAH++WHA  IPLT L+WSF+RDD+EFRT+S
Sbjct  295  PPYEGYFDAHSIWHAATIPLTILWWSFIRDDAEFRTSS  332



>ref|XP_007022222.1| Per1-like family protein isoform 1 [Theobroma cacao]
 gb|EOY13747.1| Per1-like family protein isoform 1 [Theobroma cacao]
Length=355

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 139/176 (79%), Gaps = 12/176 (7%)
 Frame = -2

Query  715  SAVFHSR------------DVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVA  572
            SAVFHSR            DVDLTE+LD+SSAVALLG+S++L ILR+FNVRDEA RVMVA
Sbjct  180  SAVFHSRFRVSQLVMCQTCDVDLTEKLDYSSAVALLGYSLLLTILRSFNVRDEAARVMVA  239

Query  571  SPIIAFVTTHILYLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvvig  392
            +P++AF TTHIL+LNFY  DYG N KVC  M +A+L IW +WAG + HPSRWKLWVVV G
Sbjct  240  APLLAFTTTHILFLNFYSLDYGWNMKVCVVMGVAQLLIWAIWAGRTHHPSRWKLWVVVFG  299

Query  391  gvvatvveVFDFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            G +A ++E++DF PY G+ DAHA+WHAT IPLT ++WSF+RDD++ RT+ L KKAK
Sbjct  300  GGLAMLLEIYDFPPYQGFFDAHALWHATTIPLTCIWWSFIRDDAKLRTSVLLKKAK  355



>ref|XP_009382286.1| PREDICTED: post-GPI attachment to proteins factor 3 [Musa acuminata 
subsp. malaccensis]
Length=342

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
             A++H+R  DLTE+LDHSS+VAL+GF++ILA+LRTFNV+ EA RVM+ +P++AF+TTHIL
Sbjct  179  GAIYHTRCFDLTEKLDHSSSVALIGFALILAVLRTFNVKTEASRVMIGAPLLAFLTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D+ LN KVC  M + ++ +W VWAGV+RHPSR+K+W VVIGG +A  +E++DF
Sbjct  239  YLNFYKLDHELNMKVCVAMGIGQVLLWSVWAGVTRHPSRFKIWAVVIGGAMAIFLELYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVD+HA+WHAT IPL YL+WSFV +D EFRT+++ KKA+
Sbjct  299  PPYKGYVDSHALWHATNIPLAYLWWSFVYEDVEFRTSAIMKKAR  342



>ref|XP_011083636.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Sesamum indicum]
 ref|XP_011083637.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Sesamum indicum]
Length=358

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD++ AVALLG+S+ILAI+R+F++R    RVMVA+P+IAF  THI 
Sbjct  179  SAVFHSRDVDLTEKLDYTFAVALLGYSLILAIIRSFSLRGGPARVMVAAPLIAFTITHIF  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            +LN Y+ DYG N KVC  M +A+L  W +WAGV+RHPSRWKLW VV+GG +A ++E+FDF
Sbjct  239  FLNLYRMDYGWNMKVCVIMGIAQLLTWSIWAGVTRHPSRWKLWTVVVGGGLAMLLEIFDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKA  227
             PY G VDAHA+WHA+ +PLTY++WSF++DD+E+RT+SLS+K 
Sbjct  299  PPYQGLVDAHALWHASTVPLTYIWWSFIKDDAEYRTSSLSRKG  341



>ref|XP_006364637.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
tuberosum]
Length=342

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FH RD+D TE+LD+SSAV LLGFS+I+++LR+F+V++EA RV+VA+P++AF  THIL
Sbjct  179  SAIFHGRDMDFTEKLDYSSAVVLLGFSLIVSVLRSFSVKNEATRVLVAAPLLAFTITHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN+YQ DYG N KVC  + +++L IW +WAG+S HPSRWKLW VV+GG +A ++E++DF
Sbjct  239  YLNYYQMDYGWNMKVCVVIAVSQLLIWSIWAGISHHPSRWKLWTVVVGGGLAMLLEIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G VDAHA+WHAT IPLTY++WSF++DD+++ T++ SKK K
Sbjct  299  PPYLGLVDAHALWHATTIPLTYIWWSFIKDDAKYGTSNSSKKDK  342



>ref|XP_011083635.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Sesamum indicum]
Length=365

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD++ AVALLG+S+ILAI+R+F++R    RVMVA+P+IAF  THI 
Sbjct  186  SAVFHSRDVDLTEKLDYTFAVALLGYSLILAIIRSFSLRGGPARVMVAAPLIAFTITHIF  245

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            +LN Y+ DYG N KVC  M +A+L  W +WAGV+RHPSRWKLW VV+GG +A ++E+FDF
Sbjct  246  FLNLYRMDYGWNMKVCVIMGIAQLLTWSIWAGVTRHPSRWKLWTVVVGGGLAMLLEIFDF  305

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKA  227
             PY G VDAHA+WHA+ +PLTY++WSF++DD+E+RT+SLS+K 
Sbjct  306  PPYQGLVDAHALWHASTVPLTYIWWSFIKDDAEYRTSSLSRKG  348



>ref|XP_010693511.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +AVFHSRD+DLTE+L +SSAVALLGF +I+AI R F+++ EA RVMVA+P+IAFVTTHIL
Sbjct  179  AAVFHSRDLDLTEKLGYSSAVALLGFGLIVAIFRVFDIKLEASRVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  DYGLN KVC  M +A+L +W VWA VS+HPSR KLWVVV GG ++  + ++DF
Sbjct  239  YLNFYTLDYGLNMKVCLVMGLAQLLLWAVWARVSQHPSRCKLWVVVSGGALSIFLVIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PYW  +DA AVWHA  IPL+Y +WSF++DD+E+RT +L KKAK
Sbjct  299  PPYWELMDALAVWHAITIPLSYFWWSFIKDDAEYRTLTLLKKAK  342



>emb|CDX71621.1| BnaC09g26620D [Brassica napus]
Length=174

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDVD+T+RLD+SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VTTH+L
Sbjct  7    SAVFHTRDVDITKRLDYSSAIAVLGFSLIVSILRTFDVRVEAARVMVSAPVLALVTTHVL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+  Y  N  VC  M +A+L +W  WA VSRHPS WKLWVVVI   +A ++E++DF
Sbjct  67   YINFYKLYYDWNMIVCVAMGVAQLFLWARWADVSRHPSNWKLWVVVIALGLAMLLEIYDF  126

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAH++WH   +PLT L+W F+RDD+EFRT+SL +K+K
Sbjct  127  PPYGGYLDAHSIWHLATVPLTILWWRFIRDDAEFRTSSLLRKSK  170



>gb|EMS67113.1| Post-GPI attachment to proteins factor 3 [Triticum urartu]
Length=703

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+VFH+RD+DLTE+LD+SSAVA+LG+S+IL +LR FNV++ A RVM A+PI+AFVTTHIL
Sbjct  193  SSVFHTRDIDLTEKLDYSSAVAVLGYSLILTLLRIFNVKEGATRVMFAAPILAFVTTHIL  252

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KVC  M + ++  W +WAGV+ HPSR KLWVVV GG +A ++EVFDF
Sbjct  253  YLNFYELDYGWNMKVCVAMGVVQIVAWAIWAGVTHHPSRLKLWVVVFGGALAMLLEVFDF  312

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLS--KKAK  224
             PY GY DAH++WHA+ +PLTYL+WSF++DD+EFRT++L+  KKA+
Sbjct  313  PPYKGYADAHSLWHASTVPLTYLWWSFIKDDAEFRTSTLTLVKKAR  358



>ref|XP_010255551.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nelumbo 
nucifera]
Length=342

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDV LTE+L +SSAVA L +++ILAILRTFNVRDEA RV+VA+P+IAFVTTHIL
Sbjct  179  SAVFHTRDVGLTEKLHYSSAVAFLVYTLILAILRTFNVRDEAARVLVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYGLN KVC  + +A+L +W VWA ++ HPSR KLW+VV+GG +A ++ V+DF
Sbjct  239  YLNFYKLDYGLNMKVCLIIGIAQLLLWAVWAVLAHHPSRLKLWIVVMGGGLAMLLGVYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P+ G+VD HA+ HA  IPL+YL WSF++DD+EFRT +L KK K
Sbjct  299  PPHRGFVDVHALQHAATIPLSYLSWSFIKDDAEFRTLNLVKKVK  342



>emb|CDY37390.1| BnaC05g30400D [Brassica napus]
Length=174

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDVD+T+ LD+SSAVA+LGFS+IL+ILRTF+VR E  RVMV++P++A VTTH+L
Sbjct  7    SAVFHTRDVDITKMLDYSSAVAVLGFSLILSILRTFDVRVETARVMVSAPVLALVTTHVL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
             +NFY+  YG N  VC  M +A+L +W  WA VSRHPS WKLWVVVI   +A ++E++DF
Sbjct  67   CINFYKLYYGWNMIVCVAMGVAQLFLWARWAAVSRHPSNWKLWVVVIASGLAMLLEIYDF  126

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WH   + LT L+WSF+RDD EFRT+SL KK+K
Sbjct  127  PPYGGYFDAHSIWHLATVLLTILWWSFIRDDVEFRTSSLLKKSK  170



>ref|XP_010537783.1| PREDICTED: post-GPI attachment to proteins factor 3 [Tarenaya 
hassleriana]
Length=344

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE++D+SSAVALLGFS+I++ILRTFNVRDEA RVMV++PI AF  THIL
Sbjct  175  SAVFHSRDVELTEKVDYSSAVALLGFSLIVSILRTFNVRDEAARVMVSAPIAAFAITHIL  234

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN Y+ DYG N  VC  + +A+L +WG WA V  HPSRWKL VVVIGG +A ++E++DF
Sbjct  235  YLNIYKLDYGWNMIVCVVIGVAQLLLWGRWALVMSHPSRWKLGVVVIGGGMAMLLEIYDF  294

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKA  227
             PY G+ DAH++WHA  +PLTYL+WSF+RDD+ FRT+SL K A
Sbjct  295  PPYAGFFDAHSIWHAATVPLTYLWWSFIRDDAVFRTSSLLKNA  337



>gb|EYU19511.1| hypothetical protein MIMGU_mgv1a009409mg [Erythranthe guttata]
Length=343

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +AVFH+RDV+LTE++D SS VAL G+S+ LAI+R FNVR EA RVMV +PI AFV THIL
Sbjct  180  TAVFHTRDVELTEKVDISSDVALKGYSIFLAIIRAFNVRIEAARVMVLAPIFAFVATHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ DYG N KV   M + ++ +W VW GVSRHP+RWKLWVVV+GG +A ++E++DF
Sbjct  240  YLNFYELDYGWNMKVSVAMSVVQIVVWAVWGGVSRHPARWKLWVVVLGGGLAVLLEIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            APYW  VD+ A+ HA  IPLTYL+WSF RDDSEFRT+ L KK K
Sbjct  300  APYWELVDSRALGHAIMIPLTYLWWSFARDDSEFRTSILVKKTK  343



>emb|CDX94579.1| BnaC09g22570D [Brassica napus]
Length=174

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDVD+T+ LD+SSA+A+LGFS+I++IL+TF+VR EA RVMV++P++A VTTH+L
Sbjct  7    SAVFHTRDVDITKSLDYSSAIAVLGFSLIVSILKTFDVRVEAARVMVSAPVLALVTTHVL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+  YG N  VC  M +A+L +W  WA VSRHPS WKLWV VI   +A ++++++F
Sbjct  67   YINFYKLYYGWNMIVCVAMGVAQLFLWARWAAVSRHPSNWKLWVAVIASGLAMLLDIYNF  126

