BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005E07

Length=724
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348372.1|  PREDICTED: vam6/Vps39-like protein-like            390   6e-125   Solanum tuberosum [potatoes]
ref|XP_004243182.1|  PREDICTED: vam6/Vps39-like protein                 389   1e-124   Solanum lycopersicum
ref|XP_011099610.1|  PREDICTED: vam6/Vps39-like protein                 375   2e-119   Sesamum indicum [beniseed]
ref|XP_006340626.1|  PREDICTED: vam6/Vps39-like protein-like            375   3e-119   Solanum tuberosum [potatoes]
emb|CDO99043.1|  unnamed protein product                                372   3e-118   Coffea canephora [robusta coffee]
gb|EYU40165.1|  hypothetical protein MIMGU_mgv1a000716mg                369   1e-116   Erythranthe guttata [common monkey flower]
ref|XP_004232411.1|  PREDICTED: vam6/Vps39-like protein isoform X2      360   1e-113   Solanum lycopersicum
ref|XP_009777137.1|  PREDICTED: vam6/Vps39-like protein                 359   4e-113   Nicotiana sylvestris
ref|XP_009619069.1|  PREDICTED: vam6/Vps39-like protein                 357   3e-112   Nicotiana tomentosiformis
ref|XP_002521595.1|  conserved hypothetical protein                     354   1e-111   
ref|XP_009340752.1|  PREDICTED: vam6/Vps39-like protein                 352   2e-110   Pyrus x bretschneideri [bai li]
ref|XP_008241674.1|  PREDICTED: vam6/Vps39-like protein                 350   2e-109   Prunus mume [ume]
ref|XP_009347535.1|  PREDICTED: vam6/Vps39-like protein                 349   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_010316369.1|  PREDICTED: vam6/Vps39-like protein isoform X1      349   3e-109   Solanum lycopersicum
ref|XP_010089006.1|  Vam6/Vps39-like protein                            348   4e-109   
emb|CBI17520.3|  unnamed protein product                                346   9e-109   Vitis vinifera
ref|XP_007203223.1|  hypothetical protein PRUPE_ppa000769mg             346   3e-108   Prunus persica
ref|XP_006425673.1|  hypothetical protein CICLE_v10024797mg             345   4e-108   Citrus clementina [clementine]
ref|XP_006425674.1|  hypothetical protein CICLE_v10024797mg             345   7e-108   Citrus clementina [clementine]
ref|XP_002267514.1|  PREDICTED: vam6/Vps39-like protein                 345   8e-108   Vitis vinifera
gb|KDP38604.1|  hypothetical protein JCGZ_05311                         344   1e-107   Jatropha curcas
ref|XP_007048415.1|  Vacuolar sorting protein 39 isoform 2              340   3e-107   
ref|XP_008344274.1|  PREDICTED: vam6/Vps39-like protein                 343   4e-107   
ref|XP_010070055.1|  PREDICTED: vam6/Vps39-like protein                 341   3e-106   Eucalyptus grandis [rose gum]
ref|XP_009371595.1|  PREDICTED: vam6/Vps39-like protein                 340   6e-106   
gb|KJB43501.1|  hypothetical protein B456_007G203400                    338   8e-106   Gossypium raimondii
ref|XP_007048414.1|  Vacuolar sorting protein 39 isoform 1              339   9e-106   
gb|KHG02853.1|  Vam6/Vps39-like protein                                 338   1e-105   Gossypium arboreum [tree cotton]
gb|KJB43502.1|  hypothetical protein B456_007G203400                    338   2e-105   Gossypium raimondii
ref|XP_011003738.1|  PREDICTED: vam6/Vps39-like protein                 338   3e-105   Populus euphratica
ref|XP_006411980.1|  hypothetical protein EUTSA_v10024305mg             338   4e-105   Eutrema salsugineum [saltwater cress]
ref|XP_011025779.1|  PREDICTED: vam6/Vps39-like protein                 337   6e-105   Populus euphratica
ref|XP_010548331.1|  PREDICTED: vam6/Vps39-like protein                 336   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_003537587.1|  PREDICTED: vam6/Vps39-like protein-like            334   1e-103   Glycine max [soybeans]
gb|KHN41977.1|  Vam6/Vps39-like protein                                 333   1e-103   Glycine soja [wild soybean]
gb|KHN36129.1|  Vam6/Vps39-like protein                                 332   1e-103   Glycine soja [wild soybean]
ref|XP_007046945.1|  Vacuolar sorting protein 39                        332   2e-103   
ref|XP_010432158.1|  PREDICTED: vam6/Vps39-like protein                 333   2e-103   
ref|XP_003517237.2|  PREDICTED: vam6/Vps39-like protein-like            333   4e-103   Glycine max [soybeans]
ref|XP_002867003.1|  hypothetical protein ARALYDRAFT_490975             332   6e-103   
ref|XP_006383195.1|  hypothetical protein POPTR_0005s12470g             330   2e-102   
ref|XP_006283063.1|  hypothetical protein CARUB_v10004058mg             330   3e-102   Capsella rubella
ref|NP_195381.6|  protein EMBRYO DEFECTIVE 2754                         328   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446769.1|  PREDICTED: vam6/Vps39-like protein                 328   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_007156942.1|  hypothetical protein PHAVU_002G030300g             328   1e-101   Phaseolus vulgaris [French bean]
ref|XP_010679721.1|  PREDICTED: vam6/Vps39-like protein                 328   1e-101   
ref|XP_009138434.1|  PREDICTED: vam6/Vps39-like protein                 327   3e-101   Brassica rapa
gb|KGN53245.1|  hypothetical protein Csa_4G038630                       326   5e-101   Cucumis sativus [cucumbers]
emb|CDY42696.1|  BnaA03g53490D                                          326   7e-101   Brassica napus [oilseed rape]
ref|XP_004149149.1|  PREDICTED: vam6/Vps39-like protein-like            326   7e-101   Cucumis sativus [cucumbers]
ref|XP_004509258.1|  PREDICTED: vam6/Vps39-like protein-like isof...    326   9e-101   Cicer arietinum [garbanzo]
ref|XP_004509257.1|  PREDICTED: vam6/Vps39-like protein-like isof...    326   1e-100   Cicer arietinum [garbanzo]
emb|CAN61039.1|  hypothetical protein VITISV_018673                     332   2e-100   Vitis vinifera
ref|XP_010263662.1|  PREDICTED: vam6/Vps39-like protein                 325   3e-100   Nelumbo nucifera [Indian lotus]
emb|CDX72591.1|  BnaC07g46130D                                          324   4e-100   
ref|XP_004165852.1|  PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-l...    324   5e-100   
ref|XP_008453745.1|  PREDICTED: vam6/Vps39-like protein                 322   2e-99    Cucumis melo [Oriental melon]
gb|KEH27560.1|  vam6/Vps39-like protein                                 317   4e-99    Medicago truncatula
ref|XP_010437326.1|  PREDICTED: vam6/Vps39-like protein                 321   7e-99    Camelina sativa [gold-of-pleasure]
gb|AET03930.2|  vam6/Vps39-like protein                                 318   8e-98    Medicago truncatula
ref|XP_004512043.1|  PREDICTED: vam6/Vps39-like protein-like            318   9e-98    Cicer arietinum [garbanzo]
ref|XP_003611995.1|  Vam6/Vps39-like protein                            315   3e-97    
ref|XP_003629454.1|  Tubby-like F-box protein                           317   3e-96    
gb|KFK30284.1|  hypothetical protein AALP_AA7G241500                    313   7e-96    Arabis alpina [alpine rockcress]
ref|XP_004287898.1|  PREDICTED: vam6/Vps39-like protein                 313   9e-96    Fragaria vesca subsp. vesca
emb|CAB16830.1|  hypothetical protein                                   307   8e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010916253.1|  PREDICTED: vam6/Vps39-like protein isoform X2      292   6e-89    
gb|KJB17778.1|  hypothetical protein B456_003G015100                    292   3e-88    Gossypium raimondii
ref|XP_010916252.1|  PREDICTED: vam6/Vps39-like protein isoform X1      292   3e-88    Elaeis guineensis
ref|XP_008775839.1|  PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-l...    288   8e-87    Phoenix dactylifera
ref|XP_010258481.1|  PREDICTED: vam6/Vps39-like protein isoform X2      279   2e-83    Nelumbo nucifera [Indian lotus]
ref|XP_010258480.1|  PREDICTED: vam6/Vps39-like protein isoform X1      279   3e-83    Nelumbo nucifera [Indian lotus]
gb|KHG17162.1|  Vam6/Vps39-like protein                                 276   1e-82    Gossypium arboreum [tree cotton]
ref|XP_002310230.2|  hypothetical protein POPTR_0007s12810g             275   7e-82    
ref|XP_009409101.1|  PREDICTED: vam6/Vps39-like protein                 274   2e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004981979.1|  PREDICTED: vam6/Vps39-like protein-like isof...    271   6e-81    
ref|XP_004981978.1|  PREDICTED: vam6/Vps39-like protein-like isof...    272   1e-80    Setaria italica
ref|XP_002463992.1|  hypothetical protein SORBIDRAFT_01g010130          268   2e-79    Sorghum bicolor [broomcorn]
tpg|DAA51025.1|  TPA: hypothetical protein ZEAMMB73_281557              268   2e-79    
ref|XP_006650498.1|  PREDICTED: vam6/Vps39-like protein-like            266   1e-78    Oryza brachyantha
gb|EEE59815.1|  hypothetical protein OsJ_12351                          263   9e-78    Oryza sativa Japonica Group [Japonica rice]
gb|ABB45382.1|  TVLP1                                                   262   3e-77    Oryza sativa Indica Group [Indian rice]
ref|NP_001051077.1|  Os03g0715500                                       262   3e-77    
gb|AAL58199.1|AC090882_2  TGF beta receptor associated protein-li...    262   4e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009109971.1|  PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-l...    251   2e-76    
ref|XP_006858768.1|  hypothetical protein AMTR_s00066p00149360          260   2e-76    Amborella trichopoda
ref|XP_003560617.1|  PREDICTED: vam6/Vps39-like protein                 258   1e-75    Brachypodium distachyon [annual false brome]
gb|EMS67489.1|  Vam6/Vps39-like protein                                 253   3e-73    Triticum urartu
gb|EPS67833.1|  hypothetical protein M569_06937                         244   3e-72    Genlisea aurea
ref|XP_008338142.1|  PREDICTED: vam6/Vps39-like protein                 209   8e-59    
gb|KDO79545.1|  hypothetical protein CISIN_1g0018512mg                  204   2e-58    Citrus sinensis [apfelsine]
gb|KDO79543.1|  hypothetical protein CISIN_1g0018512mg                  204   1e-57    Citrus sinensis [apfelsine]
gb|KJB43500.1|  hypothetical protein B456_007G203400                    201   4e-56    Gossypium raimondii
emb|CDY24777.1|  BnaA08g15330D                                          180   1e-48    Brassica napus [oilseed rape]
dbj|BAH56769.1|  AT4G36630                                              167   2e-44    Arabidopsis thaliana [mouse-ear cress]
gb|KDO79548.1|  hypothetical protein CISIN_1g0018511mg                  139   3e-37    Citrus sinensis [apfelsine]
ref|XP_008367954.1|  PREDICTED: vam6/Vps39-like protein                 143   7e-37    
gb|KDO79546.1|  hypothetical protein CISIN_1g0018511mg                  139   2e-35    Citrus sinensis [apfelsine]
ref|XP_002973518.1|  hypothetical protein SELMODRAFT_149115             144   2e-35    
ref|XP_002975550.1|  hypothetical protein SELMODRAFT_442906             142   1e-34    Selaginella moellendorffii
emb|CDY35465.1|  BnaC03g61950D                                          130   2e-33    Brassica napus [oilseed rape]
emb|CDX83649.1|  BnaC07g23890D                                          117   5e-28    
emb|CDY53083.1|  BnaC03g76730D                                          117   7e-27    Brassica napus [oilseed rape]
gb|ESA12188.1|  hypothetical protein GLOINDRAFT_27429                 66.6    3e-09    
gb|EXX74416.1|  Vam6p                                                 66.6    3e-09    Rhizophagus irregularis DAOM 197198w
gb|EXX74414.1|  Vam6p                                                 66.6    3e-09    Rhizophagus irregularis DAOM 197198w
emb|CBJ28092.1|  conserved unknown protein                            66.6    3e-09    Ectocarpus siliculosus
gb|EXX74415.1|  Vam6p                                                 66.2    4e-09    Rhizophagus irregularis DAOM 197198w
ref|XP_008902429.1|  hypothetical protein PPTG_09287                  65.9    6e-09    Phytophthora parasitica INRA-310
gb|ETL98061.1|  hypothetical protein L917_04787                       65.9    6e-09    Phytophthora parasitica
gb|ETK91497.1|  hypothetical protein L915_04940                       65.9    6e-09    Phytophthora parasitica
gb|ETM51227.1|  hypothetical protein L914_04891                       65.9    6e-09    Phytophthora parasitica
gb|ETP21385.1|  hypothetical protein F441_05078                       65.9    7e-09    Phytophthora parasitica CJ01A1
gb|ETP49310.1|  hypothetical protein F442_05136                       63.9    2e-08    Phytophthora parasitica P10297
gb|ETI51606.1|  hypothetical protein F443_05073                       62.4    7e-08    Phytophthora parasitica P1569
gb|EPS66254.1|  hypothetical protein M569_08522                       61.6    9e-08    Genlisea aurea
ref|XP_009526848.1|  hypothetical protein PHYSODRAFT_331721           62.0    1e-07    Phytophthora sojae
ref|XP_005847817.1|  hypothetical protein CHLNCDRAFT_134018           60.8    3e-07    Chlorella variabilis
ref|XP_008613257.1|  hypothetical protein SDRG_09121                  58.5    1e-06    Saprolegnia diclina VS20
gb|KDO29045.1|  hypothetical protein SPRG_06100                       58.2    2e-06    Saprolegnia parasitica CBS 223.65
ref|XP_004751240.1|  PREDICTED: vam6/Vps39-like protein isoform X1    58.2    2e-06    
ref|XP_004751241.1|  PREDICTED: vam6/Vps39-like protein isoform X2    58.2    2e-06    Mustela putorius furo [black ferret]
gb|KFH64948.1|  hypothetical protein MVEG_09676                       57.0    5e-06    Mortierella verticillata NRRL 6337
ref|XP_007783065.1|  hypothetical protein W97_07002                   56.2    9e-06    Coniosporium apollinis CBS 100218
ref|XP_002899468.1|  conserved hypothetical protein                   55.8    1e-05    Phytophthora infestans T30-4
ref|XP_002678158.1|  CNH domain-containing protein                    55.5    1e-05    Naegleria gruberi strain NEG-M
ref|XP_005090680.1|  PREDICTED: vam6/Vps39-like protein-like isof...  55.5    2e-05    Aplysia californica
ref|XP_005090679.1|  PREDICTED: vam6/Vps39-like protein-like isof...  55.5    2e-05    
ref|XP_003836838.1|  similar to vacuolar morphogenesis protein AvaB   55.1    2e-05    Leptosphaeria maculans JN3
ref|XP_005644041.1|  hypothetical protein COCSUDRAFT_58773            54.7    3e-05    Coccomyxa subellipsoidea C-169
ref|XP_002941202.1|  PREDICTED: transforming growth factor-beta r...  53.5    7e-05    Xenopus tropicalis [western clawed frog]
gb|EXX73335.1|  Vam6p                                                 52.8    1e-04    Rhizophagus irregularis DAOM 197198w
emb|CEG77263.1|  hypothetical protein RMATCC62417_12049               52.4    1e-04    Rhizopus microsporus
emb|CBK20343.2|  unnamed protein product                              52.4    1e-04    Blastocystis hominis
ref|XP_001805746.1|  hypothetical protein SNOG_15601                  52.8    1e-04    Parastagonospora nodorum SN15
emb|CBK23177.2|  unnamed protein product                              52.4    2e-04    Blastocystis hominis
ref|NP_001077023.1|  transforming growth factor-beta receptor-ass...  52.4    2e-04    Danio rerio [leopard danio]
gb|EXX73336.1|  Vam6p                                                 52.0    2e-04    Rhizophagus irregularis DAOM 197198w
ref|XP_001729176.1|  hypothetical protein MGL_3643                    52.0    2e-04    Malassezia globosa CBS 7966
emb|CEG64743.1|  hypothetical protein RMATCC62417_01664               52.0    2e-04    Rhizopus microsporus
emb|CEI95304.1|  hypothetical protein RMCBS344292_09494               52.0    2e-04    Rhizopus microsporus
ref|XP_002670182.1|  predicted protein                                52.0    2e-04    Naegleria gruberi strain NEG-M
emb|CEJ01119.1|  hypothetical protein RMCBS344292_15155               52.0    2e-04    Rhizopus microsporus
ref|XP_008021503.1|  hypothetical protein SETTUDRAFT_174898           51.6    3e-04    Exserohilum turcica Et28A
ref|XP_005806816.1|  PREDICTED: transforming growth factor-beta r...  51.6    4e-04    
ref|XP_011445059.1|  PREDICTED: vam6/Vps39-like protein               51.2    5e-04    Crassostrea gigas
ref|XP_009300553.1|  PREDICTED: transforming growth factor-beta r...  50.4    7e-04    Danio rerio [leopard danio]



>ref|XP_006348372.1| PREDICTED: vam6/Vps39-like protein-like [Solanum tuberosum]
Length=1004

 Score =   390 bits (1002),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 189/224 (84%), Positives = 211/224 (94%), Gaps = 2/224 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVRRLV+SNNAVIVAL+NSVFGFFPVPLGAQIVQLTASGNFEEALALC
Sbjct  268  VPYPLIQTVVLRNVRRLVRSNNAVIVALDNSVFGFFPVPLGAQIVQLTASGNFEEALALC  327