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
              Y GY +AH++WH   +PLT L+WSF+RDD+EF+T+SL KK+K
Sbjct  127  PLYGGYFEAHSIWHLATVPLTILWWSFIRDDAEFKTSSLLKKSK  170



>ref|XP_009590513.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=335

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSR V+ TE+LD+SSAVALLGFS+I+++LR F+++DEA RV+V++P++AF TTHIL
Sbjct  172  SVVFHSRGVEFTEKLDYSSAVALLGFSLIISVLRCFSIKDEATRVLVSAPLLAFTTTHIL  231

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYG N KVC  M +A+L IW +WAG+S HPS+WK+W VV+GG  A ++E++DF
Sbjct  232  YLNNYQMDYGWNIKVCVIMGVAQLLIWAIWAGISHHPSKWKIWTVVVGGGFAMLLEIYDF  291

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G +DAH++WHA  +PLTY++WSF++DD++++T + SKK +
Sbjct  292  PPYAGLIDAHSLWHAITVPLTYIWWSFIQDDAKYQTINPSKKVE  335



>ref|XP_011097638.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Sesamum indicum]
Length=342

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LT+ L+ SS VAL G+S+ILAI+R+FN++D+A RVMVA+P+IAF TTHIL
Sbjct  179  SAVFHSRDVNLTKNLECSSGVALFGYSLILAIIRSFNLKDDAARVMVAAPLIAFTTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN Y+ DYG N KVC  M++A+L  W +WAG+++HPSRWKLW+VV+GG +A  +++ DF
Sbjct  239  YLNNYKIDYGWNNKVCTIMIIAQLLTWSIWAGLTKHPSRWKLWIVVVGGGLALRLKILDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G VDAHA+WHA+ +PLTY++WSF++DD+ + T+   KK K
Sbjct  299  PPYQGLVDAHALWHASSVPLTYIWWSFIKDDANYITSINLKKVK  342



>ref|XP_011097637.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Sesamum indicum]
Length=353

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LT+ L+ SS VAL G+S+ILAI+R+FN++D+A RVMVA+P+IAF TTHIL
Sbjct  190  SAVFHSRDVNLTKNLECSSGVALFGYSLILAIIRSFNLKDDAARVMVAAPLIAFTTTHIL  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN Y+ DYG N KVC  M++A+L  W +WAG+++HPSRWKLW+VV+GG +A  +++ DF
Sbjct  250  YLNNYKIDYGWNNKVCTIMIIAQLLTWSIWAGLTKHPSRWKLWIVVVGGGLALRLKILDF  309

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G VDAHA+WHA+ +PLTY++WSF++DD+ + T+   KK K
Sbjct  310  PPYQGLVDAHALWHASSVPLTYIWWSFIKDDANYITSINLKKVK  353



>ref|XP_002872857.1| hypothetical protein ARALYDRAFT_490363 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49116.1| hypothetical protein ARALYDRAFT_490363 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -2

Query  700  SRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFY  521
            S DVDLTERLD+SSAVA+LGFS+ILAILRTF++R EA RVMV++PI+AFVTTHILY+NFY
Sbjct  152  SADVDLTERLDYSSAVAVLGFSLILAILRTFDIRVEATRVMVSAPILAFVTTHILYINFY  211

Query  520  QFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWG  341
            + DYG N  VC  M + +L +W  WA VS HPS WKLWVVVI G +A ++E++DF PY G
Sbjct  212  KLDYGWNMIVCMAMGVTQLFLWARWAAVSSHPSNWKLWVVVIAGGLAMLLEIYDFPPYEG  271

Query  340  YVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTS  242
            Y DAH++WHA  IPLT L+WSF+RDD+EFRT+S
Sbjct  272  YFDAHSIWHAATIPLTILWWSFIRDDAEFRTSS  304



>emb|CDY38313.1| BnaC05g30060D [Brassica napus]
Length=269

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 124/162 (77%), Gaps = 11/162 (7%)
 Frame = -2

Query  709  VFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYL  530
            VFH+RDVD+T+RLD+SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VT H+LY+
Sbjct  115  VFHTRDVDITKRLDYSSAIAVLGFSLIVSILRTFDVRVEAARVMVSAPLLALVTIHVLYI  174

Query  529  NFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAP  350
            NFY+ DYG N  VC  M +A+L +W  WA VS HPS WKLW           V ++DF P
Sbjct  175  NFYKLDYGWNMIVCVAMGVAQLFLWARWAAVSGHPSNWKLW-----------VVIYDFPP  223

Query  349  YWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            Y GY DAH++WH   +PLT L+WSF+RDD EFRT+SL KK+K
Sbjct  224  YGGYFDAHSIWHIATVPLTILWWSFIRDDDEFRTSSLLKKSK  265



>ref|XP_009788343.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Nicotiana sylvestris]
Length=390

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDV+LTE+LD+SSAVALLGFS+I++ILR F+++DEA RV++++P++AF TTHIL
Sbjct  172  SVVSHSRDVELTEKLDYSSAVALLGFSLIISILRCFSIKDEATRVLMSAPLLAFTTTHIL  231

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYG N KVC  M +A+L IW +WAG+S HPS+WK+W VV+GG    ++E++DF
Sbjct  232  YLNNYQMDYGWNIKVCVTMGVAQLLIWAIWAGISHHPSKWKIWTVVLGGGFGMLLEIYDF  291

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRT  248
             PY G +DAH++WHAT +PL Y++WSF++DD++++T
Sbjct  292  PPYAGIIDAHSLWHATTVPLAYIWWSFIQDDAKYQT  327



>ref|XP_004240259.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
lycopersicum]
Length=330

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSR +++TE+LD +SAVALLGFS+I++ILR+FNV +EA RV+ +SP+ AF  THIL
Sbjct  167  SVVFHSRGMEITEKLDCTSAVALLGFSLIISILRSFNVNNEAARVLASSPLFAFTITHIL  226

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ D+G N KVC  M +A+L IW +WAG+S+HPS+ K+W+VV G  VA  +E  DF
Sbjct  227  YLNNYQMDHGWNTKVCVTMGVAQLLIWAIWAGISQHPSKSKIWIVVFGSGVAMFLENCDF  286

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G +DAHA+WHAT IPLT ++WSF++DD++++T  L+KK K
Sbjct  287  PPYAGLIDAHALWHATTIPLTCIWWSFIQDDAKYQTFDLNKKQK  330



>gb|KFK27944.1| hypothetical protein AALP_AA8G451600 [Arabis alpina]
Length=343

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S+V HSRDV+LTERLD+SSA  L GFS+ILA++R+F++ D++ ++MV +PI+A V THIL
Sbjct  180  SSVCHSRDVELTERLDYSSATVLAGFSLILAMIRSFSIHDQSAKIMVTAPILAVVATHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV +G+   +L +WG WA ++ HPS+WKL       ++   + +FDF
Sbjct  240  YLNFYNLDEGLHRKVIYGIGAFELVVWGFWAALTSHPSKWKLRAFFASSLLTMCLRLFDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+W A  IPL+YL+WSFVRDD+ FRTT L KK+K
Sbjct  300  PPYKGYVDAHALWRAAGIPLSYLWWSFVRDDAVFRTTVLLKKSK  343



>ref|XP_001771346.1| predicted protein [Physcomitrella patens]
 gb|EDQ63906.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSRD+  TE LD+SSA+AL+G+S++LAI+RT N+R EA RVMVA+PIIAF+TTHIL
Sbjct  190  STVFHSRDMTFTEMLDYSSAIALIGYSLMLAIIRTGNLRSEAARVMVAAPIIAFITTHIL  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN Y+FDYGLN  VC  + +A+L IW  W  ++RHP+R+KL  VV G   A ++EVFDF
Sbjct  250  YLNLYKFDYGLNMIVCVVIGVAQLLIWSTWGFITRHPARFKLCTVVFGAAFAMLLEVFDF  309

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKK  230
             P WG  DAHA+WH   +P+TYL+WSF++DD+ +RT  L KK
Sbjct  310  PPLWGIFDAHAIWHGATLPITYLWWSFIKDDAIYRTEMLVKK  351



>ref|XP_006394431.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
 gb|ESQ31717.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
Length=276

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDV+LTERLD+SSA  L G+S+ILAI R+F++ D++ ++MV  PI+A V THIL
Sbjct  113  SGVCHSRDVELTERLDYSSATLLAGYSLILAIFRSFSIHDQSAKIMVTVPILAVVATHIL  172

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   ++ +WG+WA ++ HPS+WKL    +  +    + + DF
Sbjct  173  YLNFYNLDEGLHRKVIFGIGAVEIVVWGLWAALTSHPSKWKLRAFFVSSIFIMCIRMLDF  232

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+W A  IPL+YL+WSFVRDD+ FRTT   KK+K
Sbjct  233  PPYKGYVDAHALWRAAGIPLSYLWWSFVRDDAVFRTTVHLKKSK  276



>emb|CDX82919.1| BnaC01g13690D [Brassica napus]
Length=158

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 125/164 (76%), Gaps = 16/164 (10%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH RDVD+T+RLD+SSA+A+LGFS+I++IL+TF+VR EA RVMV++P++A VTTH+L
Sbjct  7    SAVFHIRDVDITKRLDYSSAIAVLGFSLIVSILKTFDVRVEAARVMVSAPVLALVTTHVL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+F YG N  VC  M +A+L +   WA VS HPS WKLWVVVI             
Sbjct  67   YINFYKFYYGWNMIVCVAMGVAQLFLCARWAAVSGHPSNWKLWVVVIVS-----------  115

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
                GY DAH++WHAT +PLT L+WSF+RDDSEFRT+SL KK+K
Sbjct  116  ----GYFDAHSIWHAT-VPLTILWWSFIRDDSEFRTSSLLKKSK  154



>emb|CDY00259.1| BnaA06g21600D [Brassica napus]
Length=345

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDV LTERLD+SSA  L GFS+ILAI+R+F++ D++ +VMV  PI+A V THIL
Sbjct  182  SGVCHSRDVALTERLDYSSATVLAGFSLILAIIRSFSIHDKSAKVMVTVPILAVVATHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   +L +WGVWA ++ HPS+WKL    +  ++   + + DF
Sbjct  242  YLNFYNLDEGLHRKVIFGIGAVELVVWGVWAALTSHPSKWKLRAFFVSSILTMCLRMLDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+W A  IPL+YL+WSF  DD+ FRTT L KK+K
Sbjct  302  PPYKGYVDAHALWRAAGIPLSYLWWSFACDDAVFRTTVLLKKSK  345



>ref|XP_006360399.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
tuberosum]
Length=330

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFHSR +++TE+LD +SAVALLGFS+I++ILR+FN+++EA RV+ ASP+ AF  THIL
Sbjct  167  SVVFHSRGMEITEKLDCTSAVALLGFSLIISILRSFNIKNEAARVLAASPLFAFTITHIL  226

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN YQ DYG N KVC  M +A+L IW +WAG+S+HP + K+W+VV G  VA  +E  DF
Sbjct  227  YLNNYQMDYGWNIKVCVTMGVAQLLIWAIWAGISQHPCKCKIWIVVFGSGVAMFLENSDF  286

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G +DAHA+ HA  IPLT ++W+F++DD++++T  L+KK K
Sbjct  287  PPYAGLIDAHALLHAITIPLTCIWWNFIQDDAKYQTFDLNKKEK  330



>emb|CDX86924.1| BnaC03g51940D [Brassica napus]
Length=313

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDV LTERLD+SSA  L GFS+ILAI+R+F++ D++ +VMV +PI+A V THIL
Sbjct  150  SGVCHSRDVALTERLDYSSATVLAGFSLILAIIRSFSIHDKSAKVMVTAPILAVVATHIL  209