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDSSLR+AKEQSIHIRYAH+L+ENGSYEEAMEHFLASQVE+TYVL+LYPSII+PK
Sbjct  328  KLLPPEDSSLRSAKEQSIHIRYAHFLFENGSYEEAMEHFLASQVELTYVLALYPSIIVPK  387

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN-THILESDETDIESKKMSHNTLMALI  187
            S+ IPEP+KFV++ GD P LSR SS LSDD++S  +H+LESDE D+ESKKMSHNTLMALI
Sbjct  388  SSFIPEPQKFVEV-GDAPYLSRASSGLSDDLDSTPSHVLESDEIDMESKKMSHNTLMALI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQK+RY +IEKATAEGTEEVVSDAVGD+F+SYGTSRSKK  K
Sbjct  447  KYLQKRRYSVIEKATAEGTEEVVSDAVGDNFISYGTSRSKKPTK  490



>ref|XP_004243182.1| PREDICTED: vam6/Vps39-like protein [Solanum lycopersicum]
Length=1004

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/224 (84%), Positives = 210/224 (94%), Gaps = 2/224 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVRRLV+SNNAVIVAL+NSVFGFFPVPLGAQIVQLTASGNFEEALALC
Sbjct  268  VPYPLIQTVVLRNVRRLVRSNNAVIVALDNSVFGFFPVPLGAQIVQLTASGNFEEALALC  327

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDSSLR+AKEQSIHIRYAH+L+ENGSYEEAMEHFLASQVE+TYVL+LYPSII+PK
Sbjct  328  KLLPPEDSSLRSAKEQSIHIRYAHFLFENGSYEEAMEHFLASQVELTYVLALYPSIIVPK  387

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN-THILESDETDIESKKMSHNTLMALI  187
            S+ IPEP+KFV++ GD P LSR SS LSDD++S  +H+LESDE DIESKKMSHNTLMALI
Sbjct  388  SSFIPEPQKFVEV-GDAPYLSRASSGLSDDLDSTPSHVLESDEMDIESKKMSHNTLMALI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQK+RY ++EKAT EGTEEVVSDAVGD+F+SYGTSRSKK  K
Sbjct  447  KYLQKRRYSVVEKATTEGTEEVVSDAVGDNFISYGTSRSKKPTK  490



>ref|XP_011099610.1| PREDICTED: vam6/Vps39-like protein [Sesamum indicum]
Length=1006

 Score =   375 bits (964),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 205/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVRRL+QS++ +IVA+ENSV+G FPVPLGAQIVQLTASGNFEEALALCK
Sbjct  272  PYPLIQTVVLRNVRRLLQSSHVIIVAVENSVYGLFPVPLGAQIVQLTASGNFEEALALCK  331

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKEQSIHIRYAHYL+ENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS
Sbjct  332  LLPPEDSNLRAAKEQSIHIRYAHYLFENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  391

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN-THILESDE-TDIESKKMSHNTLMALI  187
            + IPEPE+++DMS D P+LSRGSS +SDD+ES+  H L+S E TD+ESKKMSHN LMALI
Sbjct  392  SFIPEPERYMDMSSDAPDLSRGSSGMSDDLESSFPHALDSAESTDLESKKMSHNILMALI  451

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQ+KRYGI+EKA AEGTEE VSDAVG++FVSYG SR KK  K
Sbjct  452  KFLQRKRYGIVEKAAAEGTEEAVSDAVGNNFVSYGNSRPKKPSK  495



>ref|XP_006340626.1| PREDICTED: vam6/Vps39-like protein-like [Solanum tuberosum]
Length=1001

 Score =   375 bits (963),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 204/224 (91%), Gaps = 2/224 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVR LV+SNN VIVAL+NSVFGFFPVPLGAQIVQLTASGNFEEALALC
Sbjct  265  VPYPLIQTVVLRNVRHLVRSNNTVIVALDNSVFGFFPVPLGAQIVQLTASGNFEEALALC  324

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDSSLR++KEQSIH+RYAH+L+ENGSYEEAMEHF+ASQVEITYVL+LYPSII+PK
Sbjct  325  KLLPPEDSSLRSSKEQSIHMRYAHFLFENGSYEEAMEHFVASQVEITYVLALYPSIIIPK  384

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDETDIESKKMSHNTLMALI  187
            S+ IPEP+KF D++ D   LSRGSS LSDD++S  + + ESDE DIESKKMSHNTLMALI
Sbjct  385  SSCIPEPQKFADVA-DAAYLSRGSSGLSDDLDSPPSDVFESDEMDIESKKMSHNTLMALI  443

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQKKRY +IEKAT EGTEEVVSDAVGD+F+SYGT RSKK  K
Sbjct  444  KYLQKKRYSVIEKATTEGTEEVVSDAVGDNFISYGTDRSKKATK  487



>emb|CDO99043.1| unnamed protein product [Coffea canephora]
Length=1007

 Score =   372 bits (956),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 205/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVRRL+QSN+A+IVAL+NSV G FPVPLGAQIVQLTASGNFEEALALCK
Sbjct  271  PYPLIQTVVLRNVRRLLQSNSAIIVALDNSVHGLFPVPLGAQIVQLTASGNFEEALALCK  330

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKEQSIHIRYAHYL+ENG YEEAMEHFLASQVEIT+VLSLYP ++LPKS
Sbjct  331  LLPPEDSSLRAAKEQSIHIRYAHYLFENGCYEEAMEHFLASQVEITHVLSLYPYVVLPKS  390

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDET-DIESKKMSHNTLMALI  187
            ++IPEPEKF+D++GD   LSRGSS +SDDM+S  +H+LESDE  DIESKK+SHNTLMALI
Sbjct  391  SLIPEPEKFLDVTGDASYLSRGSSGMSDDMDSPPSHLLESDENADIESKKISHNTLMALI  450

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQKKRY IIEKA AEGTEEVV DAVG +F+SYG++R+KK  K
Sbjct  451  KFLQKKRYSIIEKAAAEGTEEVVLDAVGSNFISYGSTRAKKAGK  494



>gb|EYU40165.1| hypothetical protein MIMGU_mgv1a000716mg [Erythranthe guttata]
Length=1008

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 206/225 (92%), Gaps = 3/225 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVRRL+QS N ++VALENSV+  FPVPLGAQIVQLTASGNF+EALALCK
Sbjct  272  PYPLIQTVVLRNVRRLLQSTNVIVVALENSVYCLFPVPLGAQIVQLTASGNFDEALALCK  331

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+L+AAKEQSIH+RYAH+L+ENGS+E+AMEHFLASQVEI+YVLSLYPSI+LPKS
Sbjct  332  LLPPEDSNLQAAKEQSIHVRYAHHLFENGSFEDAMEHFLASQVEISYVLSLYPSIVLPKS  391

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDE-TDIESKKMSHNTLMAL  190
            + IPEPEK++DMSGD P LSRGSS +SDDMES+   + L+S+E TD+ES+KMSHNTLMAL
Sbjct  392  SFIPEPEKYLDMSGDAPELSRGSSGMSDDMESSLPPYALDSEESTDLESRKMSHNTLMAL  451

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IKFLQ+KRYGI+EKA AEGTEE VSDAVG++FVSYG +R KK+ K
Sbjct  452  IKFLQRKRYGIVEKAAAEGTEEAVSDAVGNNFVSYGNNRPKKSGK  496



>ref|XP_004232411.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Solanum lycopersicum]
Length=1001

 Score =   360 bits (924),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 198/224 (88%), Gaps = 2/224 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVR LVQSNN VIVAL+ SVFGFF VPLGAQIVQLTASGNFEEALALC
Sbjct  265  VPYPLIQTVVLRNVRHLVQSNNTVIVALDYSVFGFFAVPLGAQIVQLTASGNFEEALALC  324

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDSSLR++KEQSIH+RYAH+L+ENGSYEEAMEHFLASQVEITYVL+LYPSII+PK
Sbjct  325  KLLPPEDSSLRSSKEQSIHMRYAHFLFENGSYEEAMEHFLASQVEITYVLALYPSIIVPK  384

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSS-LSDDMESNTHILESDETDIESKKMSHNTLMALI  187
            S+ IPEP+KF D++ D P LSRGSS    D    ++ + ESDE DIESKKMSHNTLMALI
Sbjct  385  SSCIPEPQKFADVA-DAPYLSRGSSGLSDDLDSPSSDVFESDEMDIESKKMSHNTLMALI  443

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQKKRY +IEKAT EGTEEVVSDAVGD+F+SYGT RSKK  K
Sbjct  444  KYLQKKRYSVIEKATTEGTEEVVSDAVGDNFISYGTDRSKKPTK  487



>ref|XP_009777137.1| PREDICTED: vam6/Vps39-like protein [Nicotiana sylvestris]
Length=1004

 Score =   359 bits (921),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 190/224 (85%), Positives = 209/224 (93%), Gaps = 2/224 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVRR+V+SNNAVIVAL+ SVFGFFPVPLGAQIVQLTASGNFEEALALC
Sbjct  268  VPYPLIQTVVLRNVRRVVRSNNAVIVALDYSVFGFFPVPLGAQIVQLTASGNFEEALALC  327

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDSSLR AKEQSIHIRYAH+L+ENGSYEEAMEHFLASQVEITYVL+LYPSII+PK
Sbjct  328  KLLPPEDSSLRTAKEQSIHIRYAHFLFENGSYEEAMEHFLASQVEITYVLALYPSIIVPK  387

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN-THILESDETDIESKKMSHNTLMALI  187
            S+ IPEP+KFVD++ D P LSRGSS LSDD+ES  +++LESDE DIESKKMSHNTLM LI
Sbjct  388  SSFIPEPQKFVDVA-DAPYLSRGSSGLSDDLESTPSNVLESDEMDIESKKMSHNTLMGLI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQKKRY +IEKATAEGTEEVVSDAVGD+F+SYGTSRSKK  K
Sbjct  447  KYLQKKRYSVIEKATAEGTEEVVSDAVGDNFISYGTSRSKKPTK  490



>ref|XP_009619069.1| PREDICTED: vam6/Vps39-like protein [Nicotiana tomentosiformis]
Length=1004

 Score =   357 bits (915),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 190/224 (85%), Positives = 207/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVRR+V+SNNAVIVAL+ SVFGFFPVPLGAQIVQLTASGNFEEALALC
Sbjct  268  VPYPLIQTVVLRNVRRVVRSNNAVIVALDYSVFGFFPVPLGAQIVQLTASGNFEEALALC  327

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDSSLR AKEQSIHIRYAH+L+ENGSYEEAMEHFLASQVEITYVL+LYPSII+PK
Sbjct  328  KLLPPEDSSLRTAKEQSIHIRYAHFLFENGSYEEAMEHFLASQVEITYVLALYPSIIVPK  387

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI-LESDETDIESKKMSHNTLMALI  187
            S+ IPEP+KFVD++ D P LSRGSS LSDD++S   I LESDE DIESKKMSHNTLM LI
Sbjct  388  SSFIPEPQKFVDVA-DAPYLSRGSSGLSDDLDSTPSIVLESDELDIESKKMSHNTLMGLI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQKKRY +IEKATAEGTEEVVSDAVGD+F+SYGTSRSKK  K
Sbjct  447  KYLQKKRYSVIEKATAEGTEEVVSDAVGDNFISYGTSRSKKPTK  490



>ref|XP_002521595.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40866.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 207/238 (87%), Gaps = 5/238 (2%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL+NVR L+QSNN+VIVAL+NSV+G FPVPLGAQIVQLTASG+FEEALALC
Sbjct  265  VPYPLIQTIVLQNVRHLIQSNNSVIVALDNSVYGLFPVPLGAQIVQLTASGDFEEALALC  324

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQV+ITYVLSLYPSI+LPK
Sbjct  325  KLLPPEDASLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQVDITYVLSLYPSIVLPK  384

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI--LESDE-TDIESKKMSHNTLMA  193
            ++++PEPEK +D++ D P LSRGSS +SDD E +  +  +E DE   +ESKKMSHNTLMA
Sbjct  385  TSMVPEPEKLMDITSDAPYLSRGSSGVSDDTELSPPLQSIEFDERAALESKKMSHNTLMA  444

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIKV--AFIFILLGI  25
            LIKFLQKKRY IIEKATAEGTEEVV DAVGDSF  Y +SR KK+ KV  +  F++ G+
Sbjct  445  LIKFLQKKRYSIIEKATAEGTEEVVLDAVGDSFGPYDSSRFKKSNKVENSSFFLVSGV  502



>ref|XP_009340752.1| PREDICTED: vam6/Vps39-like protein [Pyrus x bretschneideri]
Length=1004

 Score =   352 bits (902),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 203/224 (91%), Gaps = 3/224 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRN RR++QSN+AV+VALENSV+G FPVPLGAQIVQLTASG+F+EALALCK
Sbjct  267  PYPLIQTVVLRNARRILQSNDAVVVALENSVYGLFPVPLGAQIVQLTASGDFDEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            +LPPE++SLRAAKE SIH+RYAH+L++NG+YE+AMEHFLASQV+ITYVLSLYPSIILPK+
Sbjct  327  MLPPEEASLRAAKEGSIHMRYAHHLFDNGAYEDAMEHFLASQVDITYVLSLYPSIILPKT  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME-SNTHILESDET-DIESKKMSHNTLMALI  187
             ++ EPEK +D+SGD P LSRGSS +SDDME S   +LES+E+  +ESKKMSHNTLMALI
Sbjct  387  TMVAEPEKLMDISGDSPYLSRGSSGISDDMEHSLPSLLESEESAALESKKMSHNTLMALI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQKKRYGIIEKATAEGTEEVV DAVGD+FVSY  SR KK+ K
Sbjct  447  KFLQKKRYGIIEKATAEGTEEVVLDAVGDNFVSY-ESRFKKSNK  489



>ref|XP_008241674.1| PREDICTED: vam6/Vps39-like protein [Prunus mume]
Length=1009

 Score =   350 bits (897),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 204/226 (90%), Gaps = 4/226 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRN RR++QSNN+VIVAL+N+V+G FPVPLGAQIVQLTASG+FEEALALCK
Sbjct  267  PYPLIQTVVLRNARRILQSNNSVIVALDNAVYGLFPVPLGAQIVQLTASGDFEEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPE++SLRAAKE SIH+RYAH+L++NG+YE+AMEHFLASQV+ITYVLSLYPSI+LPK+
Sbjct  327  LLPPEEASLRAAKEGSIHMRYAHHLFDNGAYEDAMEHFLASQVDITYVLSLYPSIVLPKT  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDET-DIESKKMSHNTLMAL  190
             ++ EPEK +D+SGD  +LSRGSS +SDDME +T  H+LES+E+  +ESKKMSHNTLMAL
Sbjct  387  TMVSEPEKLMDISGDSSHLSRGSSGISDDMEPSTPLHLLESEESAALESKKMSHNTLMAL  446

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY-GTSRSKKTIK  55
            IKFLQKKRYGIIEKATAEGTEEVV DAVG++F SY   +R K++ K
Sbjct  447  IKFLQKKRYGIIEKATAEGTEEVVLDAVGNNFASYESNNRFKRSNK  492



>ref|XP_009347535.1| PREDICTED: vam6/Vps39-like protein [Pyrus x bretschneideri]
Length=1004

 Score =   349 bits (896),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 203/224 (91%), Gaps = 3/224 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRN RR++QSN+AV+VALEN+V+G FPVPLGAQIVQLTASG+F+EALALCK
Sbjct  267  PYPLIQTVVLRNARRILQSNDAVVVALENAVYGLFPVPLGAQIVQLTASGDFDEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            +LPPE++SLRAAKE SIH+RYAH+L++NG+YE+AMEHF+ASQV+ITYVLSLYPSIILPK+
Sbjct  327  MLPPEEASLRAAKEGSIHMRYAHHLFDNGAYEDAMEHFVASQVDITYVLSLYPSIILPKT  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME-SNTHILESDET-DIESKKMSHNTLMALI  187
             ++ EPEK +D+SGD P LSRGSS +SDDME S   +LES+E+  +ESKKMSHNTLMALI
Sbjct  387  TMVAEPEKLMDISGDSPYLSRGSSGISDDMEHSLPSLLESEESAALESKKMSHNTLMALI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQKKRYGIIEKATAEGTEEVV DAVGD+FVSY  SR KK+ K
Sbjct  447  KFLQKKRYGIIEKATAEGTEEVVLDAVGDNFVSY-ESRFKKSNK  489



>ref|XP_010316369.1| PREDICTED: vam6/Vps39-like protein isoform X1 [Solanum lycopersicum]
Length=1019

 Score =   349 bits (895),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 198/242 (82%), Gaps = 20/242 (8%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVR LVQSNN VIVAL+ SVFGFF VPLGAQIVQLTASGNFEEALALC
Sbjct  265  VPYPLIQTVVLRNVRHLVQSNNTVIVALDYSVFGFFAVPLGAQIVQLTASGNFEEALALC  324

Query  543  KLLPPEDSSLRAAKEQSIHI------------------RYAHYLYENGSYEEAMEHFLAS  418
            KLLPPEDSSLR++KEQSIH+                  RYAH+L+ENGSYEEAMEHFLAS
Sbjct  325  KLLPPEDSSLRSSKEQSIHMRVNQYVCLWEVEGNTDYSRYAHFLFENGSYEEAMEHFLAS  384

Query  417  QVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSS-LSDDMESNTHILESD  241
            QVEITYVL+LYPSII+PKS+ IPEP+KF D++ D P LSRGSS    D    ++ + ESD
Sbjct  385  QVEITYVLALYPSIIVPKSSCIPEPQKFADVA-DAPYLSRGSSGLSDDLDSPSSDVFESD  443

Query  240  ETDIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKT  61
            E DIESKKMSHNTLMALIK+LQKKRY +IEKAT EGTEEVVSDAVGD+F+SYGT RSKK 
Sbjct  444  EMDIESKKMSHNTLMALIKYLQKKRYSVIEKATTEGTEEVVSDAVGDNFISYGTDRSKKP  503

Query  60   IK  55
             K
Sbjct  504  TK  505



>ref|XP_010089006.1| Vam6/Vps39-like protein [Morus notabilis]
 gb|EXB37233.1| Vam6/Vps39-like protein [Morus notabilis]
Length=1019

 Score =   348 bits (894),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 199/225 (88%), Gaps = 4/225 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVRRL+QSNN+ +VAL+NSV+G FPVPLGAQIVQLTASGNFEEALALCK
Sbjct  269  PYPLIQTVVLRNVRRLLQSNNSAVVALDNSVYGLFPVPLGAQIVQLTASGNFEEALALCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPED++LR AKE SIHIR+AHYL++NGSYEEAMEHFLASQV+ TYVLSLYPSIILPK+
Sbjct  329  LLPPEDANLRTAKEWSIHIRFAHYLFDNGSYEEAMEHFLASQVDATYVLSLYPSIILPKT  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES--NTHILESDET-DIESKKMSHNTLMAL  190
            +V PEPEK  D+S + P+LSR SS++SDDME     H+L+SDE+  ++SKKMSHNTLMAL
Sbjct  389  SV-PEPEKLTDLSWETPHLSRASSNVSDDMEQLPPQHMLDSDESVALQSKKMSHNTLMAL  447

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +KFLQKKRY IIE+ATAEGTEEVV DAVG++F SY +SR KK  K
Sbjct  448  VKFLQKKRYSIIERATAEGTEEVVLDAVGNNFASYDSSRFKKLNK  492



>emb|CBI17520.3| unnamed protein product [Vitis vinifera]
Length=924

 Score =   346 bits (887),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 198/226 (88%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRN+  L QSNNA++VA++NSV+G FPVPLGAQIVQLTASG+FEEALALC
Sbjct  184  VPYPLIQTVVLRNMCHLHQSNNAILVAVDNSVYGLFPVPLGAQIVQLTASGDFEEALALC  243

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            K+LPPED+SLRAAKE SIHIRYAHYL+ENGSYEEAM+ FLASQV+ITYVLSLYPSI+LPK
Sbjct  244  KMLPPEDASLRAAKEGSIHIRYAHYLFENGSYEEAMDQFLASQVDITYVLSLYPSIVLPK  303

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDETDI-ESKKMSHNTLMA  193
            S V+PEPEK ++   D  +LSRGSS +SDDMES+    +LES+E  + ESKKMSHNTLMA
Sbjct  304  SVVLPEPEKLMENVWDASHLSRGSSGVSDDMESSPPPQLLESEENAVLESKKMSHNTLMA  363

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIKFLQKKRY IIEKATAE TEEVV DAVGD+F SY ++RSKK+ K
Sbjct  364  LIKFLQKKRYNIIEKATAERTEEVVLDAVGDNFASYDSTRSKKSNK  409



>ref|XP_007203223.1| hypothetical protein PRUPE_ppa000769mg [Prunus persica]
 gb|EMJ04422.1| hypothetical protein PRUPE_ppa000769mg [Prunus persica]
Length=1009

 Score =   346 bits (888),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 201/226 (89%), Gaps = 4/226 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRN RR++QSNN+VIVALEN+V+G FPVPLGAQIVQLTASG+FEEALALCK
Sbjct  267  PYPLIQTVVLRNARRILQSNNSVIVALENAVYGLFPVPLGAQIVQLTASGDFEEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPE++SLRAAKE SIH+RYAH+L++NG+YE+AMEHFLASQV+ITYVLSLYPSI+LPK+
Sbjct  327  LLPPEEASLRAAKEGSIHMRYAHHLFDNGAYEDAMEHFLASQVDITYVLSLYPSIVLPKT  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDET-DIESKKMSHNTLMAL  190
             ++ EPEK +D+SGD   LSRGSS +SDDME +T  H+LES+E+  +ESKKMSHNTLMAL
Sbjct  387  TMVLEPEKLMDISGDSSYLSRGSSGISDDMEPSTPFHLLESEESAALESKKMSHNTLMAL  446

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY-GTSRSKKTIK  55
            IKFLQKKRY IIEKATAEGTEEVV DAVG++F SY   +R KK  K
Sbjct  447  IKFLQKKRYSIIEKATAEGTEEVVLDAVGNNFASYESNNRFKKLNK  492



>ref|XP_006425673.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
 gb|ESR38913.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
Length=971

 Score =   345 bits (885),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPY LIQT VL+NVR L+ S+NAVIVALENS+FG FPVPLGAQIVQLTASG+FEEALALC
Sbjct  264  VPYALIQTIVLQNVRHLIPSSNAVIVALENSIFGLFPVPLGAQIVQLTASGDFEEALALC  323

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIR+AHYL++ GSYEEAMEHFLASQV+ITY LSLYPSI+LPK
Sbjct  324  KLLPPEDASLRAAKEGSIHIRFAHYLFDTGSYEEAMEHFLASQVDITYALSLYPSIVLPK  383

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDET-DIESKKMSHNTLMA  193
            + V+PEPE+ +D+S D P+LSRGSS +SDDMES+    + E DE   ++SKKMSHNTLMA
Sbjct  384  TTVVPEPERLLDISSDAPSLSRGSSGMSDDMESSPPAQLSELDENATLKSKKMSHNTLMA  443

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIKFLQKKR  IIEKATAEGTEEVV DAVGD+F S+ ++R KK+ K
Sbjct  444  LIKFLQKKRSSIIEKATAEGTEEVVLDAVGDNFTSHDSTRFKKSSK  489



>ref|XP_006425674.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
 ref|XP_006466791.1| PREDICTED: vam6/Vps39-like protein-like [Citrus sinensis]
 gb|ESR38914.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
Length=1004

 Score =   345 bits (885),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPY LIQT VL+NVR L+ S+NAVIVALENS+FG FPVPLGAQIVQLTASG+FEEALALC
Sbjct  264  VPYALIQTIVLQNVRHLIPSSNAVIVALENSIFGLFPVPLGAQIVQLTASGDFEEALALC  323

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIR+AHYL++ GSYEEAMEHFLASQV+ITY LSLYPSI+LPK
Sbjct  324  KLLPPEDASLRAAKEGSIHIRFAHYLFDTGSYEEAMEHFLASQVDITYALSLYPSIVLPK  383

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDET-DIESKKMSHNTLMA  193
            + V+PEPE+ +D+S D P+LSRGSS +SDDMES+    + E DE   ++SKKMSHNTLMA
Sbjct  384  TTVVPEPERLLDISSDAPSLSRGSSGMSDDMESSPPAQLSELDENATLKSKKMSHNTLMA  443

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIKFLQKKR  IIEKATAEGTEEVV DAVGD+F S+ ++R KK+ K
Sbjct  444  LIKFLQKKRSSIIEKATAEGTEEVVLDAVGDNFTSHDSTRFKKSSK  489



>ref|XP_002267514.1| PREDICTED: vam6/Vps39-like protein [Vitis vinifera]
Length=1006

 Score =   345 bits (885),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 198/226 (88%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRN+  L QSNNA++VA++NSV+G FPVPLGAQIVQLTASG+FEEALALC
Sbjct  266  VPYPLIQTVVLRNMCHLHQSNNAILVAVDNSVYGLFPVPLGAQIVQLTASGDFEEALALC  325

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            K+LPPED+SLRAAKE SIHIRYAHYL+ENGSYEEAM+ FLASQV+ITYVLSLYPSI+LPK
Sbjct  326  KMLPPEDASLRAAKEGSIHIRYAHYLFENGSYEEAMDQFLASQVDITYVLSLYPSIVLPK  385

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDETDI-ESKKMSHNTLMA  193
            S V+PEPEK ++   D  +LSRGSS +SDDMES+    +LES+E  + ESKKMSHNTLMA
Sbjct  386  SVVLPEPEKLMENVWDASHLSRGSSGVSDDMESSPPPQLLESEENAVLESKKMSHNTLMA  445

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIKFLQKKRY IIEKATAE TEEVV DAVGD+F SY ++RSKK+ K
Sbjct  446  LIKFLQKKRYNIIEKATAERTEEVVLDAVGDNFASYDSTRSKKSNK  491



>gb|KDP38604.1| hypothetical protein JCGZ_05311 [Jatropha curcas]
Length=1001

 Score =   344 bits (883),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT  L+NVR L+QSNNAVIVAL+NSV+G FPVPLGAQIVQLTASGNFEEAL+LC
Sbjct  263  VPYPLIQTIALQNVRHLIQSNNAVIVALDNSVYGLFPVPLGAQIVQLTASGNFEEALSLC  322

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDS+LRAAKE SIH+RYAHYL++NGSYEEAMEHFLASQV++TYVLSLYPSI+LPK
Sbjct  323  KLLPPEDSNLRAAKEGSIHLRYAHYLFDNGSYEEAMEHFLASQVDMTYVLSLYPSIVLPK  382

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDET-DIESKKMSHNTLMA  193
            ++++ EPEK +D+S D P LSR SS +SDDMES+    + + DE   +ESKKMSHNTLMA
Sbjct  383  TSILLEPEKLMDISSDAPYLSRASSGVSDDMESSLPPQLTDFDEHFSLESKKMSHNTLMA  442

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            L+KFLQKKR  IIEKATAEGTEEVV DAVGD+F  Y +SR KK+ K
Sbjct  443  LVKFLQKKRCSIIEKATAEGTEEVVLDAVGDNFGPYDSSRFKKSSK  488



>ref|XP_007048415.1| Vacuolar sorting protein 39 isoform 2 [Theobroma cacao]
 gb|EOX92572.1| Vacuolar sorting protein 39 isoform 2 [Theobroma cacao]
Length=836

 Score =   340 bits (872),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 189/222 (85%), Gaps = 2/222 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL+N R L++SNNAV+VAL NSV+G FPVPLGAQIVQLTASGNFEEALALC
Sbjct  102  VPYPLIQTIVLQNARHLIKSNNAVVVALNNSVYGLFPVPLGAQIVQLTASGNFEEALALC  161

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIRYAHYL++NG YEEAMEHFLASQV+ITYVLSLYPSI+LPK
Sbjct  162  KLLPPEDASLRAAKEGSIHIRYAHYLFDNGCYEEAMEHFLASQVDITYVLSLYPSIVLPK  221

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT-HILESDET-DIESKKMSHNTLMAL  190
            +  IPEPEK +D+S D   LSRGSS LSDD+E+    + ESDE   +E KKMSHNTLMAL
Sbjct  222  TTAIPEPEKLMDLSLDASQLSRGSSGLSDDLETLLPQLSESDENAALEFKKMSHNTLMAL  281

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKK  64
            IKFLQKKRY I+EKA AEGTEEVV DAVGD+F S    +S K
Sbjct  282  IKFLQKKRYSIVEKAAAEGTEEVVLDAVGDNFSSTRFKKSNK  323



>ref|XP_008344274.1| PREDICTED: vam6/Vps39-like protein [Malus domestica]
Length=1004

 Score =   343 bits (880),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRN RR++QSN+AV VALEN+V+G FPVPLGAQIVQLTASG+F+EALALCK
Sbjct  267  PYPLIQTVVLRNARRILQSNDAVTVALENAVYGLFPVPLGAQIVQLTASGDFDEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            +LPPE++SLRAAKE SIH+RYAH+L++NG+YE+AMEHFLASQV+ITYVLSLYPSIILPK+
Sbjct  327  MLPPEEASLRAAKEGSIHMRYAHHLFDNGAYEDAMEHFLASQVDITYVLSLYPSIILPKT  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME-SNTHILESDET-DIESKKMSHNTLMALI  187
             ++ +PEK +D+SGD   LSRGSS +SDDME S   +LES+E+  +ESKKMSHNTLMALI
Sbjct  387  TMVADPEKLMDISGDSLYLSRGSSGISDDMEHSLPSLLESEESAALESKKMSHNTLMALI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQKKRYGIIEKATAEGTEEVV DAVGD+FVSY  SR KK+ K
Sbjct  447  KFLQKKRYGIIEKATAEGTEEVVLDAVGDNFVSY-ESRFKKSNK  489



>ref|XP_010070055.1| PREDICTED: vam6/Vps39-like protein [Eucalyptus grandis]
 gb|KCW58609.1| hypothetical protein EUGRSUZ_H01269 [Eucalyptus grandis]
Length=1017

 Score =   341 bits (874),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 193/226 (85%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VLRNVR L QS+++++VA +NSV+G FPVP+GAQIVQL ASGNFEEALALC
Sbjct  277  VPYPLIQTVVLRNVRHLAQSSSSLVVAQDNSVYGLFPVPIGAQIVQLMASGNFEEALALC  336

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            K+LPPEDS+LR AKE SIHIRYAHYL+ENGSYEEAMEHFLASQV+ITYVLSLYPSIILPK
Sbjct  337  KMLPPEDSNLRTAKEGSIHIRYAHYLFENGSYEEAMEHFLASQVDITYVLSLYPSIILPK  396

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDE-TDIESKKMSHNTLMA  193
            +A+ PEPEK VD+S D   LSR SS +SDDMES+   H  E DE + +ESKKMSHNTLMA
Sbjct  397  TALAPEPEKLVDISWDTSYLSRASSGVSDDMESSPPPHSQEFDEHSALESKKMSHNTLMA  456

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIKFLQKKR+ IIEKAT EGTEEVV DAVGDS  SY  SR K+T K
Sbjct  457  LIKFLQKKRHSIIEKATTEGTEEVVLDAVGDSVPSYNISRFKRTNK  502



>ref|XP_009371595.1| PREDICTED: vam6/Vps39-like protein [Pyrus x bretschneideri]
Length=1004

 Score =   340 bits (872),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRN  R++QSN AVIVALEN+V+G FPVPLGAQIVQLTASG+F+EALALCK
Sbjct  267  PYPLIQTVVLRNACRILQSNTAVIVALENAVYGLFPVPLGAQIVQLTASGDFDEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            +LPPE++SLRAAKE SIH+RYAH+L++NG+YE+AMEHFLASQV+ITYVLSLYPS++LPK+
Sbjct  327  MLPPEEASLRAAKEASIHMRYAHHLFDNGAYEDAMEHFLASQVDITYVLSLYPSMVLPKT  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME-SNTHILESDET-DIESKKMSHNTLMALI  187
             ++  PEK +D+SGD   LSRGSS LSDDME S   +LES+E+  +ESKKMSHNTLMAL+
Sbjct  387  TMVAVPEKLMDISGDSSYLSRGSSGLSDDMEHSLPSVLESEESAALESKKMSHNTLMALV  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQKKRYGIIEKATAEGTEEVV DAVGD+FVSY  SR KK+ K
Sbjct  447  KFLQKKRYGIIEKATAEGTEEVVLDAVGDNFVSY-ESRFKKSNK  489



>gb|KJB43501.1| hypothetical protein B456_007G203400 [Gossypium raimondii]
Length=936

 Score =   338 bits (867),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 189/225 (84%), Gaps = 5/225 (2%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL   RRL +SNNAV+VALE SV+G FPVPLGAQIVQLTASGNFEEALALC
Sbjct  264  VPYPLIQTIVLPGARRLTKSNNAVVVALEKSVYGLFPVPLGAQIVQLTASGNFEEALALC  323

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIRYAHYL++NG YEEAMEHFLASQV+ITYVLSLY SI+LPK
Sbjct  324  KLLPPEDASLRAAKEGSIHIRYAHYLFDNGCYEEAMEHFLASQVDITYVLSLYQSIVLPK  383

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT-HILESDETD-IESKKMSHNTLMAL  190
            +  +PEPEK  D+S D P LSRGSS +SDD+E+    + ESDE   +E KKMSHNTLMAL
Sbjct  384  TTAVPEPEKLADLSLDAPQLSRGSSGMSDDLETFLPQLAESDENSALEFKKMSHNTLMAL  443

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IKFLQKKRY I+EKA AEGTEEVV DAVGDSF S   SR KK+ K
Sbjct  444  IKFLQKKRYSIVEKAAAEGTEEVVLDAVGDSFTS---SRFKKSNK  485



>ref|XP_007048414.1| Vacuolar sorting protein 39 isoform 1 [Theobroma cacao]
 gb|EOX92571.1| Vacuolar sorting protein 39 isoform 1 [Theobroma cacao]
Length=998

 Score =   339 bits (870),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 189/222 (85%), Gaps = 2/222 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL+N R L++SNNAV+VAL NSV+G FPVPLGAQIVQLTASGNFEEALALC
Sbjct  264  VPYPLIQTIVLQNARHLIKSNNAVVVALNNSVYGLFPVPLGAQIVQLTASGNFEEALALC  323

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIRYAHYL++NG YEEAMEHFLASQV+ITYVLSLYPSI+LPK
Sbjct  324  KLLPPEDASLRAAKEGSIHIRYAHYLFDNGCYEEAMEHFLASQVDITYVLSLYPSIVLPK  383

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT-HILESDET-DIESKKMSHNTLMAL  190
            +  IPEPEK +D+S D   LSRGSS LSDD+E+    + ESDE   +E KKMSHNTLMAL
Sbjct  384  TTAIPEPEKLMDLSLDASQLSRGSSGLSDDLETLLPQLSESDENAALEFKKMSHNTLMAL  443