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV  G+   +L +WGVWA ++ HPS+WKL    +  ++   + + DF
Sbjct  210  YLNFYNLDEGLHRKVIIGIGAVELVVWGVWAALTSHPSKWKLRAFFVSSILTMCLRMLDF  269

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+W A  IPL+YL+WSF  DD+ FRTT L KK+K
Sbjct  270  PPYKGYVDAHALWRAAGIPLSYLWWSFACDDAVFRTTVLLKKSK  313



>dbj|BAB10175.1| unnamed protein product [Arabidopsis thaliana]
Length=276

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++ HSRDV+LTERLD+SSA  L GFS+ILAILR+F+++D++ ++MV +PI+A V THIL
Sbjct  113  SSICHSRDVELTERLDYSSATVLAGFSLILAILRSFSIQDQSVKIMVTAPILAVVATHIL  172

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+ KV FG+   +L +WG+WA ++ HPS+WKL   +I  ++   + +FDF
Sbjct  173  YLNFYNLDEGLHWKVIFGIGGIELVVWGLWAALTSHPSKWKLRAFLISSILTLCLRMFDF  232

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAHA+W    IPL+YL+WSFV DD+ FRTT   KK+K
Sbjct  233  PPYKGYIDAHALWRGAGIPLSYLWWSFVCDDAVFRTTVNLKKSK  276



>ref|XP_006394432.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
 gb|ESQ31718.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
Length=343

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDV+LTERLD+SSA  L G+S+ILAI R+F++ D++ ++MV  PI+A V THIL
Sbjct  180  SGVCHSRDVELTERLDYSSATLLAGYSLILAIFRSFSIHDQSAKIMVTVPILAVVATHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   ++ +WG+WA ++ HPS+WKL    +  +    + + DF
Sbjct  240  YLNFYNLDEGLHRKVIFGIGAVEIVVWGLWAALTSHPSKWKLRAFFVSSIFIMCIRMLDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+W A  IPL+YL+WSFVRDD+ FRTT   KK+K
Sbjct  300  PPYKGYVDAHALWRAAGIPLSYLWWSFVRDDAVFRTTVHLKKSK  343



>ref|XP_009151332.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Brassica 
rapa]
Length=345

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDV LTERLD+SSA  L GFS+ILAI+R+F++ D++ +V+V  PI+A V THIL
Sbjct  182  SGVCHSRDVALTERLDYSSATVLAGFSLILAIIRSFSIHDKSAKVLVTVPILAVVATHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   +L +WGVWA ++ HPS+WKL    +  ++   + + DF
Sbjct  242  YLNFYNLDEGLHRKVIFGIGAVELVVWGVWAALTSHPSKWKLRAFFVSSILTMCLRMLDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+W A  IPL+YL+WSF  DD+ FRTT L KK+K
Sbjct  302  PPYKGYVDAHALWRAAGIPLSYLWWSFACDDAVFRTTVLLKKSK  345



>ref|XP_009130193.1| PREDICTED: post-GPI attachment to proteins factor 3 [Brassica 
rapa]
 emb|CDY30696.1| BnaA02g33180D [Brassica napus]
Length=345

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDVDLTERLD+SSA  L G++++LA++R+F++ D++ +VMV +P++A V THI+
Sbjct  182  SGVCHSRDVDLTERLDYSSATVLAGYTLVLAVIRSFSIHDQSAKVMVTAPVLALVATHII  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV +G+   +L +WG+W+ ++ HPS+WKL    +  ++ T + + DF
Sbjct  242  YLNFYNLDEGLHRKVIYGIGGVELVVWGLWSVLTSHPSKWKLRAFFVSCILTTCLRMLDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GYVDAHA+W A  IPL+YL+WSF+RDD+ FRTT L KK+K
Sbjct  302  PPYKGYVDAHALWRAAGIPLSYLWWSFIRDDAVFRTTVLLKKSK  345



>ref|NP_568951.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AAK95279.1|AF410293_1 AT5g62130/mtg10_150 [Arabidopsis thaliana]
 gb|AAM10355.1| AT5g62130/mtg10_150 [Arabidopsis thaliana]
 gb|AED97567.1| Per1-like family protein [Arabidopsis thaliana]
Length=343

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++ HSRDV+LTERLD+SSA  L GFS+ILAILR+F+++D++ ++MV +PI+A V THIL
Sbjct  180  SSICHSRDVELTERLDYSSATVLAGFSLILAILRSFSIQDQSVKIMVTAPILAVVATHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+ KV FG+   +L +WG+WA ++ HPS+WKL   +I  ++   + +FDF
Sbjct  240  YLNFYNLDEGLHWKVIFGIGGIELVVWGLWAALTSHPSKWKLRAFLISSILTLCLRMFDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAHA+W    IPL+YL+WSFV DD+ FRTT   KK+K
Sbjct  300  PPYKGYIDAHALWRGAGIPLSYLWWSFVCDDAVFRTTVNLKKSK  343



>ref|NP_001190592.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AED97568.1| Per1-like family protein [Arabidopsis thaliana]
Length=345

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++ HSRDV+LTERLD+SSA  L GFS+ILAILR+F+++D++ ++MV +PI+A V THIL
Sbjct  182  SSICHSRDVELTERLDYSSATVLAGFSLILAILRSFSIQDQSVKIMVTAPILAVVATHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+ KV FG+   +L +WG+WA ++ HPS+WKL   +I  ++   + +FDF
Sbjct  242  YLNFYNLDEGLHWKVIFGIGGIELVVWGLWAALTSHPSKWKLRAFLISSILTLCLRMFDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAHA+W    IPL+YL+WSFV DD+ FRTT   KK+K
Sbjct  302  PPYKGYIDAHALWRGAGIPLSYLWWSFVCDDAVFRTTVNLKKSK  345



>gb|EYU27545.1| hypothetical protein MIMGU_mgv1a009440mg [Erythranthe guttata]
 gb|EYU27546.1| hypothetical protein MIMGU_mgv1a009440mg [Erythranthe guttata]
Length=342

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV  S D+DLTE+LD+SSAVALLG+S+ILAI+R+ ++R +A +VMVA+P+IAF TTHIL
Sbjct  179  SAVSRSIDIDLTEKLDYSSAVALLGYSLILAIIRSLSLRQDAAKVMVAAPLIAFTTTHIL  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YL+ Y+ D+G N KV   M +A+L  W +WA  +RHPSRWKLW+V++GG ++ ++EV DF
Sbjct  239  YLHNYKMDHGWNMKVSIAMCIAQLLTWSIWAVTTRHPSRWKLWIVIVGGFLSMLLEVSDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G V A A+WHA+ IPLTY++WSF++DD+E RT+ L+KK +
Sbjct  299  PPYQGLVGARALWHASTIPLTYIWWSFIKDDAEHRTSILTKKVQ  342



>emb|CDY32129.1| BnaCnng06380D [Brassica napus]
Length=213

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 15/162 (9%)
 Frame = -2

Query  709  VFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYL  530
            VFH+RDVD+T+RLD+SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VTTH+LY+
Sbjct  63   VFHTRDVDITKRLDYSSAIAVLGFSLIVSILRTFDVRVEAARVMVSAPVLALVTTHVLYI  122

Query  529  NFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAP  350
            NFY+  YG N  VC  M +A+L +W  WA VSRHPS WK+WVVVI               
Sbjct  123  NFYKLYYGWNMIVCVAMGVAQLFLWARWAAVSRHPSNWKVWVVVIAS-------------  169

Query  349  YWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
              GY  AH++WH   +PLT L+WSF+RDD+EFRT+ L K +K
Sbjct  170  --GYFGAHSIWHLATVPLTILWWSFIRDDAEFRTSILFKNSK  209



>emb|CDY10592.1| BnaC03g70220D [Brassica napus]
Length=159

 Score =   180 bits (456),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 122/164 (74%), Gaps = 15/164 (9%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RDVD+T+RL +SSA+A+LGFS+I++I+RTF+VR EA RVMV++P++A VTTH+L
Sbjct  7    SAVFHTRDVDITKRLGYSSAIAVLGFSLIVSIIRTFDVRVEAARVMVSAPVLALVTTHVL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+  YG N  VC  M +A+L +W   A VSRHPS WKLWVVVI             
Sbjct  67   YINFYKLYYGWNMIVCVAMGVAQLFLWARCAAVSRHPSNWKLWVVVIAS-----------  115

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
                GY DAH++WH   +PLT L+ SF+RDD+EFRT+SL KK+K
Sbjct  116  ----GYFDAHSIWHFATVPLTILWRSFIRDDAEFRTSSLLKKSK  155



>ref|XP_010523608.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Tarenaya hassleriana]
Length=343

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV HSRDV+LTERLD+SSA ALLG S+I AI+R FN+RDE+ +VMVA+PIIA + TH+L
Sbjct  180  SAVCHSRDVELTERLDYSSAAALLGVSLIFAIIRVFNIRDESAKVMVAAPIIALMATHVL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YL+FY  D GL  K    +   + T+WG WA ++ HPSRWKLW+ ++  +V+   ++ DF
Sbjct  240  YLSFYNLDSGLQMKAVLTVGAVEFTVWGGWAAMTAHPSRWKLWIFLVLSIVSMFFKMCDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P +GYVDA  +W    IPL YL+WSF+RDD+ F T  L KK+K
Sbjct  300  PPLYGYVDAQFLWRIAAIPLAYLWWSFIRDDAVFCTAVLLKKSK  343



>ref|XP_010483931.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=344

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S + HSRDV+LTERLD+SSA  L  F++ILA LR+F++ D++ ++MV +PI+A   THIL
Sbjct  181  SGICHSRDVELTERLDYSSATVLAAFTLILATLRSFSIHDQSVKIMVTAPILAVAATHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   ++ +WG+WA ++ HPS+WKL   ++  ++     + DF
Sbjct  241  YLNFYNLDEGLHRKVIFGIGGIEIVVWGIWAALTSHPSKWKLRSFLVLSILTMCFRMLDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAHA+W A  IPL+YL+WSFV DD+ FRTT   KK+K
Sbjct  301  PPYKGYIDAHALWRAAGIPLSYLWWSFVCDDAVFRTTVHLKKSK  344



>ref|XP_006280748.1| hypothetical protein CARUB_v10026718mg [Capsella rubella]
 gb|EOA13646.1| hypothetical protein CARUB_v10026718mg [Capsella rubella]
Length=343

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S + HSRDV+LTERLD+SSA  L GF++ILA LR+F++ D++ ++MV +PI+A   THIL
Sbjct  180  SGICHSRDVELTERLDYSSATVLAGFTLILATLRSFSIHDQSVKIMVTAPILAVAATHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   ++ +WG+WA ++ HP++WKL   V+  ++ T + + DF
Sbjct  240  YLNFYNLDEGLHRKVIFGIGGIEMIVWGLWAALTSHPAKWKLRSFVVLSILTTCLRMLDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAHA+W A  IPL+Y++WSFV DD+ FRTT   KK+K
Sbjct  300  PPYKGYIDAHALWRAAGIPLSYIWWSFVCDDAVFRTTVHLKKSK  343



>ref|XP_010458286.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=344

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S + HSRDV+LTERLD+SSA  L  F++ILA LR+F++ D++ ++MV +PI+A   THIL
Sbjct  181  SGICHSRDVELTERLDYSSATVLAAFTLILATLRSFSIHDQSVKIMVTAPILAVAATHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   ++ +WG+WA ++ HPS+WKL   ++  ++   + + DF
Sbjct  241  YLNFYNLDEGLHRKVIFGIGGIEIVVWGIWAALTSHPSKWKLRSFLMLSILTMCLRMLDF  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAHA+W A  IPL+Y++WSFV DD+ FRTT   KK+K
Sbjct  301  PPYKGYIDAHALWRAAGIPLSYIWWSFVCDDAVFRTTVHLKKSK  344