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKK  64
            IKFLQKKRY I+EKA AEGTEEVV DAVGD+F S    +S K
Sbjct  444  IKFLQKKRYSIVEKAAAEGTEEVVLDAVGDNFSSTRFKKSNK  485



>gb|KHG02853.1| Vam6/Vps39-like protein [Gossypium arboreum]
Length=956

 Score =   338 bits (867),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 190/225 (84%), Gaps = 5/225 (2%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL   RRL +SNNAV+VALE SV+G FPVPLGAQIVQLTASGNFEEALALC
Sbjct  220  VPYPLIQTIVLPGARRLTKSNNAVVVALEKSVYGLFPVPLGAQIVQLTASGNFEEALALC  279

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIRYAHYL++NG YEEAMEHFLASQV+ITYVLSLY SI+LPK
Sbjct  280  KLLPPEDASLRAAKEGSIHIRYAHYLFDNGCYEEAMEHFLASQVDITYVLSLYQSIVLPK  339

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT-HILESDETD-IESKKMSHNTLMAL  190
            +  +PEPEK VD+S D P LSRGSS +SDD+E+    + ESDE   +E KKMSHNTLMAL
Sbjct  340  TTAVPEPEKLVDLSLDAPQLSRGSSGMSDDLETFLPQLSESDENSALEFKKMSHNTLMAL  399

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IKFLQKKRY I+EKA AEGTEEVV DAVGDSF S   SR KK+ K
Sbjct  400  IKFLQKKRYIIVEKAAAEGTEEVVLDAVGDSFTS---SRFKKSNK  441



>gb|KJB43502.1| hypothetical protein B456_007G203400 [Gossypium raimondii]
 gb|KJB43503.1| hypothetical protein B456_007G203400 [Gossypium raimondii]
Length=1000

 Score =   338 bits (868),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 189/225 (84%), Gaps = 5/225 (2%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL   RRL +SNNAV+VALE SV+G FPVPLGAQIVQLTASGNFEEALALC
Sbjct  264  VPYPLIQTIVLPGARRLTKSNNAVVVALEKSVYGLFPVPLGAQIVQLTASGNFEEALALC  323

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIRYAHYL++NG YEEAMEHFLASQV+ITYVLSLY SI+LPK
Sbjct  324  KLLPPEDASLRAAKEGSIHIRYAHYLFDNGCYEEAMEHFLASQVDITYVLSLYQSIVLPK  383

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT-HILESDETD-IESKKMSHNTLMAL  190
            +  +PEPEK  D+S D P LSRGSS +SDD+E+    + ESDE   +E KKMSHNTLMAL
Sbjct  384  TTAVPEPEKLADLSLDAPQLSRGSSGMSDDLETFLPQLAESDENSALEFKKMSHNTLMAL  443

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IKFLQKKRY I+EKA AEGTEEVV DAVGDSF S   SR KK+ K
Sbjct  444  IKFLQKKRYSIVEKAAAEGTEEVVLDAVGDSFTS---SRFKKSNK  485



>ref|XP_011003738.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
Length=1008

 Score =   338 bits (867),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 196/226 (87%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQ  VL+NVR L++SNN +IVAL NSV   FPVPLGAQIVQLTASGNFEEALALC
Sbjct  268  VPYPLIQAFVLQNVRHLIESNNVIIVALSNSVCVLFPVPLGAQIVQLTASGNFEEALALC  327

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDS+LRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQV+I YVLSLYPSI+LPK
Sbjct  328  KLLPPEDSNLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQVDIIYVLSLYPSIVLPK  387

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDE-TDIESKKMSHNTLMA  193
            +++IPEPEK +D+S D P LSRGSS LSD ME +   H+ + DE + +ESKKMSHNTLMA
Sbjct  388  TSLIPEPEKLIDISQDAPYLSRGSSGLSDIMEPSPPIHLSDFDEHSALESKKMSHNTLMA  447

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIK+LQK+R+GI+EKATAEGT+EVV DAVGD++  Y ++R KK+ K
Sbjct  448  LIKYLQKRRFGIVEKATAEGTDEVVLDAVGDNYGPYDSNRFKKSNK  493



>ref|XP_006411980.1| hypothetical protein EUTSA_v10024305mg [Eutrema salsugineum]
 gb|ESQ53433.1| hypothetical protein EUTSA_v10024305mg [Eutrema salsugineum]
Length=1002

 Score =   338 bits (866),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+RRLV+SNNAVIV L+NSV   FPV +GAQIVQLTASGNFEEALALCK
Sbjct  262  PYPLIQTIVLQNIRRLVKSNNAVIVGLDNSVHVLFPVSIGAQIVQLTASGNFEEALALCK  321

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPE+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILPK+
Sbjct  322  LLPPEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPKT  381

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILES-DETDIESKKMSHNTLMAL  190
             +IP+P+K VD+SGD  +LSRGSS +SDDM+S++  + LES D  D+ESKKMSHNTLMAL
Sbjct  382  TIIPQPDKMVDISGDEASLSRGSSGMSDDMDSSSPRYYLESEDNADLESKKMSHNTLMAL  441

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY  85
            IK+LQKKR GIIEKAT+EGTEEV+SDAVG ++ +Y
Sbjct  442  IKYLQKKRPGIIEKATSEGTEEVISDAVGKTYGAY  476



>ref|XP_011025779.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
 ref|XP_011025780.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
 ref|XP_011025781.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
Length=1001

 Score =   337 bits (865),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 192/223 (86%), Gaps = 2/223 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPY LIQ  VL+NVR L++SNNA+IVAL NSV   FPVPLGAQIVQLTASGNFEEALALC
Sbjct  268  VPYSLIQAVVLQNVRHLIESNNAIIVALSNSVCALFPVPLGAQIVQLTASGNFEEALALC  327

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDS+LRAAKE SIHIRYAHYL++NGSYEEAME FLASQV+ITYVLSLYPS++LPK
Sbjct  328  KLLPPEDSNLRAAKEGSIHIRYAHYLFDNGSYEEAMEQFLASQVDITYVLSLYPSVVLPK  387

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESKKMSHNTLMALIK  184
            ++++PEPEK +DMS D P LSRGSS LSDDMES+      + + +ESKKMSHNTL ALIK
Sbjct  388  TSMVPEPEKLIDMSPDVPYLSRGSSGLSDDMESSPDF--DEHSALESKKMSHNTLKALIK  445

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +LQK+RY IIEKATAE T+EVV DAVGD++ +Y +SR KK+ K
Sbjct  446  YLQKRRYSIIEKATAEVTDEVVLDAVGDNYGAYDSSRFKKSSK  488



>ref|XP_010548331.1| PREDICTED: vam6/Vps39-like protein [Tarenaya hassleriana]
Length=1000

 Score =   336 bits (861),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 194/224 (87%), Gaps = 3/224 (1%)
 Frame = -2

Query  717  YPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKL  538
            YPLIQT VL+NVR LV+SNNAVIV L+NSV+  FPV LGAQIVQLTASGNFEEALALCKL
Sbjct  263  YPLIQTIVLQNVRHLVKSNNAVIVGLDNSVYVLFPVSLGAQIVQLTASGNFEEALALCKL  322

Query  537  LPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSA  358
            LPPEDSSLRAAKE SIH+RYAHYL++NGSYEEAME FLASQV+ITYVLSLY SI+LPK+ 
Sbjct  323  LPPEDSSLRAAKESSIHVRYAHYLFDNGSYEEAMEQFLASQVDITYVLSLYQSIVLPKTT  382

Query  357  VIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILES-DETDIESKKMSHNTLMALI  187
            ++P+PEK VD++GD   LSRGSS +SDDMES +  ++ ES D + +ESKKMSHNTLMALI
Sbjct  383  IVPQPEKMVDITGDEAPLSRGSSGISDDMESTSPLYLFESEDNSALESKKMSHNTLMALI  442

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQK+R  IIEKATAEGTEE VSDAVGD++  Y +S+ KK+ K
Sbjct  443  KYLQKRRQSIIEKATAEGTEEAVSDAVGDTYGVYDSSKFKKSTK  486



>ref|XP_003537587.1| PREDICTED: vam6/Vps39-like protein-like [Glycine max]
Length=989

 Score =   334 bits (856),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 194/225 (86%), Gaps = 6/225 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QSN++VI+AL+NS+ G +PVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  257  PYPLIQTVVLRNVRHLCQSNDSVILALDNSIHGLYPVPLGAQIVQLTASGNFEEALSLCK  316

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQ+EITYVLSLYPSIILPK+
Sbjct  317  LLPPEDSSLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQIEITYVLSLYPSIILPKT  376

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME--SNTHILESDET-DIESKKMSHNTLMAL  190
             ++ +PEK +D+ GD   LSR SS +SDDME  S +H+ ESDE   +ESKKM+HN LMAL
Sbjct  377  TIVYDPEK-LDIYGDASYLSRASSGVSDDMEPSSTSHMPESDENAALESKKMNHNMLMAL  435

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IK+LQKKR+  IEKATAEGTEEVV DAVGD+F SY  +R KKT K
Sbjct  436  IKYLQKKRFSFIEKATAEGTEEVVFDAVGDNFASY--NRLKKTNK  478



>gb|KHN41977.1| Vam6/Vps39-like protein [Glycine soja]
Length=988

 Score =   333 bits (855),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 194/225 (86%), Gaps = 6/225 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QSN++VI+AL+NS+ G +PVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  256  PYPLIQTVVLRNVRHLCQSNDSVILALDNSIHGLYPVPLGAQIVQLTASGNFEEALSLCK  315

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQ+EITYVLSLYPSIILPK+
Sbjct  316  LLPPEDSSLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQIEITYVLSLYPSIILPKT  375

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME--SNTHILESDET-DIESKKMSHNTLMAL  190
             ++ +PEK +D+ GD   LSR SS +SDDME  S +H+ ESDE   +ESKKM+HN LMAL
Sbjct  376  TIVYDPEK-LDIYGDASYLSRASSGVSDDMEPSSTSHMPESDENAALESKKMNHNMLMAL  434

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IK+LQKKR+  IEKATAEGTEEVV DAVGD+F SY  +R KKT K
Sbjct  435  IKYLQKKRFSFIEKATAEGTEEVVFDAVGDNFASY--NRLKKTNK  477



>gb|KHN36129.1| Vam6/Vps39-like protein [Glycine soja]
Length=945

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 193/225 (86%), Gaps = 6/225 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QSN++ I+AL+NS+ G FPVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  212  PYPLIQTVVLRNVRHLCQSNDSTILALDNSIHGLFPVPLGAQIVQLTASGNFEEALSLCK  271

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQ+EITYVLSLYPSIILPK+
Sbjct  272  LLPPEDSSLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQIEITYVLSLYPSIILPKT  331

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME--SNTHILESDET-DIESKKMSHNTLMAL  190
             ++ +PEK +D+ GD   LSR SS +SDDME  S +H+ E DE+  +ESKKM+HN LMAL
Sbjct  332  TIVHDPEK-LDIYGDASYLSRASSGVSDDMEPPSTSHMSEFDESAALESKKMNHNMLMAL  390

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IK+LQKKR+  IEKATAEGTEEVV DAVGD+F SY  +R KKT K
Sbjct  391  IKYLQKKRFSFIEKATAEGTEEVVLDAVGDNFASY--NRLKKTNK  433



>ref|XP_007046945.1| Vacuolar sorting protein 39 [Theobroma cacao]
 gb|EOX91102.1| Vacuolar sorting protein 39 [Theobroma cacao]
Length=919

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 190/228 (83%), Gaps = 9/228 (4%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL+N   L++SNNAVIVALENSV G FPVPLGAQIVQLTA GNFEEALALC
Sbjct  232  VPYPLIQTIVLQNACHLIKSNNAVIVALENSVCGLFPVPLGAQIVQLTAYGNFEEALALC  291

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPED+SLRAAKE SIHIRYAHYL++NG YEEAMEHFLASQ++ITYVL+LYPSI+LPK
Sbjct  292  KLLPPEDASLRAAKEGSIHIRYAHYLFDNGCYEEAMEHFLASQIDITYVLTLYPSIVLPK  351

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETD----IESKKMSHNTLM  196
            +  +PEPEK +D+S D   LSRGSS LSDD+E  T   +S E+D    +E KKMSHNTLM
Sbjct  352  TTTVPEPEKLLDLSLDASQLSRGSSGLSDDLE--TFFPQSSESDENAALEFKKMSHNTLM  409

Query  195  ALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIKV  52
            ALIKFLQKKR+ ++EKA AEGTEEVV DAVGD F S   +R KK+ KV
Sbjct  410  ALIKFLQKKRFSVLEKAAAEGTEEVVLDAVGDDFTS---ARFKKSNKV  454



>ref|XP_010432158.1| PREDICTED: vam6/Vps39-like protein [Camelina sativa]
Length=1000

 Score =   333 bits (854),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 194/215 (90%), Gaps = 3/215 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+RRLV+SNNAVIV L+NSV+  FPV +GAQIVQLTASGNFEEALALCK
Sbjct  260  PYPLIQTIVLQNIRRLVKSNNAVIVGLDNSVYVLFPVSIGAQIVQLTASGNFEEALALCK  319

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPE+SSLRAAKE SIH R+AHYL++NGSYEEAMEHFLASQV+IT+VLS+YPSI+LPK+
Sbjct  320  LLPPEESSLRAAKESSIHTRFAHYLFDNGSYEEAMEHFLASQVDITHVLSMYPSIVLPKT  379

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDETD-IESKKMSHNTLMAL  190
             +IP+PEK VD+SGD  +LSRGSS +SDDMES++  + LES++ + +ESKKMSHNTLMAL
Sbjct  380  TIIPQPEKMVDVSGDEASLSRGSSGISDDMESSSPRYFLESEDNEALESKKMSHNTLMAL  439

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY  85
            IK+LQK+R  IIEKAT+EGTEEV+SDAVG ++ +Y
Sbjct  440  IKYLQKRRPAIIEKATSEGTEEVISDAVGKTYGAY  474



>ref|XP_003517237.2| PREDICTED: vam6/Vps39-like protein-like [Glycine max]
Length=1015

 Score =   333 bits (853),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 193/225 (86%), Gaps = 6/225 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QSN++ I+AL+NS+ G FPVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  282  PYPLIQTVVLRNVRHLCQSNDSTILALDNSIHGLFPVPLGAQIVQLTASGNFEEALSLCK  341

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQ+EITYVLSLYPSIILPK+
Sbjct  342  LLPPEDSSLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQIEITYVLSLYPSIILPKT  401

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME--SNTHILESDET-DIESKKMSHNTLMAL  190
             ++ +PEK +D+ GD   LSR SS +SDDME  S +H+ E DE+  +ESKKM+HN LMAL
Sbjct  402  TIVHDPEK-LDIYGDASYLSRASSGVSDDMEPPSTSHMSEFDESAALESKKMNHNMLMAL  460

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IK+LQKKR+  IEKATAEGTEEVV DAVGD+F SY  +R KKT K
Sbjct  461  IKYLQKKRFSFIEKATAEGTEEVVLDAVGDNFASY--NRLKKTNK  503



>ref|XP_002867003.1| hypothetical protein ARALYDRAFT_490975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43262.1| hypothetical protein ARALYDRAFT_490975 [Arabidopsis lyrata subsp. 
lyrata]
Length=1000

 Score =   332 bits (851),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+RRLV+SNNAVIV L+NSV+  FPV +GAQIVQLTASGNFEEALALCK
Sbjct  260  PYPLIQTIVLQNIRRLVKSNNAVIVGLDNSVYVLFPVSIGAQIVQLTASGNFEEALALCK  319

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            +LPPE+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILPK+
Sbjct  320  VLPPEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPKT  379

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILES-DETDIESKKMSHNTLMAL  190
             +IP+P+K VD+SGD  +LSRGSS +SDDMES++  + LES D T +ESKKMS+NTLMAL
Sbjct  380  TIIPQPDKMVDISGDEASLSRGSSGISDDMESSSPRYFLESEDNTALESKKMSYNTLMAL  439

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY  85
            IK+LQK+R  +IEKAT+EGTEEV+SDAVG S+ +Y
Sbjct  440  IKYLQKRRPAVIEKATSEGTEEVISDAVGKSYGAY  474



>ref|XP_006383195.1| hypothetical protein POPTR_0005s12470g [Populus trichocarpa]
 gb|ERP60992.1| hypothetical protein POPTR_0005s12470g [Populus trichocarpa]
Length=1008

 Score =   330 bits (847),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 194/226 (86%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPY LIQ  VL+NVR L++SNNA+IVAL NSV   FPVPLGAQIVQLTASGNFEEALALC
Sbjct  268  VPYSLIQAFVLQNVRHLIESNNAIIVALSNSVRALFPVPLGAQIVQLTASGNFEEALALC  327

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPPEDS+LRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQV+I YVLSLYPSI+LPK
Sbjct  328  KLLPPEDSNLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQVDIIYVLSLYPSIVLPK  387

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDE-TDIESKKMSHNTLMA  193
            ++++PE +K +D+S D P LSRGS  LSD ME +   H+ + DE + +ESKKMSHNTLMA
Sbjct  388  TSLVPERQKLIDISQDAPYLSRGSCGLSDIMEPSPPIHLSDFDEHSALESKKMSHNTLMA  447

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIK+LQK+R+GI+EKATAEGT+EVV DAVGD++  Y ++R KK+ K
Sbjct  448  LIKYLQKRRFGIVEKATAEGTDEVVLDAVGDNYGPYDSNRFKKSNK  493