>ref|XP_007149294.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
 gb|ESW21288.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
Length=346

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FHSR  +L E+LD+ SAVALLG+S+ILAILR+FNV+DEA RVM+ +P+I+FV THI+
Sbjct  180  SAIFHSRYCELIEKLDYFSAVALLGYSLILAILRSFNVKDEATRVMIPAPLISFVATHIM  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNF++ D+  N KVC  M + +L  W +W   S HPSRWK+  VV+   +A  ++++DF
Sbjct  240  YLNFFKLDHEWNLKVCLSMTVGQLATWAIWGDFSHHPSRWKIRFVVLISGLAMCLQIYDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G +DA A+ HA  +PLTYL+WSF+RDD+ F T+   K +K
Sbjct  300  PPYEGLLDAQALRHAITVPLTYLWWSFIRDDATFLTSERLKNSK  343



>ref|XP_004985958.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Setaria 
italica]
Length=348

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SSA A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHIL
Sbjct  185  SAIYHSCDTVWTEKLHFSSAAAFLGYSLILAILRTLNLRDEASRVMVAAPILAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQ D GLN KVC  + +A+  +W +WA ++RHPSR K+  V IGGVV+  +E +D 
Sbjct  245  YLNFYQLDKGLNMKVCTVISIAQFLLWALWAVMTRHPSRLKIIFVAIGGVVSVFLEAYDI  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGYVD  A+  A  IPL+YL+WSF ++D+E RT++++KK +
Sbjct  305  PPRWGYVDGRAICLAVAIPLSYLWWSFAKEDAEMRTSAITKKTR  348



>ref|XP_010523600.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Tarenaya hassleriana]
Length=418

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAV HSRDV+LTERLD+SSA ALLG S+I AI+R FN+RDE+ +VMVA+PIIA + TH+L
Sbjct  255  SAVCHSRDVELTERLDYSSAAALLGVSLIFAIIRVFNIRDESAKVMVAAPIIALMATHVL  314

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YL+FY  D GL  K    +   + T+WG WA ++ HPSRWKLW+ ++  +V+   ++ DF
Sbjct  315  YLSFYNLDSGLQMKAVLTVGAVEFTVWGGWAAMTAHPSRWKLWIFLVLSIVSMFFKMCDF  374

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P +GYVDA  +W    IPL YL+WSF+RDD+ F T  L KK+K
Sbjct  375  PPLYGYVDAQFLWRIAAIPLAYLWWSFIRDDAVFCTAVLLKKSK  418



>emb|CDY55489.1| BnaCnng29030D [Brassica napus]
Length=257

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 16/158 (10%)
 Frame = -2

Query  697  RDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFYQ  518
            +DVD+T+RLD+SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VTTH+LY+NFY+
Sbjct  112  KDVDITKRLDYSSAIAVLGFSLIVSILRTFDVRVEAARVMVSAPLLALVTTHVLYINFYK  171

Query  517  FDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGY  338
             DYG N  VC  M +A+L +W  WA VSRHPS WKLWVVVI                 GY
Sbjct  172  LDYGWNMIVCVAMGVAQLFLWARWA-VSRHPSNWKLWVVVIAS---------------GY  215

Query  337  VDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             D H++WH   +PLT L+WSF+RDD EFRT+SL KK+K
Sbjct  216  FDVHSIWHLATVPLTILWWSFIRDDDEFRTSSLLKKSK  253



>gb|EMT25149.1| hypothetical protein F775_19461 [Aegilops tauschii]
Length=352

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = -2

Query  712  AVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILY  533
            A++HS D   TE+L  SSA A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHILY
Sbjct  190  AIYHSCDTAWTEKLYLSSAAAFLGYSLILAILRTSNLRDEASRVMVAAPILAFVTTHILY  249

Query  532  LNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFA  353
            LNFY+ D GLN KVC  + +A+L +W VWA ++RHPSR K+  V IGGV++  +E  D  
Sbjct  250  LNFYELDKGLNMKVCTVISVAQLLLWTVWAAITRHPSRLKVIFVAIGGVLSLYLEAHDVP  309

Query  352  PYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            P WGYVD HA+  A  IPL+YL+WSF ++D+E RT ++ KK +
Sbjct  310  PRWGYVDGHAICLAMAIPLSYLWWSFAKEDAEMRTAAIMKKKR  352



>emb|CDY66169.1| BnaCnng49780D [Brassica napus]
Length=234

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 119/162 (73%), Gaps = 17/162 (10%)
 Frame = -2

Query  709  VFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYL  530
            VFH+RDVD T+RLD+SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VTTH+LY+
Sbjct  86   VFHTRDVDFTKRLDYSSAIAILGFSLIVSILRTFDVRVEAARVMVSTPVLALVTTHVLYI  145

Query  529  NFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAP  350
            NFY+ DYG N  VC  M +A+L +   WA  + HPS WKLWVVVI               
Sbjct  146  NFYKLDYGWNMIVCVAMGVAQLFLLARWA--AWHPSNWKLWVVVIAS-------------  190

Query  349  YWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
              GY DAH++WH   +PLT L+WSF+RDD+EFRT SL KK+K
Sbjct  191  --GYFDAHSIWHLATVPLTILWWSFIRDDAEFRTFSLFKKSK  230



>gb|ACF87974.1| unknown [Zea mays]
 tpg|DAA42958.1| TPA: hypothetical protein ZEAMMB73_509369 [Zea mays]
Length=291

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SS  A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHIL
Sbjct  128  SAIYHSCDTIWTEKLYFSSDAAFLGYSLILAILRTLNLRDEASRVMVAAPILAFVTTHIL  187

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  +++A+  +W +WA ++RHPSR K+  V IGG  A ++E  D 
Sbjct  188  YLNFYELDKGLNMKVCTVIIIAQCLLWALWAVMTRHPSRLKIIFVAIGGAAAVLLEASDI  247

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGYVD  A+  A  IPL+YL+WSF ++D+E RT+++ KKA+
Sbjct  248  PPRWGYVDGRAICLAVAIPLSYLWWSFAKEDAEMRTSAILKKAR  291



>ref|XP_002866473.1| hypothetical protein ARALYDRAFT_919464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42732.1| hypothetical protein ARALYDRAFT_919464 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S++ HSRDV+LT RLD+SSA  L GFS+ILAILR+F+++D++ ++MV +PI+A V THIL
Sbjct  180  SSICHSRDVELTVRLDYSSATVLAGFSLILAILRSFSIQDQSVKIMVTAPILAVVATHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+ KV FG+   +L +WG+WA ++ HPS+WKL    I  V+   + + DF
Sbjct  240  YLNFYNLDEGLHWKVMFGIGGIELVVWGLWAALTSHPSKWKLRAFFILSVLTLCLRMLDF  299

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
              Y GY+DAHA+W    IPL+YL+WSFV DD+ FRTT   KK+K
Sbjct  300  PSYKGYIDAHALWRGAGIPLSYLWWSFVCDDAVFRTTVNLKKSK  343



>ref|XP_010444070.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=345

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S + HSRDV+LTERLD+SSA  L  F++ILA LR+F++ D++ ++MV +PI+A   THIL
Sbjct  182  SGICHSRDVELTERLDYSSATVLAAFTLILATLRSFSIHDQSVKIMVTAPILAVAATHIL  241

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  D GL+RKV FG+   ++ +WG+WA ++ H S+WKL   ++  ++   + + DF
Sbjct  242  YLNFYNLDEGLHRKVIFGIGGIEIVVWGIWAALTSHRSKWKLRSFLLLSILTMCLRMLDF  301

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY+DAHA+W A  IPL+YL+WSFV DD+ FRTT   KK+K
Sbjct  302  PPYKGYIDAHALWRAAGIPLSYLWWSFVCDDAVFRTTVHLKKSK  345



>ref|XP_007211583.1| hypothetical protein PRUPE_ppa008593m1g, partial [Prunus persica]
 gb|EMJ12782.1| hypothetical protein PRUPE_ppa008593m1g, partial [Prunus persica]
Length=139

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -2

Query  613  TFNVRDEAPRVMVASPIIAFVTTHILYLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVS  434
            +F+V+D+A RVMVA+P++AFVTTHILYLNFY+ DYG N +VC  M + +L +W +WAGV+
Sbjct  1    SFDVKDDAVRVMVAAPLLAFVTTHILYLNFYKLDYGWNMQVCVVMAVVQLLVWAIWAGVT  60

Query  433  RHPSRWKLWvvviggvvatvveVFDFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            RHPSRWKLW+VV+ G +A ++E++DF PY G+VDAHA WHAT IPLTY++WSF+RDD+EF
Sbjct  61   RHPSRWKLWLVVVAGGLAMLLEIYDFPPYQGFVDAHAAWHATTIPLTYVWWSFIRDDAEF  120

Query  253  RTTSLSKKAK*DGSAK  206
             T++  K+ K    AK
Sbjct  121  LTSNQMKRMKTSNLAK  136



>ref|NP_001142245.1| hypothetical protein precursor [Zea mays]
 gb|ACF81634.1| unknown [Zea mays]
 tpg|DAA42959.1| TPA: hypothetical protein ZEAMMB73_509369 [Zea mays]
Length=349

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SS  A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHIL
Sbjct  186  SAIYHSCDTIWTEKLYFSSDAAFLGYSLILAILRTLNLRDEASRVMVAAPILAFVTTHIL  245

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  +++A+  +W +WA ++RHPSR K+  V IGG  A ++E  D 
Sbjct  246  YLNFYELDKGLNMKVCTVIIIAQCLLWALWAVMTRHPSRLKIIFVAIGGAAAVLLEASDI  305

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGYVD  A+  A  IPL+YL+WSF ++D+E RT+++ KKA+
Sbjct  306  PPRWGYVDGRAICLAVAIPLSYLWWSFAKEDAEMRTSAILKKAR  349



>ref|XP_003545917.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Glycine 
max]
Length=345

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S +FHSR  +L ERLD+ S VALLG+S I+AILR+FNV+DEA RVM+ +P+I+FV THI+
Sbjct  179  STIFHSRYCELIERLDNFSTVALLGYSFIMAILRSFNVKDEATRVMIPAPLISFVITHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN ++ DY  N KVC  M +A+L  W +W+GVS HPSRWKL  VV    +A  ++++DF
Sbjct  239  YLNSFKLDYEWNMKVCVLMTIAQLATWAIWSGVSHHPSRWKLRFVVFISGLAMSLKIYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKK  230
             PY G +DA A+ +A  IPLTYL+WSF+RDD+ F T++  K 
Sbjct  299  PPYKGLLDAQALRNAITIPLTYLWWSFIRDDAAFLTSNRLKN  340



>gb|EMS62696.1| hypothetical protein TRIUR3_14941 [Triticum urartu]
Length=348

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = -2

Query  712  AVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILY  533
            A++HS D   TE+L  SSA A  G+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHILY
Sbjct  186  AIYHSCDTAWTEKLYLSSAAAFFGYSLILAILRTSNLRDEASRVMVAAPILAFVTTHILY  245

Query  532  LNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFA  353
            LNFY+ D GLN KVC  + +A+L +W VWA ++RHPSR K+  V IGGV++  +E  D  
Sbjct  246  LNFYELDKGLNMKVCTVISVAQLLLWTVWAAITRHPSRLKVAFVAIGGVLSLYLEAHDVP  305

Query  352  PYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            P WGYVD HA+  A  IPL+YL+WSF ++D+E RT ++ KK +
Sbjct  306  PRWGYVDGHAICLAMAIPLSYLWWSFAKEDAEMRTAAIMKKKR  348



>ref|XP_002465979.1| hypothetical protein SORBIDRAFT_01g049340 [Sorghum bicolor]
 gb|EER92977.1| hypothetical protein SORBIDRAFT_01g049340 [Sorghum bicolor]
Length=349

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SSA A LG+S+IL ILRT N+RDEA RVMVA+PI+AFVTTHIL
Sbjct  186  SAIYHSCDTTWTEKLYFSSAAAFLGYSLILTILRTLNLRDEASRVMVAAPILAFVTTHIL  245

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  + +A+  +W +WA ++RHPSR K+  V IGG VA ++E +D 
Sbjct  246  YLNFYELDKGLNMKVCTVISIAQCLLWALWAVMTRHPSRLKIIFVSIGGAVAVLLEAYDI  305

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGYVD  A+  A  IPL+YL+WSF ++D+E RT+++ KK +
Sbjct  306  PPRWGYVDGRAICLAVAIPLSYLWWSFAKEDAEMRTSAILKKTR  349



>ref|XP_010229303.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Brachypodium distachyon]
Length=319

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D + TE+L  SS+ A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHIL
Sbjct  156  SAIYHSCDTEWTEKLYFSSSAAFLGYSLILAILRTANLRDEASRVMVAAPILAFVTTHIL  215

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  + GLN KVC  + +A+L +W +W+ ++RH SR K+  V IGGV++  +E +D 
Sbjct  216  YLNFYDLNKGLNTKVCTVISIAQLLLWALWSAITRHTSRLKIMFVAIGGVLSVFLEAYDV  275

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGYVD HA   A  IPL+Y++WSF ++D+E RT ++ KK +
Sbjct  276  PPRWGYVDGHATCLAMAIPLSYIWWSFAKEDAEMRTAAIMKKKR  319



>gb|KHN27719.1| Post-GPI attachment to proteins factor 3 [Glycine soja]
Length=345

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S +FHSR  +L ERLD+ S VALLG+S I+AILR+FNV+DEA RVM+ +P+I+FV THI+
Sbjct  179  STIFHSRYCELIERLDNFSTVALLGYSFIMAILRSFNVKDEATRVMIPAPLISFVITHIM  238

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLN ++ D+  N KVC  M +A+L  W +W+GVS HPSRWKL  VV    +A  ++ +DF
Sbjct  239  YLNSFKLDHEWNMKVCVLMTIAQLATWAIWSGVSHHPSRWKLRFVVFISGLAMSLKTYDF  298

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKK  230
             PY G +DA A+ +A  IPLTYL+WSF+RDD+ F T++  K 
Sbjct  299  PPYKGLLDAQALRNAITIPLTYLWWSFIRDDAAFLTSNRLKN  340



>emb|CDY51101.1| BnaCnng20040D [Brassica napus]
Length=183

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 15/156 (10%)
 Frame = -2

Query  697  RDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFYQ  518
             DVD+T+RLD+S A+A+LGF +I++ILRTF+VR EA RVMV++P++A VT H+LY+NFY+
Sbjct  37   EDVDITKRLDYSYAIAVLGFPLIVSILRTFDVRVEAARVMVSAPVLALVTIHVLYINFYK  96

Query  517  FDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGY  338
             DYG N  VC    +A+L +W  WA VSRHPS WKLWVVVI                 GY
Sbjct  97   LDYGWNMIVCVAKRVAQLFLWARWAAVSRHPSNWKLWVVVIAS---------------GY  141

Query  337  VDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKK  230
             DAH++WH   +P T L+WSF+RDD+EFRT+SL KK
Sbjct  142  FDAHSIWHLATVPPTILWWSFIRDDAEFRTSSLLKK  177



>ref|XP_003558964.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Brachypodium distachyon]
Length=348

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D + TE+L  SS+ A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHIL
Sbjct  185  SAIYHSCDTEWTEKLYFSSSAAFLGYSLILAILRTANLRDEASRVMVAAPILAFVTTHIL  244

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY  + GLN KVC  + +A+L +W +W+ ++RH SR K+  V IGGV++  +E +D 
Sbjct  245  YLNFYDLNKGLNTKVCTVISIAQLLLWALWSAITRHTSRLKIMFVAIGGVLSVFLEAYDV  304

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGYVD HA   A  IPL+Y++WSF ++D+E RT ++ KK +
Sbjct  305  PPRWGYVDGHATCLAMAIPLSYIWWSFAKEDAEMRTAAIMKKKR  348



>ref|XP_002964918.1| hypothetical protein SELMODRAFT_167352 [Selaginella moellendorffii]
 gb|EFJ33756.1| hypothetical protein SELMODRAFT_167352 [Selaginella moellendorffii]
Length=345

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  + E  D+SSAVA LGFS+ILAI RT +++ EA RVMV++P I F+ THI 
Sbjct  176  SVVFHTRDTPVHESWDYSSAVATLGFSLILAITRTLSIKTEAARVMVSAPCIGFIATHIC  235

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FDYG N  VC  M +++L  W VWA VS+HPSR K+W V +G + A ++E++DF
Sbjct  236  YLNFYEFDYGWNMIVCVVMGLSQLLFWLVWAIVSKHPSRLKVWTVGLGTLGAMLLELYDF  295

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P  G  DAH++WH   IPLT+L+WSFV+DD+  RT+ L K+ +
Sbjct  296  PPLGGQFDAHSLWHLGTIPLTFLWWSFVKDDAVARTSRLVKRNQ  339



>ref|XP_008668589.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=545

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SS  A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHIL
Sbjct  382  SAIYHSCDTIWTEKLYFSSDAAFLGYSLILAILRTLNLRDEASRVMVAAPILAFVTTHIL  441

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  +++A+  +W +WA ++RHPSR K+  V IGG  A ++E  D 
Sbjct  442  YLNFYELDKGLNMKVCTVIIIAQCLLWALWAVMTRHPSRLKIIFVAIGGAAAVLLEASDI  501

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGYVD  A+  A  IPL+YL+WSF ++D+E RT+++ KKA+
Sbjct  502  PPRWGYVDGRAICLAVAIPLSYLWWSFAKEDAEMRTSAILKKAR  545



>ref|XP_002986499.1| hypothetical protein SELMODRAFT_124213 [Selaginella moellendorffii]
 gb|EFJ12356.1| hypothetical protein SELMODRAFT_124213 [Selaginella moellendorffii]
Length=345

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  + E  D+SSAVA LGFS+ILAI RT +++ EA RVMV++P I F+ THI 
Sbjct  176  SVVFHTRDTPVHESWDYSSAVATLGFSLILAITRTLSIKTEAARVMVSAPCIGFIATHIC  235

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FDYG N  VC  M +++L  W VWA VS+HPSR K+W V +G + A ++E++DF
Sbjct  236  YLNFYEFDYGWNMIVCVVMGLSQLLFWLVWAIVSKHPSRLKVWTVGLGTLGAMLLELYDF  295

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P  G  DAH++WH   IPLT+L+WSFV+DD+  RT+ L K+ +
Sbjct  296  PPLGGQFDAHSLWHLGTIPLTFLWWSFVKDDAVARTSRLVKRNQ  339



>emb|CDY27430.1| BnaC03g64700D [Brassica napus]
Length=148

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 115/164 (70%), Gaps = 26/164 (16%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RDVD+T+RLD+SSA+A+LGFS+I++ILRTF+VR +A RVM ++P++A VTTH L
Sbjct  7    SGVFHTRDVDITKRLDYSSAIAVLGFSLIVSILRTFDVRVDAARVMASAPVLALVTTHAL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+  Y           +A+L +W  WA VSRHPS WKL VVVI             
Sbjct  67   YINFYKLYY-----------VAQLFLWARWAAVSRHPSNWKLLVVVIAS-----------  104

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
                GY DAH++WH   +PLT L+WSF RDD+EFRT+SL KK+K
Sbjct  105  ----GYFDAHSIWHLATVPLTILWWSFTRDDAEFRTSSLLKKSK  144



>gb|AFW89791.1| hypothetical protein ZEAMMB73_859279 [Zea mays]
Length=291

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SSA A LG+S+ILAILRT ++RDEA RVMVA+PI+AFVTTHIL
Sbjct  128  SAIYHSCDTIWTEKLYFSSAAAFLGYSLILAILRTSSLRDEASRVMVAAPILAFVTTHIL  187

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  + +A+  +W +WA +S H SR K+  V +GG VA +VE +D 
Sbjct  188  YLNFYELDKGLNMKVCTVISIAQCLLWALWAVMSGHRSRLKIISVAVGGAVAVLVEAYDI  247

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGY D  A+  A  IPL+YL+WSF ++D+E RT+++ KK +
Sbjct  248  PPRWGYADGRAICLAVAIPLSYLWWSFAKEDAEMRTSAILKKTR  291



>ref|NP_001141237.1| hypothetical protein precursor [Zea mays]
 gb|ACF85808.1| unknown [Zea mays]
 gb|AFW89790.1| hypothetical protein ZEAMMB73_859279 [Zea mays]
Length=349

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SSA A LG+S+ILAILRT ++RDEA RVMVA+PI+AFVTTHIL
Sbjct  186  SAIYHSCDTIWTEKLYFSSAAAFLGYSLILAILRTSSLRDEASRVMVAAPILAFVTTHIL  245

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  + +A+  +W +WA +S H SR K+  V +GG VA +VE +D 
Sbjct  246  YLNFYELDKGLNMKVCTVISIAQCLLWALWAVMSGHRSRLKIISVAVGGAVAVLVEAYDI  305

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGY D  A+  A  IPL+YL+WSF ++D+E RT+++ KK +
Sbjct  306  PPRWGYADGRAICLAVAIPLSYLWWSFAKEDAEMRTSAILKKTR  349



>gb|AFW89789.1| hypothetical protein ZEAMMB73_859279 [Zea mays]
Length=357

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SSA A LG+S+ILAILRT ++RDEA RVMVA+PI+AFVTTHIL
Sbjct  194  SAIYHSCDTIWTEKLYFSSAAAFLGYSLILAILRTSSLRDEASRVMVAAPILAFVTTHIL  253

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+ D GLN KVC  + +A+  +W +WA +S H SR K+  V +GG VA +VE +D 
Sbjct  254  YLNFYELDKGLNMKVCTVISIAQCLLWALWAVMSGHRSRLKIISVAVGGAVAVLVEAYDI  313

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             P WGY D  A+  A  IPL+YL+WSF ++D+E RT+++ KK +
Sbjct  314  PPRWGYADGRAICLAVAIPLSYLWWSFAKEDAEMRTSAILKKTR  357



>ref|XP_010919212.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Elaeis guineensis]
Length=344

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 126/164 (77%), Gaps = 5/164 (3%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +A+FH  + D+TE+L+ SSAVALLG+S+ILAILRTFNV+ EA RV  A+P++AFVTTHIL
Sbjct  186  NAIFHIWNSDVTEKLNQSSAVALLGYSLILAILRTFNVKGEAQRVTAAAPLLAFVTTHIL  245

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FD+GLN KVC  M +A+  +W VWA V+R PS +KLW V++GG++  ++E F  
Sbjct  246  YLNFYKFDHGLNMKVCIIMDIAQAILWVVWAAVTRPPSWFKLWTVMLGGILVMLLEEFPS  305

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            +   GYVD     HA  IPL YL+W+FV+ D+E RT++++KK +
Sbjct  306  SK--GYVDLR---HAAAIPLAYLWWNFVKKDAETRTSAITKKRR  344



>ref|XP_010919213.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Elaeis guineensis]
Length=339