>ref|XP_006283063.1| hypothetical protein CARUB_v10004058mg [Capsella rubella]
 gb|EOA15961.1| hypothetical protein CARUB_v10004058mg [Capsella rubella]
Length=1000

 Score =   330 bits (846),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 192/215 (89%), Gaps = 3/215 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+RRLV+SNNAVIV L+NSV+  FPV +GAQIVQLTASGNFEEALALCK
Sbjct  260  PYPLIQTIVLQNIRRLVKSNNAVIVGLDNSVYVLFPVSIGAQIVQLTASGNFEEALALCK  319

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLP E+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILPK+
Sbjct  320  LLPSEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPKT  379

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDETD-IESKKMSHNTLMAL  190
             +IP+P+K VD+SGD  +LSRGSS +SDDMES +  + LES++ + +ESKKMSHNTLMAL
Sbjct  380  TIIPQPDKMVDISGDEASLSRGSSGISDDMESTSPRYFLESEDNEALESKKMSHNTLMAL  439

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY  85
            IK+LQK+R  IIEKAT+EGTEEV+SDAVG ++ +Y
Sbjct  440  IKYLQKRRPAIIEKATSEGTEEVISDAVGKTYGAY  474



>ref|NP_195381.6| protein EMBRYO DEFECTIVE 2754 [Arabidopsis thaliana]
 gb|AAM20730.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86679.1| vacuolar sorting protein 39 [Arabidopsis thaliana]
Length=1000

 Score =   328 bits (842),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 190/212 (90%), Gaps = 3/212 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+RRLV+SNNAVIV L+NSV+  FPV +GAQIVQLTASGNFEEALALCK
Sbjct  260  PYPLIQTIVLQNIRRLVKSNNAVIVGLDNSVYVLFPVSIGAQIVQLTASGNFEEALALCK  319

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            +LPP++SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILPK+
Sbjct  320  VLPPDESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPKT  379

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILES-DETDIESKKMSHNTLMAL  190
             +IP+P+K VD+SGD  +LSRGSS +SDDMES++  + LES D  D+ESKKMSHNTLMAL
Sbjct  380  TIIPQPDKMVDISGDEASLSRGSSGISDDMESSSPRYFLESEDNADLESKKMSHNTLMAL  439

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
            IK+L K+R  +IEKAT+EGTEEV+SDAVG ++
Sbjct  440  IKYLLKRRPAVIEKATSEGTEEVISDAVGKTY  471



>ref|XP_010446769.1| PREDICTED: vam6/Vps39-like protein [Camelina sativa]
Length=1000

 Score =   328 bits (842),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 192/215 (89%), Gaps = 3/215 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+RRLV+SNNAVI+ L+NSV   FPV +GAQIVQLTASGNFEEALALCK
Sbjct  260  PYPLIQTIVLQNIRRLVKSNNAVIIGLDNSVCVLFPVSIGAQIVQLTASGNFEEALALCK  319

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPE+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILP++
Sbjct  320  LLPPEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPQT  379

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDETD-IESKKMSHNTLMAL  190
             +IP+PEK VD+SGD  +LSRGSS + DDMES++  + LES++ + +ESKKMSHNTLMAL
Sbjct  380  TIIPKPEKMVDISGDEESLSRGSSGILDDMESSSPRYFLESEDNEALESKKMSHNTLMAL  439

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY  85
            IK+LQK+R  IIEKAT+EGTEEV+SDAVG ++ +Y
Sbjct  440  IKYLQKRRPAIIEKATSEGTEEVISDAVGKTYGAY  474



>ref|XP_007156942.1| hypothetical protein PHAVU_002G030300g [Phaseolus vulgaris]
 gb|ESW28936.1| hypothetical protein PHAVU_002G030300g [Phaseolus vulgaris]
Length=989

 Score =   328 bits (841),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 192/225 (85%), Gaps = 6/225 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QSN+++I+AL+NS+ G FPVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  256  PYPLIQTVVLRNVRHLCQSNDSMILALDNSIHGLFPVPLGAQIVQLTASGNFEEALSLCK  315

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL+ENGSYEEAMEHFLASQV+IT+VLSLYPSIILP +
Sbjct  316  LLPPEDSSLRAAKEGSIHIRYAHYLFENGSYEEAMEHFLASQVDITHVLSLYPSIILPNT  375

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME--SNTHILESDET-DIESKKMSHNTLMAL  190
             ++ E EK +D+ GD   LSR SS +SDD+E  S +H+ ESDE   +ESKKM+HN LMAL
Sbjct  376  TIVHELEK-LDIDGDASYLSRASSGVSDDLEPSSTSHMSESDENAALESKKMNHNMLMAL  434

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IK+LQKKRY  IEKATAEGTEEVV DAVGD+F SY  +R KK+ K
Sbjct  435  IKYLQKKRYSFIEKATAEGTEEVVLDAVGDNFASY--NRLKKSNK  477



>ref|XP_010679721.1| PREDICTED: vam6/Vps39-like protein [Beta vulgaris subsp. vulgaris]
Length=1005

 Score =   328 bits (842),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L++SN+ ++VALE SV G FPVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  269  PYPLIQTVVLRNVRHLIRSNDTILVALEKSVHGLFPVPLGAQIVQLTASGNFEEALSLCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIH+RYAHYL+ENGSYEEAMEHF+ASQV+ITYVLSLYPSII+P+S
Sbjct  329  LLPPEDSSLRAAKESSIHVRYAHYLFENGSYEEAMEHFVASQVDITYVLSLYPSIIVPRS  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDETDIESKKMSHNTLMALI  187
            + +PE EK +D   D  +LSR SS LSDDME++   HI   +  D+ESK +SHNTLMA I
Sbjct  389  SALPEQEKVIDFGLDASDLSRCSSGLSDDMEASPRAHIELEENADMESKIVSHNTLMAFI  448

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQKKR+ IIEKA AEGT+E VSDA G +F S+ ++R KK+ K
Sbjct  449  KFLQKKRFNIIEKAAAEGTDEAVSDAFGANFKSFDSNRPKKSNK  492



>ref|XP_009138434.1| PREDICTED: vam6/Vps39-like protein [Brassica rapa]
Length=993

 Score =   327 bits (839),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 193/223 (87%), Gaps = 3/223 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+R LV+SNNAVIV L+NSV   FPV +GAQIVQLTASGNFEEALALCK
Sbjct  256  PYPLIQTIVLQNIRHLVKSNNAVIVGLDNSVHALFPVSIGAQIVQLTASGNFEEALALCK  315

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLP E+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILPK+
Sbjct  316  LLPSEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPKT  375

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDI-ESKKMSHNTLMALIK  184
             +IP P+K +D+SG+  +LSRGSS  SDDMES+   LES+   + ESKKMSHNTLMALIK
Sbjct  376  TMIPPPDKMLDISGEEASLSRGSSGFSDDMESS--FLESEGNAVLESKKMSHNTLMALIK  433

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +LQKKR  IIEKAT+EGTEEV+SDAVG ++ +Y +S++KK+ K
Sbjct  434  YLQKKRPSIIEKATSEGTEEVISDAVGKTYGAYDSSKTKKSNK  476



>gb|KGN53245.1| hypothetical protein Csa_4G038630 [Cucumis sativus]
Length=970

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 181/210 (86%), Gaps = 3/210 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PY LIQT VLRN R L+ S +A++V L+NS +G FPVPLGAQIVQLTASGNFEEALALCK
Sbjct  269  PYALIQTIVLRNGRHLIDSKHALVVGLDNSAYGLFPVPLGAQIVQLTASGNFEEALALCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLR+AKE SIHIRYAHYL++NGSYEEAMEHFLASQV+ITYVL +YPSI+LPK+
Sbjct  329  LLPPEDSSLRSAKESSIHIRYAHYLFDNGSYEEAMEHFLASQVDITYVLPIYPSIVLPKT  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDE-TDIESKKMSHNTLMALIK  184
             ++ E EK VD+  D P+LSR SS  SDDMES  H LESDE T +ESKKM+HNTLMALIK
Sbjct  389  TLVTETEKLVDL--DDPHLSRASSGFSDDMESPLHQLESDENTSLESKKMNHNTLMALIK  446

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
            FLQKKR+ IIEKATAEGTEEVV DAVGD F
Sbjct  447  FLQKKRHNIIEKATAEGTEEVVLDAVGDRF  476



>emb|CDY42696.1| BnaA03g53490D [Brassica napus]
Length=993

 Score =   326 bits (836),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 193/223 (87%), Gaps = 3/223 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+R LV+SNNAVIV L+NSV   FPV +GAQIVQLTASGNFEEALALCK
Sbjct  256  PYPLIQTIVLQNIRHLVKSNNAVIVGLDNSVHALFPVSIGAQIVQLTASGNFEEALALCK  315

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLP E+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSI+LPK+
Sbjct  316  LLPSEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSILLPKT  375

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESD-ETDIESKKMSHNTLMALIK  184
             +IP P+K +D+SG+  +LSRGSS  SDDMES+   LES+    +ESKKMSHNTLMALIK
Sbjct  376  TMIPPPDKMLDISGEEASLSRGSSGFSDDMESS--FLESEGNAALESKKMSHNTLMALIK  433

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +LQKKR  IIEKAT+EGTEEV+SDAVG ++ +Y +S++KK+ K
Sbjct  434  YLQKKRPSIIEKATSEGTEEVISDAVGKTYGAYDSSKTKKSNK  476



>ref|XP_004149149.1| PREDICTED: vam6/Vps39-like protein-like [Cucumis sativus]
Length=996

 Score =   326 bits (836),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 181/210 (86%), Gaps = 3/210 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PY LIQT VLRN R L+ S +A++V L+NS +G FPVPLGAQIVQLTASGNFEEALALCK
Sbjct  269  PYALIQTIVLRNGRHLIDSKHALVVGLDNSAYGLFPVPLGAQIVQLTASGNFEEALALCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLR+AKE SIHIRYAHYL++NGSYEEAMEHFLASQV+ITYVL +YPSI+LPK+
Sbjct  329  LLPPEDSSLRSAKESSIHIRYAHYLFDNGSYEEAMEHFLASQVDITYVLPIYPSIVLPKT  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDE-TDIESKKMSHNTLMALIK  184
             ++ E EK VD+  D P+LSR SS  SDDMES  H LESDE T +ESKKM+HNTLMALIK
Sbjct  389  TLVTETEKLVDL--DDPHLSRASSGFSDDMESPLHQLESDENTSLESKKMNHNTLMALIK  446

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
            FLQKKR+ IIEKATAEGTEEVV DAVGD F
Sbjct  447  FLQKKRHNIIEKATAEGTEEVVLDAVGDRF  476



>ref|XP_004509258.1| PREDICTED: vam6/Vps39-like protein-like isoform X2 [Cicer arietinum]
Length=993

 Score =   326 bits (835),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT V RNVR L QSNN+VI+ALENSV G FPVPLGAQIVQLTA+GNFEEAL+LCK
Sbjct  261  PYPLIQTVVFRNVRHLRQSNNSVIIALENSVHGLFPVPLGAQIVQLTAAGNFEEALSLCK  320

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRYAHYL++NGSYEE+MEHFLASQV+IT+VLSLY SIILPK+
Sbjct  321  LLPPEDSNLRAAKEGSIHIRYAHYLFDNGSYEESMEHFLASQVDITHVLSLYTSIILPKT  380

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDE-TDIESKKMSHNTLMAL  190
             ++ + +K +D+ GD   LSRGSS++SDDME +  +++ ESD+ +++ESKKMS+N LMAL
Sbjct  381  TIVHDSDK-LDIFGDALYLSRGSSAMSDDMEPSPASNMSESDDNSELESKKMSYNMLMAL  439

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IKFLQKKR+GIIEKATAEGTEEVV DAVG++F +Y ++R KK  K
Sbjct  440  IKFLQKKRHGIIEKATAEGTEEVVFDAVGNNFATYNSNRFKKINK  484



>ref|XP_004509257.1| PREDICTED: vam6/Vps39-like protein-like isoform X1 [Cicer arietinum]
Length=1028

 Score =   326 bits (836),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT V RNVR L QSNN+VI+ALENSV G FPVPLGAQIVQLTA+GNFEEAL+LCK
Sbjct  261  PYPLIQTVVFRNVRHLRQSNNSVIIALENSVHGLFPVPLGAQIVQLTAAGNFEEALSLCK  320

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRYAHYL++NGSYEE+MEHFLASQV+IT+VLSLY SIILPK+
Sbjct  321  LLPPEDSNLRAAKEGSIHIRYAHYLFDNGSYEESMEHFLASQVDITHVLSLYTSIILPKT  380

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDE-TDIESKKMSHNTLMAL  190
             ++ + +K +D+ GD   LSRGSS++SDDME +  +++ ESD+ +++ESKKMS+N LMAL
Sbjct  381  TIVHDSDK-LDIFGDALYLSRGSSAMSDDMEPSPASNMSESDDNSELESKKMSYNMLMAL  439

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IKFLQKKR+GIIEKATAEGTEEVV DAVG++F +Y ++R KK  K
Sbjct  440  IKFLQKKRHGIIEKATAEGTEEVVFDAVGNNFATYNSNRFKKINK  484



>emb|CAN61039.1| hypothetical protein VITISV_018673 [Vitis vinifera]
Length=1941

 Score =   332 bits (852),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 200/257 (78%), Gaps = 32/257 (12%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQ-----------------  595
            VPYPLIQT VLRN+  L QSNNA++VA++NSV+G FPVPLGAQ                 
Sbjct  266  VPYPLIQTVVLRNMCHLHQSNNAILVAVDNSVYGLFPVPLGAQVCTDVXSTVTHLTFSCL  325

Query  594  ------------IVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGS  451
                        IVQLTASG+FEEALALCK+LPPED+SLRAAKE SIHIRYAHYL+ENGS
Sbjct  326  IXSCVFGLRLFMIVQLTASGDFEEALALCKMLPPEDASLRAAKEGSIHIRYAHYLFENGS  385

Query  450  YEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDM  271
            YEEAM+ FLASQV+ITYVLSLYPSI+LPKS V+PEPEK ++   D  +LSRGSS +SDDM
Sbjct  386  YEEAMDQFLASQVDITYVLSLYPSIVLPKSVVLPEPEKLMENVWDASHLSRGSSGVSDDM  445

Query  270  ESN--THILESDETDI-ESKKMSHNTLMALIKFLQKKRYGIIEKATAEGTEEVVSDAVGD  100
            ES+    +LES+E  + ESKKMSHNTLMALIKFLQKKRY IIEKATAE TEEVV DAVGD
Sbjct  446  ESSPPPQLLESEENAVLESKKMSHNTLMALIKFLQKKRYNIIEKATAERTEEVVLDAVGD  505

Query  99   SFVSYGTSRSKKTIKVA  49
            +F SY ++RSKK+ K+A
Sbjct  506  NFASYDSTRSKKSNKLA  522



>ref|XP_010263662.1| PREDICTED: vam6/Vps39-like protein [Nelumbo nucifera]
 ref|XP_010263664.1| PREDICTED: vam6/Vps39-like protein [Nelumbo nucifera]
Length=1004

 Score =   325 bits (832),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 189/225 (84%), Gaps = 3/225 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPL+QT VLRNV  L+QSNN+VIVAL +S+ G FPVP+GAQI+QLTASGNFEEAL LCK
Sbjct  269  PYPLVQTVVLRNVHHLLQSNNSVIVALNSSIHGLFPVPIGAQIIQLTASGNFEEALTLCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPED++LRAAKE SIHIRY HYL++NG+YEEAME FLASQVEITYVL+LYPSIILPKS
Sbjct  329  LLPPEDANLRAAKESSIHIRYGHYLFDNGNYEEAMEQFLASQVEITYVLALYPSIILPKS  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDET-DIESKKMSHNTLMAL  190
             VI E +   + + D  +LSR SS  SDDMES++  H++ESDET  +ESKKMSHNTLMAL
Sbjct  389  EVISEMQNVPEFTWDGSHLSRVSSDASDDMESSSPLHLVESDETATLESKKMSHNTLMAL  448

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            IKFLQKKRY I+E+AT EGTEEVVSDAVGD  ++Y  +R K + K
Sbjct  449  IKFLQKKRYNILERATIEGTEEVVSDAVGDGHIAYDLNRPKSSNK  493



>emb|CDX72591.1| BnaC07g46130D [Brassica napus]
Length=997

 Score =   324 bits (831),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 192/223 (86%), Gaps = 3/223 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+R LV+SNNAV+V L+NSV   FPV +GAQIVQLTASGNFEEALALCK
Sbjct  260  PYPLIQTIVLQNIRHLVKSNNAVMVGLDNSVHALFPVSIGAQIVQLTASGNFEEALALCK  319

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLP E+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSI LPK+
Sbjct  320  LLPSEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSITLPKT  379

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESD-ETDIESKKMSHNTLMALIK  184
             +IP P+K +D+SG+  +LSRGSS  SDDMES+   LES+    +ESKKMSHNTLMALIK
Sbjct  380  TMIPPPDKMLDISGEEASLSRGSSGFSDDMESS--FLESEGNAALESKKMSHNTLMALIK  437

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +LQKKR  IIEKAT+EGTEEV+SDAVG ++ +Y +S++KK+ K
Sbjct  438  YLQKKRPSIIEKATSEGTEEVISDAVGKTYGAYDSSKTKKSNK  480



>ref|XP_004165852.1| PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-like protein-like 
[Cucumis sativus]
Length=996