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 126/164 (77%), Gaps = 5/164 (3%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +A+FH  + D+TE+L+ SSAVALLG+S+ILAILRTFNV+ EA RV  A+P++AFVTTHIL
Sbjct  181  NAIFHIWNSDVTEKLNQSSAVALLGYSLILAILRTFNVKGEAQRVTAAAPLLAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFY+FD+GLN KVC  M +A+  +W VWA V+R PS +KLW V++GG++  ++E F  
Sbjct  241  YLNFYKFDHGLNMKVCIIMDIAQAILWVVWAAVTRPPSWFKLWTVMLGGILVMLLEEFPS  300

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            +   GYVD     HA  IPL YL+W+FV+ D+E RT++++KK +
Sbjct  301  SK--GYVDLR---HAAAIPLAYLWWNFVKKDAETRTSAITKKRR  339



>gb|KCW90759.1| hypothetical protein EUGRSUZ_A02835 [Eucalyptus grandis]
Length=303

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 109/164 (66%), Gaps = 40/164 (24%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD+SSAVALLGFS+I+A+LR  N+RDEA RVM ++P+IAFVTTHIL
Sbjct  180  SAVFHSRDVELTEKLDYSSAVALLGFSLIVALLRALNIRDEASRVMFSAPVIAFVTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNFYQFDYGL       M++                                   ++DF
Sbjct  240  YLNFYQFDYGL------AMLLE----------------------------------IYDF  259

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G+VDAHA+WH T IP +YL+WSF+RDD+E RT +L KK K
Sbjct  260  PPYMGFVDAHALWHTTAIPFSYLWWSFIRDDAELRTRTLLKKVK  303



>ref|XP_006661973.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Oryza 
brachyantha]
Length=349

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 120/163 (74%), Gaps = 0/163 (0%)
 Frame = -2

Query  712  AVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILY  533
            A++HS D   TE+L +SS  A +G+S+ILAILRT N++DEA RVMVA+PI+AF TTHILY
Sbjct  187  AIYHSCDTSWTEKLYYSSFAAFIGYSLILAILRTLNLKDEASRVMVAAPILAFTTTHILY  246

Query  532  LNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFA  353
            LNFY+ D  LN KVC    + +  +W +WA +++HPS +K+ +V+IG + + V+E +D  
Sbjct  247  LNFYELDKDLNTKVCTAASLVQFLLWAIWAVMTKHPSCFKILIVIIGSLSSIVLETYDIP  306

Query  352  PYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            P WGYVD  A+  A  IPLTYL+W+F ++D+E RTT++ KK +
Sbjct  307  PRWGYVDGRALCVAVSIPLTYLWWTFAKEDAEMRTTAIIKKTR  349



>emb|CDX73479.1| BnaC08g25240D [Brassica napus]
Length=138

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 111/164 (68%), Gaps = 36/164 (22%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RD+D+T+RLD SSA+A+LGFS I++ILRTF+VR EA RVMV++P++A VTTHIL
Sbjct  7    SAVFHTRDIDITKRLDFSSAIAVLGFSFIVSILRTFDVRVEAARVMVSAPVLALVTTHIL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DY                     A + RHPS WKLWVVVI             
Sbjct  67   YINFYKLDY---------------------AAIFRHPSNWKLWVVVIAS-----------  94

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
                GY DAH++WH   +PLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  95   ----GYFDAHSIWHLATVPLTILWWSFIRDDAEFRTSSLLKKSK  134



>gb|AFK33317.1| unknown [Medicago truncatula]
Length=119

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -2

Query  580  MVASPIIAFVTTHILYLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvv  401
            MV++P+IAFV TH++YLNFY+ DYG N  VC  M +A+LTIW VW GVSRHPSRWKLW+V
Sbjct  1    MVSAPLIAFVITHVMYLNFYKLDYGWNMIVCVVMAVAQLTIWAVWVGVSRHPSRWKLWLV  60

Query  400  viggvvatvveVFDFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            VI G +A ++E++DF PY G++DAHA+WHAT IPLTY++WSF+RDD+EFRT    KKAK
Sbjct  61   VISGGLAMLLEIYDFPPYEGFLDAHAIWHATTIPLTYVWWSFIRDDAEFRTARFLKKAK  119



>emb|CDX85322.1| BnaC07g26330D [Brassica napus]
Length=204

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -2

Query  709  VFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYL  530
            VFH+RDV++T+ LD+SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VTTH+LY+
Sbjct  63   VFHTRDVNITKMLDYSSAIAVLGFSLIVSILRTFDVRVEAARVMVSAPVLALVTTHVLYI  122

Query  529  NFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAP  350
            NFY+ DYG N  VC  M + +L +W  WA VSRHPS WKLWVVVI   +A ++E++DF P
Sbjct  123  NFYKLDYGWNMIVCVAMGVTQLFLWARWAAVSRHPSNWKLWVVVIASDLAMLLEIYDFPP  182

Query  349  YWGYVDAHAVWH  314
            Y GY DAH+ WH
Sbjct  183  YGGYFDAHSNWH  194



>ref|NP_001065105.1| Os10g0524100 [Oryza sativa Japonica Group]
 gb|AAO00714.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAP54701.1| Per1-like family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF27019.1| Os10g0524100 [Oryza sativa Japonica Group]
 gb|EAZ16735.1| hypothetical protein OsJ_32212 [Oryza sativa Japonica Group]
 dbj|BAG93522.1| unnamed protein product [Oryza sativa Japonica Group]
Length=347

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = -2

Query  712  AVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILY  533
            A++HS D   TE+L +SS  A +G+S+ILAILRT N++DEA RVMVA+PI+AF TTHILY
Sbjct  185  AIYHSCDTVWTEKLYYSSFAAFIGYSLILAILRTLNLKDEASRVMVAAPILAFTTTHILY  244

Query  532  LNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFA  353
            LNFY+ D GLN KVC    +A+  +W VWA +++HPS +K+  V+IG V + V+E +D  
Sbjct  245  LNFYELDKGLNTKVCTAASLAQFLLWAVWAVMTKHPSCFKILFVIIGNVFSIVLETYDIP  304

Query  352  PYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            P WGYVD      A  IPLTYL+W F ++D+E RT+++ KK +
Sbjct  305  PRWGYVDGRVFCVAISIPLTYLWWKFAKEDAEMRTSTIIKKTR  347



>gb|EAY79263.1| hypothetical protein OsI_34379 [Oryza sativa Indica Group]
Length=347

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = -2

Query  712  AVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILY  533
            A++HS D   TE+L +SS  A +G+S+ILAILRT N++DEA RVMVA+PI+AF TTHILY
Sbjct  185  AIYHSCDTVWTEKLYYSSFAAFIGYSLILAILRTLNLKDEASRVMVAAPILAFTTTHILY  244

Query  532  LNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFA  353
            LNFY+ D GLN KVC    +A+  +W VWA +++HPS +K+  V+IG V + V+E +D  
Sbjct  245  LNFYELDKGLNTKVCTAASLAQFLLWAVWAVMTKHPSCFKILFVIIGNVFSIVLETYDIP  304

Query  352  PYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            P WGYVD      A  IPLTYL+W F ++D+E RT+++ KK +
Sbjct  305  PRWGYVDGRVFCVAISIPLTYLWWKFAKEDAEMRTSAIIKKTR  347



>ref|XP_007149295.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
 gb|ESW21289.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
Length=334

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FHSR  +L E+LD+ SAVALLG+S+ILAILR+FNV+DEA RVM+ +P+I+FV THI+
Sbjct  180  SAIFHSRYCELIEKLDYFSAVALLGYSLILAILRSFNVKDEATRVMIPAPLISFVATHIM  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            YLNF++ D+G            +L  W +W   S HPSRWK+  VV+   +A  ++++DF
Sbjct  240  YLNFFKLDHG------------QLATWAIWGDFSHHPSRWKIRFVVLISGLAMCLQIYDF  287

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY G +DA A+ HA  +PLTYL+WSF+RDD+ F T+   K +K
Sbjct  288  PPYEGLLDAQALRHAITVPLTYLWWSFIRDDATFLTSERLKNSK  331



>ref|XP_007022228.1| Per1-like family protein isoform 7 [Theobroma cacao]
 gb|EOY13753.1| Per1-like family protein isoform 7 [Theobroma cacao]
Length=327

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLG+S++L ILR+FNVRDEA RVMVA+P++AF TTHIL
Sbjct  180  SAVFHSRDVDLTEKLDYSSAVALLGYSLLLTILRSFNVRDEAARVMVAAPLLAFTTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLW  407
            +LNFY  DYG N KVC  M +A+L IW +WAG + HPSRWKLW
Sbjct  240  FLNFYSLDYGWNMKVCVVMGVAQLLIWAIWAGRTHHPSRWKLW  282



>ref|XP_007022226.1| Per1-like family protein isoform 5 [Theobroma cacao]
 gb|EOY13751.1| Per1-like family protein isoform 5 [Theobroma cacao]
Length=362

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVALLG+S++L ILR+FNVRDEA RVMVA+P++AF TTHIL
Sbjct  180  SAVFHSRDVDLTEKLDYSSAVALLGYSLLLTILRSFNVRDEAARVMVAAPLLAFTTTHIL  239

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLW  407
            +LNFY  DYG N KVC  M +A+L IW +WAG + HPSRWKLW
Sbjct  240  FLNFYSLDYGWNMKVCVVMGVAQLLIWAIWAGRTHHPSRWKLW  282



>emb|CDY50719.1| BnaCnng19530D [Brassica napus]
Length=138

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 109/164 (66%), Gaps = 38/164 (23%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RD+D+T+RLD SSA+A+LGFS+I++ILRTF++R EA RVMV++P+ A VTTHIL
Sbjct  9    SAVFHTRDIDITKRLDFSSAIAVLGFSLIVSILRTFDIRVEAARVMVSAPVPALVTTHIL  68

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DY        G+ M                                ++E++DF
Sbjct  69   YINFYKLDYAS------GLAM--------------------------------LLEIYDF  90

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             PY GY DAH++WH   +PLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  91   PPYEGYFDAHSIWHLATVPLTILWWSFIRDDAEFRTSSLLKKSK  134



>gb|EAY79260.1| hypothetical protein OsI_34376 [Oryza sativa Indica Group]
Length=320

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = -2

Query  694  DVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFYQF  515
            D   TE+L +SS  A +G+S+ILAILRT N++DEA RVMVA+PI+AF TTHILYLNFY+ 
Sbjct  164  DTVWTEKLYYSSFAAFIGYSLILAILRTLNLKDEASRVMVAAPILAFTTTHILYLNFYEL  223

Query  514  DYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGYV  335
            D GLN KVC    +A+  +W VWA +++HPS +K+  V+IG V + ++E +D  P WG V
Sbjct  224  DKGLNTKVCTAASLAQFLLWAVWAVMTKHPSCFKILFVIIGSVFSIILETYDIPPRWGCV  283

Query  334  DAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            D      A  IPLTYL+W F ++D+E RT+++ KK +
Sbjct  284  DGRVFCVAISIPLTYLWWKFAKEDAEMRTSAIIKKTR  320



>emb|CDY22428.1| BnaC03g61410D [Brassica napus]
Length=261

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 117/157 (75%), Gaps = 8/157 (5%)
 Frame = -2

Query  694  DVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFYQF  515
            DVD+T+ LD+SSA+A+LGFS+I++ILRTF+VR EA RVMV+ P++AFVT+HI+ + F  +
Sbjct  112  DVDITKTLDYSSAIAILGFSLIVSILRTFDVRVEAARVMVSPPVLAFVTSHIISM-FTCW  170

Query  514  DYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGYV  335
                N  VC  + +A++ +W  WA VSRHPS WKLWVVVI   +A V+E++DF      +
Sbjct  171  ----NMIVCVAVGVAQIFLWARWAAVSRHPSNWKLWVVVIASCLAMVLEIYDFP---LRM  223