 Score =   324 bits (831),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 180/210 (86%), Gaps = 3/210 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PY LIQT VLRN R L+ S +A++V L+NS +G FPVPLGAQIVQLTASGNFEEALALCK
Sbjct  269  PYALIQTIVLRNGRHLIDSKHALVVGLDNSAYGLFPVPLGAQIVQLTASGNFEEALALCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLR+AKE SIHIRYAHYL++NGSYEEAMEHFLASQV+ITYVL +YPSI+LPK+
Sbjct  329  LLPPEDSSLRSAKESSIHIRYAHYLFDNGSYEEAMEHFLASQVDITYVLPIYPSIVLPKT  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDE-TDIESKKMSHNTLMALIK  184
             ++ E EK VD+  D P+LSR SS  SDDMES  H LESDE T +E KKM+HNTLMALIK
Sbjct  389  TLVTETEKLVDL--DDPHLSRASSGFSDDMESPLHQLESDENTSLEXKKMNHNTLMALIK  446

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
            FLQKKR+ IIEKATAEGTEEVV DAVGD F
Sbjct  447  FLQKKRHNIIEKATAEGTEEVVLDAVGDRF  476



>ref|XP_008453745.1| PREDICTED: vam6/Vps39-like protein [Cucumis melo]
Length=997

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 182/211 (86%), Gaps = 4/211 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PY LIQT VLRN R L+ S +A++V L+NS +G FPVPLGAQIVQLTASGNFEEALALCK
Sbjct  269  PYALIQTIVLRNGRHLIDSKHALVVGLDNSAYGLFPVPLGAQIVQLTASGNFEEALALCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLR+AKE SIHIRYAHYL++NGSYEEAMEHFLASQV+ITYVL  YPSI+LPK+
Sbjct  329  LLPPEDSSLRSAKESSIHIRYAHYLFDNGSYEEAMEHFLASQVDITYVLPFYPSIVLPKT  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTH-ILESDE-TDIESKKMSHNTLMALI  187
             ++ E EK VD+  D P+LSRGSS  SDDMES  H +LESDE T +ESKK++HNTLMALI
Sbjct  389  TLVTETEKLVDL--DDPHLSRGSSGFSDDMESPVHQLLESDENTSLESKKVNHNTLMALI  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
            KFLQKKR+ IIEKATAEGTEEVV DAVGD +
Sbjct  447  KFLQKKRHSIIEKATAEGTEEVVLDAVGDRY  477



>gb|KEH27560.1| vam6/Vps39-like protein [Medicago truncatula]
Length=749

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 186/223 (83%), Gaps = 8/223 (4%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QS+N+VI+AL+NS+ G FPVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  24   PYPLIQTIVLRNVRHLCQSSNSVILALDNSIQGLFPVPLGAQIVQLTASGNFEEALSLCK  83

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL+ENGSYEEA+EHFL SQV+ITYVLSLYPSIILPK+
Sbjct  84   LLPPEDSSLRAAKEGSIHIRYAHYLFENGSYEEAVEHFLESQVDITYVLSLYPSIILPKT  143

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDET-DIESKKMSHNTLMALIK  184
             ++ EPEK +D+ GD   LSR SS +SDDME     L +DE   +ESKK +HN LMALIK
Sbjct  144  TIVHEPEK-LDIDGDASYLSRVSSGVSDDMEP----LPTDENAALESKKTNHNMLMALIK  198

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +LQKKR   IEKATAEGTEEVV DAVGD++ SY  +R KK  K
Sbjct  199  YLQKKRGNFIEKATAEGTEEVVLDAVGDNYASY--NRFKKANK  239



>ref|XP_010437326.1| PREDICTED: vam6/Vps39-like protein [Camelina sativa]
Length=999

 Score =   321 bits (823),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+RRLV+SNNAVIV L+NSV   FPV +GAQIVQLTASGNFEEALALCK
Sbjct  260  PYPLIQTIVLQNIRRLVKSNNAVIVGLDNSVHVLFPVSIGAQIVQLTASGNFEEALALCK  319

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLP E+SSLRAAKE SIH R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILP++
Sbjct  320  LLPSEESSLRAAKESSIHTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPQT  379

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESDETD-IESKKMSHNTLMAL  190
             +IP+PEK +D+SGD   LSRGSS +SDDMES++  + LES++ + +ESKKMSHNTLMAL
Sbjct  380  TIIPQPEK-MDISGDEAYLSRGSSGISDDMESSSPRYFLESEDNEALESKKMSHNTLMAL  438

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY  85
            IK+LQK+R  IIEKAT+EGTEEV+SDAVG ++ +Y
Sbjct  439  IKYLQKRRPAIIEKATSEGTEEVISDAVGKTYGAY  473



>gb|AET03930.2| vam6/Vps39-like protein [Medicago truncatula]
Length=992

 Score =   318 bits (815),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 190/226 (84%), Gaps = 7/226 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT V RNVR L QSNN+VI+ALENS+   FPVPLGAQIVQLTA+GNFEEAL+LCK
Sbjct  259  PYPLIQTIVFRNVRHLRQSNNSVIIALENSIHCLFPVPLGAQIVQLTAAGNFEEALSLCK  318

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRYAHYL++NGSYEE+MEHFLASQV+ITYVLSLY SIILPK+
Sbjct  319  LLPPEDSNLRAAKEDSIHIRYAHYLFDNGSYEESMEHFLASQVDITYVLSLYTSIILPKT  378

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME----SNTHILESDETDIESKKMSHNTLMA  193
             ++ + +K +D+ GD  +LSRG SS+SDDME    SN   L+ D  ++ESKKMSHN LMA
Sbjct  379  TIVHDSDK-LDIFGDPLHLSRG-SSMSDDMEPSSASNMSELD-DNAELESKKMSHNMLMA  435

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIKFL KKR+ IIEKATAEGTEEVV DAVG++F SY ++R KK  K
Sbjct  436  LIKFLHKKRHSIIEKATAEGTEEVVFDAVGNNFESYNSNRFKKINK  481



>ref|XP_004512043.1| PREDICTED: vam6/Vps39-like protein-like [Cicer arietinum]
Length=980

 Score =   318 bits (814),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 162/222 (73%), Positives = 186/222 (84%), Gaps = 6/222 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QSNN+VI+AL++S+ G FPVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  255  PYPLIQTIVLRNVRHLCQSNNSVILALDDSIHGLFPVPLGAQIVQLTASGNFEEALSLCK  314

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL++NGSYEEAMEHFLASQV+ITYVLSLYPSIILPK+
Sbjct  315  LLPPEDSSLRAAKEGSIHIRYAHYLFDNGSYEEAMEHFLASQVDITYVLSLYPSIILPKT  374

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESKKMSHNTLMALIKF  181
             ++ EPEK +D+ GD   L R SS +SD+ME +   L  +   +ESKK +HN LMALIK+
Sbjct  375  TIVHEPEK-LDIDGDTSYLPRVSSGVSDEMEPS---LSDENAALESKKTNHNMLMALIKY  430

Query  180  LQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LQKKR   IEKATAEGTEEVV DAVG++F SY  +R KKT K
Sbjct  431  LQKKRSSFIEKATAEGTEEVVLDAVGNNFASY--TRFKKTNK  470



>ref|XP_003611995.1| Vam6/Vps39-like protein [Medicago truncatula]
 gb|AES94953.1| vam6/Vps39-like protein [Medicago truncatula]
Length=899

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 186/223 (83%), Gaps = 8/223 (4%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRNVR L QS+N+VI+AL+NS+ G FPVPLGAQIVQLTASGNFEEAL+LCK
Sbjct  255  PYPLIQTIVLRNVRHLCQSSNSVILALDNSIQGLFPVPLGAQIVQLTASGNFEEALSLCK  314

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRYAHYL+ENGSYEEA+EHFL SQV+ITYVLSLYPSIILPK+
Sbjct  315  LLPPEDSSLRAAKEGSIHIRYAHYLFENGSYEEAVEHFLESQVDITYVLSLYPSIILPKT  374

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDET-DIESKKMSHNTLMALIK  184
             ++ EPEK +D+ GD   LSR SS +SDDME     L +DE   +ESKK +HN LMALIK
Sbjct  375  TIVHEPEK-LDIDGDASYLSRVSSGVSDDMEP----LPTDENAALESKKTNHNMLMALIK  429

Query  183  FLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +LQKKR   IEKATAEGTEEVV DAVGD++ SY  +R KK  K
Sbjct  430  YLQKKRGNFIEKATAEGTEEVVLDAVGDNYASY--NRFKKANK  470



>ref|XP_003629454.1| Tubby-like F-box protein [Medicago truncatula]
Length=1399

 Score =   317 bits (813),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 190/226 (84%), Gaps = 7/226 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT V RNVR L QSNN+VI+ALENS+   FPVPLGAQIVQLTA+GNFEEAL+LCK
Sbjct  259  PYPLIQTIVFRNVRHLRQSNNSVIIALENSIHCLFPVPLGAQIVQLTAAGNFEEALSLCK  318

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRYAHYL++NGSYEE+MEHFLASQV+ITYVLSLY SIILPK+
Sbjct  319  LLPPEDSNLRAAKEDSIHIRYAHYLFDNGSYEESMEHFLASQVDITYVLSLYTSIILPKT  378

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME----SNTHILESDETDIESKKMSHNTLMA  193
             ++ + +K +D+ GD  +LSRG SS+SDDME    SN   L+ D  ++ESKKMSHN LMA
Sbjct  379  TIVHDSDK-LDIFGDPLHLSRG-SSMSDDMEPSSASNMSELD-DNAELESKKMSHNMLMA  435

Query  192  LIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LIKFL KKR+ IIEKATAEGTEEVV DAVG++F SY ++R KK  K
Sbjct  436  LIKFLHKKRHSIIEKATAEGTEEVVFDAVGNNFESYNSNRFKKINK  481



>gb|KFK30284.1| hypothetical protein AALP_AA7G241500 [Arabis alpina]
Length=1000

 Score =   313 bits (802),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 188/215 (87%), Gaps = 3/215 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+R LV+SNNAVIV L+ SV   FPV +GAQIVQLTASGNFEEALALCK
Sbjct  259  PYPLIQTVVLQNIRHLVKSNNAVIVGLDKSVHVLFPVSIGAQIVQLTASGNFEEALALCK  318

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPE+SSLRAAKE SIH RYAHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILPK+
Sbjct  319  LLPPEESSLRAAKESSIHTRYAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPKT  378

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILES-DETDIESKKMSHNTLMAL  190
             +IP PEK VD+SGD  +LSRGSS LSDDMES++  + LES D   +ESKKMSHNTLM L
Sbjct  379  TIIPPPEKMVDISGDEASLSRGSSGLSDDMESSSPRYFLESEDNAALESKKMSHNTLMGL  438

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSY  85
            IK+LQK+R GIIEKAT+EGTEEV+SDAVG ++ +Y
Sbjct  439  IKYLQKRRPGIIEKATSEGTEEVISDAVGKTYGAY  473



>ref|XP_004287898.1| PREDICTED: vam6/Vps39-like protein [Fragaria vesca subsp. vesca]
Length=1005

 Score =   313 bits (801),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 184/210 (88%), Gaps = 3/210 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT +LRN RRL+QSNNA IVAL+ +V+G FPVPLGAQIVQLTASG FEEAL+LCK
Sbjct  266  PYPLIQTIILRNARRLLQSNNAAIVALDYAVYGLFPVPLGAQIVQLTASGEFEEALSLCK  325

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPE++S RAAKE SIHIR AH+ +++G YE+AMEHF+ASQV+ITYVLS+YPSI+LPK+
Sbjct  326  LLPPEEASHRAAKEASIHIRCAHHRFDSGDYEDAMEHFVASQVDITYVLSMYPSIVLPKT  385

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDET-DIESKKMSHNTLMAL  190
             ++ +P+K +D+S D   LSRGSS +SDDME +  +H+LES+E+  +ESKKMSHNTLMAL
Sbjct  386  TMVVDPDKLMDISTDSSYLSRGSSGMSDDMEPSPLSHVLESEESAALESKKMSHNTLMAL  445

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGD  100
            IKFLQKKR+ IIEKATAEGTEEVV DAVGD
Sbjct  446  IKFLQKKRFSIIEKATAEGTEEVVLDAVGD  475



>emb|CAB16830.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80329.1| hypothetical protein [Arabidopsis thaliana]
Length=1003

 Score =   307 bits (787),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 190/255 (75%), Gaps = 46/255 (18%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQ------------------  595
            PYPLIQT VL+N+RRLV+SNNAVIV L+NSV+  FPV +GAQ                  
Sbjct  260  PYPLIQTIVLQNIRRLVKSNNAVIVGLDNSVYVLFPVSIGAQVFTLALRILMFLAAAHGF  319

Query  594  -------------------------IVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSI  490
                                     IVQLTASGNFEEALALCK+LPP++SSLRAAKE SI
Sbjct  320  LWMNMKMCFILPNISVEYDTISVFFIVQLTASGNFEEALALCKVLPPDESSLRAAKESSI  379

Query  489  HIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYP  310
            H R+AHYL+ENGSYEEAMEHFLASQV+IT+VLS+YPSIILPK+ +IP+P+K VD+SGD  
Sbjct  380  HTRFAHYLFENGSYEEAMEHFLASQVDITHVLSMYPSIILPKTTIIPQPDKMVDISGDEA  439

Query  309  NLSRGSSSLSDDMESNT--HILES-DETDIESKKMSHNTLMALIKFLQKKRYGIIEKATA  139
            +LSRGSS +SDDMES++  + LES D  D+ESKKMSHNTLMALIK+L K+R  +IEKAT+
Sbjct  440  SLSRGSSGISDDMESSSPRYFLESEDNADLESKKMSHNTLMALIKYLLKRRPAVIEKATS  499

Query  138  EGTEEVVSDAVGDSF  94
            EGTEEV+SDAVG ++
Sbjct  500  EGTEEVISDAVGKTY  514



>ref|XP_010916253.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Elaeis guineensis]
Length=852

 Score =   292 bits (747),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 174/214 (81%), Gaps = 4/214 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPL+QT VLR+V  L+QSNN VI  L NSV+G  PVPLGAQIVQLTASG+FEEALALCK
Sbjct  267  PYPLVQTVVLRDVHLLLQSNNCVIATLSNSVYGLLPVPLGAQIVQLTASGDFEEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIH+RY HYL++NGSYEE+ME FLASQV+I YVLSLYPSI+LPK 
Sbjct  327  LLPPEDSTLRAAKESSIHMRYGHYLFDNGSYEESMEQFLASQVDINYVLSLYPSIVLPKV  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDETD-IESKKMSHNTLMAL  190
              I EPEKF D++ D   LSR SS  SD++ES+  + + ESD+   +E KKMSHN LMAL
Sbjct  387  LTIAEPEKFPDLN-DESLLSRVSSDASDEIESSSPSQLQESDDKSMLEIKKMSHNALMAL  445

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVS  88
            +K+L K+RY IIE+ATAE TEEVVSDAV DS  S
Sbjct  446  VKYLHKRRYSIIERATAEVTEEVVSDAVQDSITS  479



>gb|KJB17778.1| hypothetical protein B456_003G015100 [Gossypium raimondii]
Length=983

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 177/227 (78%), Gaps = 15/227 (7%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL +   L++SNNA++VA  NSV+G FPVPLGAQIVQLTASG FEEAL LC
Sbjct  263  VPYPLIQTIVLHDACHLIKSNNAIVVASNNSVYGLFPVPLGAQIVQLTASGEFEEALTLC  322

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPP+D+ LRAA+E+ IH RY HYL+ENG YEEAMEHFLASQV+ITYVLSLYPSI+LPK
Sbjct  323  KLLPPKDADLRAARERLIHTRYGHYLFENGCYEEAMEHFLASQVDITYVLSLYPSIVLPK  382

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETD----IESKKMSHNTLM  196
            +  IP+PEK +D+S D       SS LSDD+E  T + +  E+D     E KK SHNTLM
Sbjct  383  TTTIPKPEKLMDLSPD------DSSGLSDDLE--TLLPQPSESDENAAFEFKKTSHNTLM  434

Query  195  ALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            ALIK+LQKK Y I+EKA A+G EEVV DA+GD+F S   +RSKK+ K
Sbjct  435  ALIKYLQKKGYNIVEKAAAKGMEEVVLDAIGDNFTS---ARSKKSNK  478



>ref|XP_010916252.1| PREDICTED: vam6/Vps39-like protein isoform X1 [Elaeis guineensis]
Length=997

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 174/214 (81%), Gaps = 4/214 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPL+QT VLR+V  L+QSNN VI  L NSV+G  PVPLGAQIVQLTASG+FEEALALCK
Sbjct  267  PYPLVQTVVLRDVHLLLQSNNCVIATLSNSVYGLLPVPLGAQIVQLTASGDFEEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIH+RY HYL++NGSYEE+ME FLASQV+I YVLSLYPSI+LPK 
Sbjct  327  LLPPEDSTLRAAKESSIHMRYGHYLFDNGSYEESMEQFLASQVDINYVLSLYPSIVLPKV  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDETD-IESKKMSHNTLMAL  190
              I EPEKF D++ D   LSR SS  SD++ES+  + + ESD+   +E KKMSHN LMAL
Sbjct  387  LTIAEPEKFPDLN-DESLLSRVSSDASDEIESSSPSQLQESDDKSMLEIKKMSHNALMAL  445

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVS  88
            +K+L K+RY IIE+ATAE TEEVVSDAV DS  S
Sbjct  446  VKYLHKRRYSIIERATAEVTEEVVSDAVQDSITS  479



>ref|XP_008775839.1| PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-like protein [Phoenix 
dactylifera]
Length=997

 Score =   288 bits (738),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPL+QT VLR+V  L+QSNN VI AL NSV+G  PVPLGAQIVQLTASG+FEEALALCK
Sbjct  267  PYPLVQTVVLRDVHLLLQSNNCVIAALSNSVYGLLPVPLGAQIVQLTASGDFEEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LR+AKE SIH+RY HYL++NGSYEE+ME FLASQV++TYVLSLYPS++LPK 
Sbjct  327  LLPPEDSTLRSAKESSIHMRYGHYLFDNGSYEESMEQFLASQVDVTYVLSLYPSVVLPKV  386

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDM---ESNTHILESDETDIESKKMSHNTLMAL  190
              I EPEK  D++ D  +LSR SS  SD++     +      D++ +E KK+SHN LMAL
Sbjct  387  LTIAEPEKLPDLN-DESHLSRVSSDASDEIESSSLSQLQESDDKSMLEIKKLSHNALMAL  445

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVS  88
            +K+LQK+RYGIIE+ATAE TEEVVSDAV DS  S
Sbjct  446  VKYLQKRRYGIIERATAEVTEEVVSDAVQDSITS  479



>ref|XP_010258481.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Nelumbo nucifera]
Length=975

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P+PL+Q   L +VR L++SNN ++V L++S++G  PVPLGAQI+QLTASGNFEEALALCK
Sbjct  269  PHPLVQIISLHDVRFLIRSNNGILVVLDSSIYGLLPVPLGAQIIQLTASGNFEEALALCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
             LPPEDS+LRAAKE SIHIRY HYL++NG+YEEAME FLAS V++TYVL+LYP + LPK+
Sbjct  329  SLPPEDSTLRAAKEGSIHIRYGHYLFDNGNYEEAMEQFLASSVDVTYVLALYPYMALPKT  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDETDI-ESKKMSHNTLMAL  190
              IP+ +K V  + D  +  R SS++SD MES+  +H+ ES+E ++ ESKKMSH+ L+AL
Sbjct  389  LSIPDTDKVVYFASDTLDHCRISSNVSDIMESSSPSHLCESNEKEVLESKKMSHDALIAL  448

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +K LQKKR+ IIE+ATAEGT+E VSDAV DS  S  +SR K + K
Sbjct  449  VKLLQKKRFCIIERATAEGTDEAVSDAVDDSIKSCKSSRLKNSGK  493



>ref|XP_010258480.1| PREDICTED: vam6/Vps39-like protein isoform X1 [Nelumbo nucifera]
Length=1003

 Score =   279 bits (713),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P+PL+Q   L +VR L++SNN ++V L++S++G  PVPLGAQI+QLTASGNFEEALALCK
Sbjct  269  PHPLVQIISLHDVRFLIRSNNGILVVLDSSIYGLLPVPLGAQIIQLTASGNFEEALALCK  328

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
             LPPEDS+LRAAKE SIHIRY HYL++NG+YEEAME FLAS V++TYVL+LYP + LPK+
Sbjct  329  SLPPEDSTLRAAKEGSIHIRYGHYLFDNGNYEEAMEQFLASSVDVTYVLALYPYMALPKT  388

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESN--THILESDETDI-ESKKMSHNTLMAL  190
              IP+ +K V  + D  +  R SS++SD MES+  +H+ ES+E ++ ESKKMSH+ L+AL
Sbjct  389  LSIPDTDKVVYFASDTLDHCRISSNVSDIMESSSPSHLCESNEKEVLESKKMSHDALIAL  448

Query  189  IKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            +K LQKKR+ IIE+ATAEGT+E VSDAV DS  S  +SR K + K
Sbjct  449  VKLLQKKRFCIIERATAEGTDEAVSDAVDDSIKSCKSSRLKNSGK  493



>gb|KHG17162.1| Vam6/Vps39-like protein [Gossypium arboreum]
Length=940

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 173/227 (76%), Gaps = 20/227 (9%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPYPLIQT VL +   L++SNNA++VA  NSV+G FPVPLGAQIVQLTASG FEEALALC
Sbjct  219  VPYPLIQTIVLHDACHLIKSNNAIVVASNNSVYGLFPVPLGAQIVQLTASGEFEEALALC  278

Query  543  KLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPK  364
            KLLPP+D+ LR A+E+SIH RYAHYL++NG YEEAMEHFLASQV+I YVLSLYPSI+LPK
Sbjct  279  KLLPPKDADLRVARERSIHTRYAHYLFDNGCYEEAMEHFLASQVDIIYVLSLYPSIVLPK  338

Query  363  SAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETD----IESKKMSHNTLM  196
            +  IP+      +S D       SS LSDD+E  T + +  ++D     E KK SHNTLM
Sbjct  339  TTTIPK-----RLSPD------DSSCLSDDLE--TLLPQPSDSDENAAFEFKKTSHNTLM  385

Query  195  ALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            ALIK+LQKK Y I+EKA AEG EEVV DA+GD+F S   +RSKK+ K
Sbjct  386  ALIKYLQKKGYNIVEKAAAEGMEEVVLDAIGDNFTS---ARSKKSNK  429



>ref|XP_002310230.2| hypothetical protein POPTR_0007s12810g [Populus trichocarpa]
 gb|EEE90680.2| hypothetical protein POPTR_0007s12810g [Populus trichocarpa]
Length=953

 Score =   275 bits (702),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 169/208 (81%), Gaps = 3/208 (1%)
 Frame = -2

Query  678  RLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKE  499
            +L  S    +V ++ S +    +P   +IVQLTASGNFEEALALCKLLPPEDS+LRAAKE
Sbjct  236  KLCWSEAPSVVVIQKS-YAIALLPRRIEIVQLTASGNFEEALALCKLLPPEDSNLRAAKE  294

Query  498  QSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSG  319
             SIH+RYAHYL++NGSYEEAME FLASQV+ITY+LSLYPSI+LPK++++PEPEK +DMS 
Sbjct  295  GSIHLRYAHYLFDNGSYEEAMEQFLASQVDITYMLSLYPSIVLPKTSMVPEPEKLIDMSP  354

Query  318  DYPNLSRGSSSLSDDMESNTHILESDETDIESKKMSHNTLMALIKFLQKKRYGIIEKATA  139
            D P LSRGSS LSDDMES+      + + +ESKKMSHNTL ALIK+LQK+RY IIEKATA
Sbjct  355  DVPYLSRGSSGLSDDMESSPDF--DEHSALESKKMSHNTLKALIKYLQKRRYSIIEKATA  412

Query  138  EGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            E T+EVV DAVGD++ +Y +SR KK+ K
Sbjct  413  EVTDEVVLDAVGDNYGAYDSSRFKKSSK  440



>ref|XP_009409101.1| PREDICTED: vam6/Vps39-like protein [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 171/224 (76%), Gaps = 7/224 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPL+QT  LR+V  L+QSNN++I  L N+V+G  PVPL AQIVQLTASG+FEEAL+LCK
Sbjct  275  PYPLVQTVGLRDVHLLLQSNNSLITTLSNAVYGLLPVPLIAQIVQLTASGDFEEALSLCK  334

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            L+PPEDSSLRA+KE  IHIRYAH+L+ NG+YEEAME FLASQ EITY+LSLYPSIILPK 
Sbjct  335  LIPPEDSSLRASKESLIHIRYAHHLFNNGNYEEAMEQFLASQEEITYILSLYPSIILPKL  394

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES--NTHILESDETDIESKKMSHNTLMALI  187
              +  PEKF D + D  +LSR SS  SD+ ES  + H    D++ +E KKMSHN LMAL+
Sbjct  395  QTVSVPEKFAD-ANDELHLSRVSSDASDETESSLSQHYESDDKSTLEIKKMSHNALMALV  453

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            KFLQKKR GI E+ATAE TEEVV D++     SY   RSK + K
Sbjct  454  KFLQKKRQGIFERATAEVTEEVVQDSIS----SYEPYRSKSSNK  493



>ref|XP_004981979.1| PREDICTED: vam6/Vps39-like protein-like isoform X2 [Setaria italica]
Length=908

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 173/212 (82%), Gaps = 6/212 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT +LR+V++LVQ++N ++ AL NSV+GF PVP+GAQIVQLTASG FEEALALCK
Sbjct  271  PNALVQTLLLRDVQKLVQTDNCILAALSNSVYGFLPVPIGAQIVQLTASGEFEEALALCK  330

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L+++GSYEEAME F  S V+ITYVLSLYPSI+LP++
Sbjct  331  LLPPEDSNLRAAKESSIHIRYGHFLFDSGSYEEAMEQFSDSHVDITYVLSLYPSIVLPQT  390

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDE-TDIESKKMSHNTLMALI  187
             +I E +K +DM    P L+R SS ++D+MES +  + ESD+ + +E KKMSHN L+AL+
Sbjct  391  HIIGEHDKLLDM----PELARESSDVTDEMESYSLQLHESDDKSPLEVKKMSHNALVALV  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFV  91
            K+LQKKR GIIE+ATAE TEEVVS AV  S +
Sbjct  447  KYLQKKRSGIIERATAEVTEEVVSGAVHHSLI  478



>ref|XP_004981978.1| PREDICTED: vam6/Vps39-like protein-like isoform X1 [Setaria italica]
Length=997

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 173/212 (82%), Gaps = 6/212 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT +LR+V++LVQ++N ++ AL NSV+GF PVP+GAQIVQLTASG FEEALALCK
Sbjct  271  PNALVQTLLLRDVQKLVQTDNCILAALSNSVYGFLPVPIGAQIVQLTASGEFEEALALCK  330

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L+++GSYEEAME F  S V+ITYVLSLYPSI+LP++
Sbjct  331  LLPPEDSNLRAAKESSIHIRYGHFLFDSGSYEEAMEQFSDSHVDITYVLSLYPSIVLPQT  390

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDE-TDIESKKMSHNTLMALI  187
             +I E +K +DM    P L+R SS ++D+MES +  + ESD+ + +E KKMSHN L+AL+
Sbjct  391  HIIGEHDKLLDM----PELARESSDVTDEMESYSLQLHESDDKSPLEVKKMSHNALVALV  446

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFV  91
            K+LQKKR GIIE+ATAE TEEVVS AV  S +
Sbjct  447  KYLQKKRSGIIERATAEVTEEVVSGAVHHSLI  478



>ref|XP_002463992.1| hypothetical protein SORBIDRAFT_01g010130 [Sorghum bicolor]
 gb|EER90990.1| hypothetical protein SORBIDRAFT_01g010130 [Sorghum bicolor]
Length=998

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 168/211 (80%), Gaps = 6/211 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LVQ++N ++ AL NSV G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  270  PNALVQTVVLRDVQKLVQTDNCILAALSNSVHGLLPVPIGAQIVQLTASGEFEEALALCK  329

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L+++GSYEEAME F  S V+ITYVLSLYPSI+LP++
Sbjct  330  LLPPEDSNLRAAKESSIHIRYGHFLFDSGSYEEAMEQFSDSHVDITYVLSLYPSIVLPQT  389

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILE--SDETDIESKKMSHNTLMALI  187
             +I E +K +DM    P L+R SS ++D+MES +  L    D++ +E+KKMSHN L AL+
Sbjct  390  NIIGEHDKLLDM----PELTRESSDVTDEMESYSLQLHDPDDKSPLEAKKMSHNALAALV  445

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
            K+LQKKR GIIE+ATAE TEEVVS AV  S 
Sbjct  446  KYLQKKRSGIIERATAEVTEEVVSGAVHHSL  476



>tpg|DAA51025.1| TPA: hypothetical protein ZEAMMB73_281557 [Zea mays]
Length=995

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 173/224 (77%), Gaps = 6/224 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LVQ+++ ++ AL NSV G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  270  PNALVQTVVLRDVQKLVQTDHCILAALSNSVHGLLPVPIGAQIVQLTASGEFEEALALCK  329

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L++NGSYEEAME F  S V+ITYVLSLYPSI+LP++
Sbjct  330  LLPPEDSNLRAAKESSIHIRYGHFLFDNGSYEEAMEQFSDSHVDITYVLSLYPSIVLPQT  389

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILE--SDETDIESKKMSHNTLMALI  187
             +I + +K +DM    P L+R SS ++D+MES +  L+   D++ +E KKMSHN L AL+
Sbjct  390  NIIGDHDKLLDM----PELARESSDVTDEMESYSLQLQEPDDKSPLEVKKMSHNALAALV  445

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQKKR GIIE+ATAE TEEVVS AV  S       +SKK  K
Sbjct  446  KYLQKKRSGIIERATAEVTEEVVSGAVHHSLKLSEPYKSKKLSK  489



>ref|XP_006650498.1| PREDICTED: vam6/Vps39-like protein-like [Oryza brachyantha]
Length=980

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 173/224 (77%), Gaps = 6/224 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LV++ N ++  L  SV+G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  259  PNALVQTVVLRDVQKLVETENCILAVLARSVYGLLPVPIGAQIVQLTASGEFEEALALCK  318

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDSSLRAAKE SIHIRY H+L++NGSYEEAME F  S V+ITYVLSLYPS+ILP++
Sbjct  319  LLPPEDSSLRAAKESSIHIRYGHFLFDNGSYEEAMEQFADSHVDITYVLSLYPSLILPQT  378

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDE-TDIESKKMSHNTLMALI  187
             +I E ++  D+    P L+R SS L+D+ME  +  + ESD+ + +E KKMSHN L+AL+
Sbjct  379  HIIGEHDRLHDL----PELARESSDLTDEMEPYSLQLHESDDKSPLEIKKMSHNALIALV  434

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQKKR GIIE+ATAE TEEVVS AV  S +   + RSKK  K
Sbjct  435  KYLQKKRNGIIERATAEVTEEVVSGAVHHSSILSESYRSKKPNK  478



>gb|EEE59815.1| hypothetical protein OsJ_12351 [Oryza sativa Japonica Group]
Length=986

 Score =   263 bits (673),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 177/234 (76%), Gaps = 9/234 (4%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LV++ N ++  L  SV+G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  185  PNALVQTVVLRDVQKLVETENCILAVLARSVYGLLPVPIGAQIVQLTASGEFEEALALCK  244

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L++NGSYEEAME F  S V+ITYVLSLYPS++LP++
Sbjct  245  LLPPEDSNLRAAKESSIHIRYGHFLFDNGSYEEAMEQFSDSHVDITYVLSLYPSLVLPQT  304

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDE-TDIESKKMSHNTLMALI  187
             +I E ++  D+    P L+R SS ++DDME  +  + ESD+ + +E KKMSHN L+AL+
Sbjct  305  HIIGEHDRLQDL----PELARESSDVTDDMEPYSLQLHESDDKSPLEIKKMSHNALIALV  360

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIKVAFIFILLGI  25
            K+L KKR GIIE+ATAE TEEVVS AV  S +   + RSKK  K A    L+GI
Sbjct  361  KYLHKKRNGIIERATAEVTEEVVSGAVHHSSILSESYRSKKPNKEA---ALIGI  411



>gb|ABB45382.1| TVLP1 [Oryza sativa Indica Group]
Length=984

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LV++ N ++  L  SV+G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  259  PNALVQTVVLRDVQKLVETENCILAVLARSVYGLLPVPIGAQIVQLTASGEFEEALALCK  318

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L++NGSYEEAME F  S V+ITYVLSLYPS++LP++
Sbjct  319  LLPPEDSNLRAAKESSIHIRYGHFLFDNGSYEEAMEQFSDSHVDITYVLSLYPSLVLPQT  378

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDE-TDIESKKMSHNTLMALI  187
             +I E ++  D+    P L+R SS ++DDME  +  + ESD+ + +E KKMSHN L+AL+
Sbjct  379  HIIGEHDRLQDL----PELARESSDVTDDMEPYSLQLHESDDKSPLEIKKMSHNALIALV  434

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKK  64
            K+L KKR GIIE+ATAE TEEVVS AV  S +   + RSKK
Sbjct  435  KYLHKKRNGIIERATAEVTEEVVSGAVHHSSILSESYRSKK  475



>ref|NP_001051077.1| Os03g0715500 [Oryza sativa Japonica Group]
 gb|ABF98552.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98553.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12991.1| Os03g0715500 [Oryza sativa Japonica Group]
 gb|EEC76073.1| hypothetical protein OsI_13290 [Oryza sativa Indica Group]
Length=984

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LV++ N ++  L  SV+G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  259  PNALVQTVVLRDVQKLVETENCILAVLARSVYGLLPVPIGAQIVQLTASGEFEEALALCK  318

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L++NGSYEEAME F  S V+ITYVLSLYPS++LP++
Sbjct  319  LLPPEDSNLRAAKESSIHIRYGHFLFDNGSYEEAMEQFSDSHVDITYVLSLYPSLVLPQT  378

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDE-TDIESKKMSHNTLMALI  187
             +I E ++  D+    P L+R SS ++DDME  +  + ESD+ + +E KKMSHN L+AL+
Sbjct  379  HIIGEHDRLQDL----PELARESSDVTDDMEPYSLQLHESDDKSPLEIKKMSHNALIALV  434

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKK  64
            K+L KKR GIIE+ATAE TEEVVS AV  S +   + RSKK
Sbjct  435  KYLHKKRNGIIERATAEVTEEVVSGAVHHSSILSESYRSKK  475



>gb|AAL58199.1|AC090882_2 TGF beta receptor associated protein-like protein [Oryza sativa 
Japonica Group]
Length=1038

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LV++ N ++  L  SV+G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  296  PNALVQTVVLRDVQKLVETENCILAVLARSVYGLLPVPIGAQIVQLTASGEFEEALALCK  355

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIHIRY H+L++NGSYEEAME F  S V+ITYVLSLYPS++LP++
Sbjct  356  LLPPEDSNLRAAKESSIHIRYGHFLFDNGSYEEAMEQFSDSHVDITYVLSLYPSLVLPQT  415