Query  334  DAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             AH++WH   +PLT L+WSF+RD+ EFRT+SL KK K
Sbjct  224  KAHSIWHLATVPLTVLWWSFIRDNVEFRTSSLLKKFK  260



>emb|CDY34434.1| BnaC01g21990D [Brassica napus]
Length=213

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 97/152 (64%), Gaps = 38/152 (25%)
 Frame = -2

Query  706  FHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLN  527
            FH+RDVD+T+RLD+SS +A+LGFS+I+ ILRTF+VR EA RVMV++P++A VTTH+LY+N
Sbjct  87   FHTRDVDITKRLDYSSGIAVLGFSLIVYILRTFDVRVEATRVMVSAPVLALVTTHVLYIN  146

Query  526  FYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPY  347
            FY+  Y        G+ M                                ++E++DF PY
Sbjct  147  FYKLYYA------SGLAM--------------------------------LLEIYDFPPY  168

Query  346  WGYVDAHAVWHATCIPLTYLFWSFVRDDSEFR  251
             GY DAH++WH   +PLT L+WSF+RDD+EFR
Sbjct  169  GGYFDAHSIWHLATVPLTILWWSFIRDDAEFR  200



>emb|CDY63979.1| BnaCnng42900D [Brassica napus]
Length=121

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 94/164 (57%), Gaps = 53/164 (32%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RD+D+T+RLD SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VTTH+L
Sbjct  7    SAVFHTRDIDITKRLDFSSAIAVLGFSLIVSILRTFDVRVEAARVMVSAPVLALVTTHVL  66

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DY                     +G     S W L                  
Sbjct  67   YINFYKLDYA--------------------SGYVDAHSIWHL------------------  88

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
                             +PLT L+WSF+RDD+EFRT+SL KK+K
Sbjct  89   ---------------ATVPLTILWWSFIRDDAEFRTSSLLKKSK  117



>emb|CDY43293.1| BnaC06g01750D [Brassica napus]
Length=196

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 94/164 (57%), Gaps = 53/164 (32%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            +A+FH+RDVD+T+RLD+SSA+A+LGFS+I++ILRTF+VR EA RVMV++P++A VTTH+L
Sbjct  82   NAIFHTRDVDITKRLDYSSAIAVLGFSLIVSILRTFDVRVEAARVMVSAPVLALVTTHVL  141

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
            Y+NFY+ DY                                                FD 
Sbjct  142  YINFYKLDYA--------------------------------------------SGYFDA  157

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
               W         H   +PLT L+W+F+RDD+EFRT+SL KK+K
Sbjct  158  HSIW---------HLATVPLTILWWNFIRDDAEFRTSSLLKKSK  192



>ref|XP_006422203.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|ESR35443.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|KDO46710.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
 gb|KDO46711.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=260

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+ D+SSAVALLGFS+ILAILR+FNVRDEA RVMVA+P++AFVTTHIL
Sbjct  181  SAVFHSRDVDLTEKFDYSSAVALLGFSLILAILRSFNVRDEAARVMVAAPLLAFVTTHIL  240

Query  535  YLNFYQFDYGLNRKVCF  485
            YLNFY+ DYG+ R +C 
Sbjct  241  YLNFYKLDYGI-RPLCL  256



>ref|XP_007213774.1| hypothetical protein PRUPE_ppa024516m1g, partial [Prunus persica]
 gb|EMJ14973.1| hypothetical protein PRUPE_ppa024516m1g, partial [Prunus persica]
Length=118

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -2

Query  502  NRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGYVDAHA  323
            N +VC  M + +L +W +WAGV+RHPSRWKLW+VV+ G +A ++E++DF PY G+VDAHA
Sbjct  17   NMQVCVVMAVVQLLVWAIWAGVTRHPSRWKLWLVVVAGGLAMLLEIYDFPPYQGFVDAHA  76

Query  322  VWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK*DGSAK  206
             WHAT IPLTY++WSF+RDD+EF T++  K+ K    AK
Sbjct  77   AWHATTIPLTYVWWSFIRDDAEFLTSNQMKRMKTSNLAK  115



>gb|KEH26892.1| post-GPI attachment-like factor-protein [Medicago truncatula]
Length=125

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  481  MVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGYVDAHAVWHATCI  302
            M +A+LTIW VWAGVSRHPSRWKLW+VVI G +A ++E++DF PY G++DAHA+WHAT I
Sbjct  1    MAVAQLTIWAVWAGVSRHPSRWKLWLVVISGGLAMLLEIYDFPPYEGFLDAHAIWHATTI  60

Query  301  PLTYLFWSFVRDDSEFRTTSLSKKAK  224
            PLTY++WSF+RDD+EFRT    KKA 
Sbjct  61   PLTYVWWSFIRDDAEFRTARFLKKAN  86



>gb|KJB52865.1| hypothetical protein B456_008G280700 [Gossypium raimondii]
Length=284

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA+FHSRDV+LTE+LD+SSAVAL+G+S+ILAILR F++RDEA RVMVA+P++AFVTTHIL
Sbjct  182  SAIFHSRDVELTEKLDYSSAVALVGYSLILAILRVFDLRDEASRVMVAAPLVAFVTTHIL  241

Query  535  YLNFYQFDYGLN  500
            YLNFY+ DYG++
Sbjct  242  YLNFYKLDYGIS  253



>gb|AFK49320.1| unknown [Lotus japonicus]
Length=92

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  493  VCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDFAPYWGYVDAHAVWH  314
            VC  M + +L IW VWAG+S HPSRWKLW+VVI G +A ++E++DF PY G +DAHA+WH
Sbjct  3    VCVVMAVVQLVIWAVWAGLSGHPSRWKLWLVVIDGGLAMLLEIYDFPPYEGLLDAHALWH  62

Query  313  ATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
            AT IPLTY++WSF+RDD+EFRT+   KKAK
Sbjct  63   ATTIPLTYIWWSFIRDDAEFRTSIRVKKAK  92



>gb|AES76445.2| post-GPI attachment-like factor-protein [Medicago truncatula]
Length=255

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVD+TE+LD+SSAV LLG+S+ILAILR+FN+RDEA RVMV++P+IAFV TH++
Sbjct  179  SAVFHSRDVDVTEKLDYSSAVILLGYSLILAILRSFNIRDEATRVMVSAPLIAFVITHVM  238

Query  535  YLNFYQFDYG  506
            YLNFY+ DYG
Sbjct  239  YLNFYKLDYG  248



>ref|XP_006421843.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|ESR35083.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|KDO60110.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=260

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDV+LTE+LD SSAVALLGF+ ILAILR F+VRDEA RVMVA+P+IAFVTTHIL
Sbjct  179  SAVFHSRDVELTEKLDCSSAVALLGFNFILAILRAFSVRDEAARVMVAAPLIAFVTTHIL  238

Query  535  YLNFYQFDYG  506
            YLNFY+ D+G
Sbjct  239  YLNFYKLDHG  248



>ref|XP_004171395.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cucumis 
sativus]
Length=267

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+LD+SSAVA+LGFS+ILAILR+FNVR EA RVMVA+P++AF  THIL
Sbjct  179  SAVFHSRDVDLTEKLDYSSAVAVLGFSLILAILRSFNVRHEATRVMVAAPLLAFALTHIL  238

Query  535  YLNFYQFDYG  506
            Y+NFY+ DYG
Sbjct  239  YINFYELDYG  248



>emb|CDY26180.1| BnaA06g12370D [Brassica napus]
Length=145

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 74/97 (76%), Gaps = 5/97 (5%)
 Frame = -2

Query  697  RDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFYQ  518
            +DVD+T+ LD+SSA+A+LGFS+I++ILRTF+VR EA RVMV+ P++AFVT+HI+ +    
Sbjct  50   KDVDITKTLDYSSAIAILGFSLIVSILRTFDVRVEAARVMVSPPVLAFVTSHIISMF---  106

Query  517  FDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLW  407
               G N  VC  M +A+L +W  WA VSRHPS WKLW
Sbjct  107  --TGWNMIVCVAMGVAQLFLWARWAAVSRHPSNWKLW  141



>emb|CDY02556.1| BnaA08g01630D [Brassica napus]
Length=145

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 74/97 (76%), Gaps = 5/97 (5%)
 Frame = -2

Query  697  RDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILYLNFYQ  518
            +DVD+T+ LD+SSA+A+LGFS+I++ILRTF+VR EA RVMV+ P++AFVT+HI+ +    
Sbjct  50   KDVDITKTLDYSSAIAILGFSLIVSILRTFDVRVEAARVMVSPPVLAFVTSHIISMF---  106

Query  517  FDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLW  407
               G N  VC  M +A+L +W  WA VSRHPS WKLW
Sbjct  107  --TGWNMIVCVAMGVAQLFLWARWAAVSRHPSNWKLW  141



>ref|XP_009788344.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Nicotiana sylvestris]
Length=335

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 89/156 (57%), Gaps = 55/156 (35%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S V HSRDV+LTE+LD+SSAVALLGFS+I++ILR F+++DEA RV++++P++AF TTHI 
Sbjct  172  SVVSHSRDVELTEKLDYSSAVALLGFSLIISILRCFSIKDEATRVLMSAPLLAFTTTHI-  230

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRHPSRWKLWvvviggvvatvveVFDF  356
                Y  +Y ++                                                
Sbjct  231  ---LYLNNYQMD------------------------------------------------  239

Query  355  APYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRT  248
               +G +DAH++WHAT +PL Y++WSF++DD++++T
Sbjct  240  ---YGIIDAHSLWHATTVPLAYIWWSFIQDDAKYQT  272



>gb|KDO46709.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=288

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFHSRDVDLTE+ D+SSAVALLGFS+ILAILR+FNVRDEA RVMVA+P++AFVTTHIL
Sbjct  181  SAVFHSRDVDLTEKFDYSSAVALLGFSLILAILRSFNVRDEAARVMVAAPLLAFVTTHIL  240



>ref|XP_010739161.1| PREDICTED: post-GPI attachment to proteins factor 3 [Larimichthys 
crocea]
Length=355

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A+L +S+ L  +RT  +R      MV   +I   T+H+ 
Sbjct  188  STVFHTRDTYLTEKMDYFCATAVLLYSIYLCCVRTLGLRRPGVSSMVGVLLILLFTSHVS  247

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F +FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  248  YLTFVRFDYGYNMAANASIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  307

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +
Sbjct  308  DFPPMLWVLDAHAVWHLSTIPVHFLFYSFLIDDSLY  343



>emb|CBZ39512.1| td11ITM2 protein, partial [Triticum turgidum subsp. durum]
Length=73

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  712  AVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHILY  533
            A++HS D   TE+L  SSA A LG+S+ILAILRT N+RDEA RVMVA+PI+AFVTTHI Y
Sbjct  5    AIYHSCDTAWTEKLYLSSAAAFLGYSLILAILRTSNLRDEASRVMVAAPILAFVTTHIPY  64

Query  532  LNFYQFDYG  506
            LNFY+ D G
Sbjct  65   LNFYELDKG  73



>ref|XP_008435790.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Poecilia 
reticulata]
Length=308

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 88/154 (57%), Gaps = 2/154 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R      MV + +I   T+H+ 
Sbjct  141  STVFHTRDTFLTEKMDYFCATAVILYSIYLCCVRTLGLRRPGVSSMVGALLILVFTSHVS  200

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F +FDYG N      + M  +  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  201  YLTFIRFDYGYNMAANVSIGMVNMLWWFCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  260

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDS  260
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS
Sbjct  261  DFPPLLWILDAHAVWHLSTIPVHFLFYSFLIDDS  294



>ref|XP_005810657.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Xiphophorus 
maculatus]
Length=308

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 93/168 (55%), Gaps = 4/168 (2%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R      MV + +I   T+H+ 
Sbjct  141  STVFHTRDTFLTEKMDYFCATAVILYSIYLCCVRTLGLRRPGVSSMVGALLILAFTSHVS  200

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F +FDYG N      + M  +  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  201  YLTFIRFDYGYNMAANVSIGMVNMLWWFCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  260

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF--RTTSLSKKAK  224
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +   T  L  K +
Sbjct  261  DFPPLLWILDAHAVWHLSTIPVHFLFYSFLIDDSLYLLNTEKLGVKVE  308



>ref|XP_004080335.1| PREDICTED: post-GPI attachment to proteins factor 3 [Oryzias 
latipes]
Length=343

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R      MV + +I   T+H+ 
Sbjct  176  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLRRPGLSSMVGALLILVFTSHVS  235

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK   VV+      ++E+ 
Sbjct  236  YLTFVSFDYGYNMAANTAIGMVNLLWWLCWCWQNRRTLPYWWKCGSVVLLLHGLALLELL  295

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +
Sbjct  296  DFPPLLWILDAHAVWHLSTIPVHFLFYSFLIDDSLY  331



>ref|XP_008312260.1| PREDICTED: post-GPI attachment to proteins factor 3 [Cynoglossus 
semilaevis]
Length=329

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SAVFH+RD  LTE++D+  A A++ +S+ L  +RT  +R  +   MV   +I   T+H+ 
Sbjct  162  SAVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLRRPSVSSMVGILLILAFTSHVS  221

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N        M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  222  YLTFVSFDYGYNMAANASFGMVNLMWWLCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  281

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P +   DAHAVWH + +P+ +LF+SF+ DDS +
Sbjct  282  DFPPLYWVFDAHAVWHLSTVPVHFLFYSFLIDDSLY  317



>ref|XP_787276.2| PREDICTED: post-GPI attachment to proteins factor 3-like [Strongylocentrotus 
purpuratus]
Length=335

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 91/171 (53%), Gaps = 8/171 (5%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIA----FVT  548
            S VFHSRD+  TE++D+  A +++  S+I +++R F VRD +  + VA  I A    F  
Sbjct  164  STVFHSRDLPWTEKMDYFCAYSIVMCSLITSLVRVFAVRDNSLNMKVALGITAVSSLFYL  223

Query  547  THILYLNFYQFDYGLNRKVCFGMVM---AKLTIWGVWAGVSRHPSRWKLWvvviggvvat  377
             HI +L F  F+YG N KV     M   A + +W  W  +   P  WK    ++   V  
Sbjct  224  KHICHLAFVDFNYGYNMKVNIATAMFNFAVMVLWSAW-HIKEQPYLWKAIASIVSINVCI  282

Query  376  vveVFDFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK  224
             +EV DF P+W   DAH++WHA+ IPL  L+ S+  DD  +   +  K  K
Sbjct  283  SLEVLDFPPFWWTFDAHSLWHASTIPLVILYASYFVDDCLYVHNAKGKLVK  333



>ref|XP_003458790.2| PREDICTED: post-GPI attachment to proteins factor 3-like [Oreochromis 
niloticus]
Length=357

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  ++      MV + +I   T+H+ 
Sbjct  190  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLKRPGVSSMVGALLILVFTSHVS  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  250  YLTFVSFDYGYNMAANATIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVMLLHGLALLELL  309

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +
Sbjct  310  DFPPLLWVLDAHAVWHLSTIPVHFLFYSFLIDDSLY  345



>ref|XP_007572869.1| PREDICTED: post-GPI attachment to proteins factor 3 [Poecilia 
formosa]
Length=331

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 93/168 (55%), Gaps = 4/168 (2%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R  A   +V   +I   T+H+ 
Sbjct  164  STVFHTRDTFLTEKMDYFCATAVILYSIYLCCVRTLGLRRPAVSSIVGVLLILAFTSHVS  223

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F +FDYG N      + M  +  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  224  YLTFVRFDYGYNMAANVSIGMVNMLWWFCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  283

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF--RTTSLSKKAK  224
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +   T  L  K +
Sbjct  284  DFPPLLWILDAHAVWHLSTIPVYFLFYSFLIDDSLYLLNTEKLGVKVE  331



>emb|CBN81402.1| Post-GPI attachment to proteins factor 3 [Dicentrarchus labrax]
Length=308

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R      MV   +I   T+H+ 
Sbjct  141  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLRRPGVSSMVGVVLILAFTSHVS  200

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  201  YLTFVSFDYGYNMAANASIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  260

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + +P+ +LF+SF+ DDS +
Sbjct  261  DFPPMLWILDAHAVWHLSTVPVHFLFYSFLIDDSLY  296



>ref|XP_006805747.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Neolamprologus 
brichardi]
Length=357

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  ++      MV   +I   T+H+ 
Sbjct  190  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLKQPGVSSMVGVLLILVFTSHVS  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  250  YLTFVSFDYGYNMAANATIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVVLLHGLALLELL  309

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +
Sbjct  310  DFPPLLWVLDAHAVWHLSTIPVHFLFYSFLIDDSLY  345



>ref|XP_008281815.1| PREDICTED: post-GPI attachment to proteins factor 3 [Stegastes 
partitus]
 ref|XP_008302298.1| PREDICTED: post-GPI attachment to proteins factor 3 [Stegastes 
partitus]
Length=356

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R      MV   +I   T+H+ 
Sbjct  189  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLRRPGVSSMVGVLLILAFTSHVS  248

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  249  YLTFVSFDYGYNMAANATIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  308

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +
Sbjct  309  DFPPLLWILDAHAVWHLSTIPVHFLFYSFLIDDSLY  344



>ref|XP_005947497.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Haplochromis 
burtoni]
Length=357

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 91/168 (54%), Gaps = 4/168 (2%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  ++      MV   +I   T+H+ 
Sbjct  190  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLKRPGVSSMVGVLLILVFTSHVS  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  250  YLTFVSFDYGYNMAANATIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVVLLHGLALLELL  309

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF--RTTSLSKKAK  224
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +   T  L  K +
Sbjct  310  DFPPLLWVLDAHAVWHLSTIPVHFLFYSFLIDDSLYLLNTEKLGVKVE  357



>ref|XP_005749356.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pundamilia 
nyererei]
Length=357

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 91/168 (54%), Gaps = 4/168 (2%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  ++      MV   +I   T+H+ 
Sbjct  190  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLKRPGVSSMVGVLLILVFTSHVS  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  250  YLTFVSFDYGYNMAANATIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVVLLHGLALLELL  309

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF--RTTSLSKKAK  224
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +   T  L  K +
Sbjct  310  DFPPLLWVLDAHAVWHLSTIPVHFLFYSFLIDDSLYLLNTEKLGVKVE  357



>ref|XP_010770964.1| PREDICTED: post-GPI attachment to proteins factor 3 [Notothenia 
coriiceps]
Length=333

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  ++      MV   +I   T+H+ 
Sbjct  166  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLKRPGVSSMVGVLLILAFTSHVS  225

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  226  YLTFVSFDYGYNMAANTSIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVVLLHGLALLELL  285

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + +P+ +LF+SF+ DDS +
Sbjct  286  DFPPMLWILDAHAVWHLSTVPVHFLFYSFLIDDSLY  321



>ref|XP_010902233.1| PREDICTED: post-GPI attachment to proteins factor 3 [Esox lucius]
Length=332

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 2/154 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R      MV   +I   T+H+ 
Sbjct  165  STVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPGVSSMVGVVLILAFTSHVF  224

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + +  L  W  W   +R   P  WK  VVV+      ++E+ 
Sbjct  225  YLTFISFDYGYNMAANATIGIVNLLWWLCWCWQNRRTLPYWWKCGVVVMLLHGLALLELL  284

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDS  260
            DF P +  +DAHAVWH + +P+ +LF+SF+ DDS
Sbjct  285  DFPPLFWILDAHAVWHLSTVPVHFLFYSFLIDDS  318



>ref|XP_004575037.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Maylandia 
zebra]
Length=357

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  ++      MV   +I   T+H+ 
Sbjct  190  STVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLKRPGVSSMVGVLLILVFTSHVS  249

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  +VV+      ++E+ 
Sbjct  250  YLTFVSFDYGYNMAANATIGMVNLLWWLCWCWQNRRTLPYWWKCGLVVLLLHGLALLELL  309

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEF  254
            DF P    +DAHAVWH + IP+ +LF+SF+ DDS +
Sbjct  310  DFPPLLWVLDAHAVWHLSTIPVHFLFYSFLIDDSLY  345



>ref|XP_007239376.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Astyanax 
mexicanus]
Length=323

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 87/154 (56%), Gaps = 2/154 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD  LTE++D+  A A++ +S+ L  +RT  +R      MV   +I   T+H+ 
Sbjct  156  STVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPGVSSMVGVLLILAFTSHVS  215

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWAGVSRH--PSRWKLWvvviggvvatvveVF  362
            YL F  FDYG N      + M  L  W  W   +R   P  WK  VVV+      ++E+ 
Sbjct  216  YLTFVSFDYGYNMAANATIGMINLLWWLGWCWQNRRTLPYWWKCGVVVVLLHGLALLELL  275

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDS  260
            DF P +  +DAHAVWH + +P+ +LF+SF+ DDS
Sbjct  276  DFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDS  309



>ref|XP_008657726.1| PREDICTED: post-GPI attachment to proteins factor 3-like, partial 
[Zea mays]
Length=179

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SS  A LG+S+IL ILRT ++RDEA RVMVA+PI+AFVTTHI+
Sbjct  92   SAIYHSCDTIWTEKLYFSSDAAFLGYSLILTILRTSSLRDEASRVMVAAPILAFVTTHIM  151

Query  535  YLNFYQFDYGLNRKV  491
            YLNFY+ D G  + +
Sbjct  152  YLNFYELDKGRRKDL  166



>ref|XP_007062025.1| PREDICTED: post-GPI attachment to proteins factor 3 [Chelonia 
mydas]
 gb|EMP33830.1| Post-GPI attachment to proteins factor 3 [Chelonia mydas]
Length=248

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 89/168 (53%), Gaps = 2/168 (1%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            S VFH+RD D+TE++D+  A  ++  S+ L  +RT  ++  A      S +I F+  H+ 
Sbjct  81   STVFHTRDTDVTEKMDYFCASTVILHSIYLCCVRTLGLKRPAFANAFGSFLILFLACHVS  140

Query  535  YLNFYQFDYGLNRKVCFGMVMAKLTIWGVWA--GVSRHPSRWKLWvvviggvvatvveVF  362
            YL   +FDYG N      + +  L  W  W      R P  WK  VVV+      ++E+ 
Sbjct  141  YLTLVRFDYGYNMAANVAIGLLNLFWWLGWCVRNQQRLPYVWKCVVVVLLLQGLALLELL  200

Query  361  DFAPYWGYVDAHAVWHATCIPLTYLFWSFVRDDSEFRTTSLSKKAK*D  218
            DF P +   DAHA+WH + IP+  LF+SF+RDDS +   + S   K D
Sbjct  201  DFPPLFWIFDAHAIWHISTIPVNVLFYSFLRDDSLYLLKANSDILKID  248



>ref|XP_008666951.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Zea 
mays]
Length=167

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  715  SAVFHSRDVDLTERLDHSSAVALLGFSVILAILRTFNVRDEAPRVMVASPIIAFVTTHIL  536
            SA++HS D   TE+L  SS  A LG+S+IL ILRT ++RDEA RVMVA+PI+AFVTTHI+
Sbjct  92   SAIYHSCDTIWTEKLYFSSDAAFLGYSLILTILRTSSLRDEASRVMVAAPILAFVTTHIM  151

Query  535  YLNFYQFDYG  506
            YLNFY+ D G
Sbjct  152  YLNFYELDKG  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395