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES-NTHILESDE-TDIESKKMSHNTLMALI  187
             +I E ++  D+    P L+R SS ++DDME  +  + ESD+ + +E KKMSHN L+AL+
Sbjct  416  HIIGEHDRLQDL----PELARESSDVTDDMEPYSLQLHESDDKSPLEIKKMSHNALIALV  471

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKK  64
            K+L KKR GIIE+ATAE TEEVVS AV  S +   + RSKK
Sbjct  472  KYLHKKRNGIIERATAEVTEEVVSGAVHHSSILSESYRSKK  512



>ref|XP_009109971.1| PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-like protein [Brassica 
rapa]
Length=505

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 151/176 (86%), Gaps = 7/176 (4%)
 Frame = -2

Query  606  LGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHF  427
            L  QIVQLTASGNFEEA+ALCKLLPPEDSSLRAAKE SIH R+AHYL+ENGSYEEAMEH 
Sbjct  5    LSWQIVQLTASGNFEEAIALCKLLPPEDSSLRAAKESSIHTRFAHYLFENGSYEEAMEHI  64

Query  426  LASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HI  253
            LASQV+IT+VLS+YPSIILPK+ +IP+P+K VD +    +LSRGSS +SDDMES++  + 
Sbjct  65   LASQVDITHVLSMYPSIILPKTTIIPQPDKMVDEA----SLSRGSSGISDDMESSSPXYY  120

Query  252  LESD-ETDIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVS  88
            LES+    +ESKKMSHNTLMAL+K+L K+R GIIEKAT+EGTEEV+SDAVG S  S
Sbjct  121  LESEGNAALESKKMSHNTLMALVKYLXKRRPGIIEKATSEGTEEVISDAVGKSMKS  176



>ref|XP_006858768.1| hypothetical protein AMTR_s00066p00149360 [Amborella trichopoda]
 gb|ERN20235.1| hypothetical protein AMTR_s00066p00149360 [Amborella trichopoda]
Length=1009

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 170/229 (74%), Gaps = 7/229 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPL+QT  LR+ R L+ S + VI  L+NSV+G  PVPLGAQIVQLTAS NFEEALALC+
Sbjct  270  PYPLVQTIALRDARGLLSSKHCVIATLQNSVYGLLPVPLGAQIVQLTASSNFEEALALCE  329

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SI IRY H+L++NGSYEEAME FL S V+ITYVLSLYP I +PKS
Sbjct  330  LLPPEDSTLRAAKEGSIRIRYGHHLFDNGSYEEAMEQFLKSPVDITYVLSLYPLIDIPKS  389

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDME------SNTHILESDE-TDIESKKMSHNT  202
              + E EK ++ + D   LSR SS  SD+ME      +N+  LESDE   +E +K SHN+
Sbjct  390  QSVTESEKTLESASDAYLLSRASSDASDEMEGSSPSSANSQPLESDEKATLEYRKTSHNS  449

Query  201  LMALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            LMALIK+LQKKR  IIE+ATAE TEEVV+ AV ++  S  +  S+ + K
Sbjct  450  LMALIKYLQKKRDSIIERATAEVTEEVVAYAVQETSTSPDSHWSRSSGK  498



>ref|XP_003560617.1| PREDICTED: vam6/Vps39-like protein [Brachypodium distachyon]
Length=984

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 172/224 (77%), Gaps = 6/224 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+Q  VLR+V++LVQ++N ++ AL NSV+G  PVP+GAQIVQLTASG FEEALALCK
Sbjct  258  PNALVQMVVLRDVQKLVQTDNCILAALSNSVYGLLPVPIGAQIVQLTASGEFEEALALCK  317

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIH+RY H+L++NGSY+EAME F  S V+ITYVLSL+PS++LP++
Sbjct  318  LLPPEDSNLRAAKESSIHMRYGHFLFDNGSYDEAMEQFSNSHVDITYVLSLFPSLVLPQT  377

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILE--SDETDIESKKMSHNTLMALI  187
             +I E +K  D+    P L+R SS ++D+MES +  L    D++  E+KKMS+N L+AL 
Sbjct  378  HIIGEHDKLQDL----PELARESSDVTDEMESYSMQLHESDDKSPSENKKMSNNALIALA  433

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKKTIK  55
            K+LQKKR GII++AT+E TEEVVS AV  S +     +SKK  K
Sbjct  434  KYLQKKRSGIIDRATSEVTEEVVSGAVHHSLILSEPYKSKKPNK  477



>gb|EMS67489.1| Vam6/Vps39-like protein [Triticum urartu]
Length=1357

 Score =   253 bits (646),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 166/211 (79%), Gaps = 6/211 (3%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  L+QT VLR+V++LVQ++N ++ +L NSV+G  PVP+GAQIVQLTASG FE+ALALCK
Sbjct  156  PSALVQTVVLRDVQKLVQTDNYILASLSNSVYGLLPVPIGAQIVQLTASGEFEDALALCK  215

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            LLPPEDS+LRAAKE SIH+RY H+L++NGSYEEAME F  + V+ITYVLSLYP ++LP++
Sbjct  216  LLPPEDSNLRAAKESSIHMRYGHFLFDNGSYEEAMEQFSDAHVDITYVLSLYPYLVLPQT  275

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILE--SDETDIESKKMSHNTLMALI  187
             +I E +K  D+      L+R SS  +D+ME+ +  L    D++ +E+KKMSHN L+AL+
Sbjct  276  HIIGEHDKLQDLQ----ELARESSDATDEMEAYSLQLHDSDDKSPLENKKMSHNALIALV  331

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
            K+LQKKR GII++AT+E TEEVVS AV  S 
Sbjct  332  KYLQKKRNGIIDRATSEVTEEVVSGAVHHSL  362



>gb|EPS67833.1| hypothetical protein M569_06937, partial [Genlisea aurea]
Length=704

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 156/183 (85%), Gaps = 3/183 (2%)
 Frame = -2

Query  594  IVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQ  415
            IVQLTASGNFEEALALCKLLPPEDS+LR AKEQSIH+RYAH+L+EN  YEEAM+ FL+SQ
Sbjct  1    IVQLTASGNFEEALALCKLLPPEDSNLRTAKEQSIHVRYAHHLFENQRYEEAMDQFLSSQ  60

Query  414  VEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMES--NTHILESD  241
            VEI YVL+LYP+I+LPKS+VIPEPE + ++SGD  ++SRGSS++SD++E+   +H L+S+
Sbjct  61   VEIHYVLALYPAIVLPKSSVIPEPETYTEISGDTTDISRGSSAVSDELEAPLPSHALDSE  120

Query  240  E-TDIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSFVSYGTSRSKK  64
               D+ES+KMSHN+LMALIKFLQKKRYG++EKA AEGTEEVVS  V  SF SYG +  KK
Sbjct  121  GFGDLESRKMSHNSLMALIKFLQKKRYGVVEKAAAEGTEEVVSSVVASSFASYGNNIMKK  180

Query  63   TIK  55
              K
Sbjct  181  VSK  183



>ref|XP_008338142.1| PREDICTED: vam6/Vps39-like protein [Malus domestica]
Length=742

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 3/145 (2%)
 Frame = -2

Query  483  RYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNL  304
            RYAH+L++NG+YE+AMEHFLASQV+ITYVLSLYPSI+LPK+ ++  PEK +D+SGD   L
Sbjct  84   RYAHHLFDNGAYEDAMEHFLASQVDITYVLSLYPSIVLPKTTMVAVPEKLMDISGDSSYL  143

Query  303  SRGSSSLSDDME-SNTHILESDET-DIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGT  130
            SRGSS LSDDME S   +LES+E+  +ESKKMSHNTLMALIKFLQKKRYGIIEKATAEGT
Sbjct  144  SRGSSGLSDDMEHSLPSVLESEESAALESKKMSHNTLMALIKFLQKKRYGIIEKATAEGT  203

Query  129  EEVVSDAVGDSFVSYGTSRSKKTIK  55
            EEVV DAVGD+FVSY  SR KK+ K
Sbjct  204  EEVVLDAVGDNFVSY-ESRFKKSNK  227



>gb|KDO79545.1| hypothetical protein CISIN_1g0018512mg, partial [Citrus sinensis]
Length=479

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = -2

Query  480  YAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLS  301
            +AHYL++ GSYEEAMEHFLASQV+ITY LSLYPSI+LPK+ V+PEPE+ +D+S D P+LS
Sbjct  1    FAHYLFDTGSYEEAMEHFLASQVDITYALSLYPSIVLPKTTVVPEPERLLDISSDAPSLS  60

Query  300  RGSSSLSDDMESN--THILESDET-DIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGT  130
            RGSS +SDDMES+    + E DE   ++SKKMSHNTLMALIKFLQKKR  IIEKATAEGT
Sbjct  61   RGSSGMSDDMESSPPAQLSELDENATLKSKKMSHNTLMALIKFLQKKRSSIIEKATAEGT  120

Query  129  EEVVSDAVGDSFVSYGTSRSKKTIK  55
            EEVV DAVGD+F S+ ++R KK+ K
Sbjct  121  EEVVLDAVGDNFTSHDSTRFKKSSK  145



>gb|KDO79543.1| hypothetical protein CISIN_1g0018512mg, partial [Citrus sinensis]
 gb|KDO79544.1| hypothetical protein CISIN_1g0018512mg, partial [Citrus sinensis]
Length=660

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = -2

Query  480  YAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLS  301
            +AHYL++ GSYEEAMEHFLASQV+ITY LSLYPSI+LPK+ V+PEPE+ +D+S D P+LS
Sbjct  1    FAHYLFDTGSYEEAMEHFLASQVDITYALSLYPSIVLPKTTVVPEPERLLDISSDAPSLS  60

Query  300  RGSSSLSDDMESN--THILESDET-DIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGT  130
            RGSS +SDDMES+    + E DE   ++SKKMSHNTLMALIKFLQKKR  IIEKATAEGT
Sbjct  61   RGSSGMSDDMESSPPAQLSELDENATLKSKKMSHNTLMALIKFLQKKRSSIIEKATAEGT  120

Query  129  EEVVSDAVGDSFVSYGTSRSKKTIK  55
            EEVV DAVGD+F S+ ++R KK+ K
Sbjct  121  EEVVLDAVGDNFTSHDSTRFKKSSK  145



>gb|KJB43500.1| hypothetical protein B456_007G203400 [Gossypium raimondii]
Length=662

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 117/145 (81%), Gaps = 5/145 (3%)
 Frame = -2

Query  483  RYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNL  304
            RYAHYL++NG YEEAMEHFLASQV+ITYVLSLY SI+LPK+  +PEPEK  D+S D P L
Sbjct  6    RYAHYLFDNGCYEEAMEHFLASQVDITYVLSLYQSIVLPKTTAVPEPEKLADLSLDAPQL  65

Query  303  SRGSSSLSDDMESNT-HILESDETD-IESKKMSHNTLMALIKFLQKKRYGIIEKATAEGT  130
            SRGSS +SDD+E+    + ESDE   +E KKMSHNTLMALIKFLQKKRY I+EKA AEGT
Sbjct  66   SRGSSGMSDDLETFLPQLAESDENSALEFKKMSHNTLMALIKFLQKKRYSIVEKAAAEGT  125

Query  129  EEVVSDAVGDSFVSYGTSRSKKTIK  55
            EEVV DAVGDSF S   SR KK+ K
Sbjct  126  EEVVLDAVGDSFTS---SRFKKSNK  147



>emb|CDY24777.1| BnaA08g15330D [Brassica napus]
Length=711

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+R LV+SN+AVIV L+NS    FPV +GAQIVQLTASGNFEEA+ALCK
Sbjct  238  PYPLIQTVVLQNIRHLVKSNSAVIVDLDNSAHVLFPVSIGAQIVQLTASGNFEEAIALCK  297

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITY  400
            LLPPEDSSLRAAKE SIH R+AHYL+ENGSYEEAMEH LASQV+IT+
Sbjct  298  LLPPEDSSLRAAKESSIHTRFAHYLFENGSYEEAMEHILASQVDITH  344



>dbj|BAH56769.1| AT4G36630 [Arabidopsis thaliana]
Length=563

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 103/118 (87%), Gaps = 3/118 (3%)
 Frame = -2

Query  438  MEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT  259
            MEHFLASQV+IT+VLS+YPSIILPK+ +IP+P+K VD+SGD  +LSRGSS +SDDMES++
Sbjct  1    MEHFLASQVDITHVLSMYPSIILPKTTIIPQPDKMVDISGDEASLSRGSSGISDDMESSS  60

Query  258  --HILES-DETDIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGTEEVVSDAVGDSF  94
              + LES D  D+ESKKMSHNTLMALIK+L K+R  +IEKAT+EGTEEV+SDAVG ++
Sbjct  61   PRYFLESEDNADLESKKMSHNTLMALIKYLLKRRPAVIEKATSEGTEEVISDAVGKTY  118



>gb|KDO79548.1| hypothetical protein CISIN_1g0018511mg, partial [Citrus sinensis]
Length=155

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPY LIQT VL+NVR L+ S+NAV+VALENS+FG FPVPLGAQIVQLTASG+FEEALALC
Sbjct  76   VPYALIQTIVLQNVRHLIPSSNAVVVALENSIFGLFPVPLGAQIVQLTASGDFEEALALC  135

Query  543  KLLPPEDSSLRAAKEQSIHI  484
            KLLPPED+SLRAAKE SIHI
Sbjct  136  KLLPPEDASLRAAKEGSIHI  155



>ref|XP_008367954.1| PREDICTED: vam6/Vps39-like protein [Malus domestica]
Length=346

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VLRN RR++QSNNAVIVALEN+V+G FPVPLGAQIVQLTASG+F+EALALCK
Sbjct  267  PYPLIQTVVLRNARRILQSNNAVIVALENAVYGLFPVPLGAQIVQLTASGDFDEALALCK  326

Query  540  LLPPEDSSLRAAKEQSIHIR  481
            +LPPE++SLRAAKE SIH+R
Sbjct  327  MLPPEEASLRAAKEASIHMR  346



>gb|KDO79546.1| hypothetical protein CISIN_1g0018511mg, partial [Citrus sinensis]
 gb|KDO79547.1| hypothetical protein CISIN_1g0018511mg, partial [Citrus sinensis]
Length=343

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VPY LIQT VL+NVR L+ S+NAV+VALENS+FG FPVPLGAQIVQLTASG+FEEALALC
Sbjct  264  VPYALIQTIVLQNVRHLIPSSNAVVVALENSIFGLFPVPLGAQIVQLTASGDFEEALALC  323

Query  543  KLLPPEDSSLRAAKEQSIHI  484
            KLLPPED+SLRAAKE SIHI
Sbjct  324  KLLPPEDASLRAAKEGSIHI  343



>ref|XP_002973518.1| hypothetical protein SELMODRAFT_149115 [Selaginella moellendorffii]
 gb|EFJ25178.1| hypothetical protein SELMODRAFT_149115 [Selaginella moellendorffii]
Length=974

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 118/202 (58%), Gaps = 23/202 (11%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PY ++Q    ++ + L  S+  ++ A ENSV+   PV +G Q+VQL ASGNFE+ALALCK
Sbjct  268  PYSVVQMIAHKDKQLLQSSSFGLLAASENSVYKLVPVAIGVQVVQLAASGNFEDALALCK  327

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            L+PPED+SLRA+KE +IH RY  +L+  G Y EA++HF  S + +  +++L+PS+ LP+ 
Sbjct  328  LMPPEDASLRASKEDAIHKRYGQFLFSRGQYVEALQHFALSSMSLPSIIALFPSVKLPEF  387

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESKKMSHNTLMALIKF  181
             V  E   F DM                    N+  LE DE +  S   S  +L AL  F
Sbjct  388  CVFDE---FKDM-------------------ENSGELEVDENNSNSVSTS-ISLAALATF  424

Query  180  LQKKRYGIIEKATAEGTEEVVS  115
            L  KR  +I KA A+ T+E ++
Sbjct  425  LMNKRGDVIAKAEAKDTDEALA  446



>ref|XP_002975550.1| hypothetical protein SELMODRAFT_442906 [Selaginella moellendorffii]
 gb|EFJ23179.1| hypothetical protein SELMODRAFT_442906 [Selaginella moellendorffii]
Length=962

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 117/202 (58%), Gaps = 23/202 (11%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PY ++Q    ++ + L  S+  ++ A ENSV+   PV +G Q+VQL ASGNFE+ALALCK
Sbjct  268  PYSVVQMIAHKDKQLLQSSSFGLLAASENSVYKLVPVAIGVQVVQLAASGNFEDALALCK  327

Query  540  LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS  361
            L+PPED+SLRA+KE +IH RY  +L+  G Y EA++HF  S + +  +++L+PS+ LP+ 
Sbjct  328  LMPPEDASLRASKEDAIHKRYGQFLFSRGQYVEALQHFALSSMSLPSIIALFPSVKLPEF  387

Query  360  AVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESKKMSHNTLMALIKF  181
             V  E   F DM                    N+  LE DE +  S   S  +L AL  F
Sbjct  388  CVFDE---FKDM-------------------ENSGELEVDENNSNSVSTS-ISLAALATF  424

Query  180  LQKKRYGIIEKATAEGTEEVVS  115
            L  KR  +I  A A+ T+E ++
Sbjct  425  LMNKRGDVIANAEAKDTDEALA  446



>emb|CDY35465.1| BnaC03g61950D [Brassica napus]
Length=195

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 1/81 (1%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            PYPLIQT VL+N+R LV+SNNAVIV L+NSV   FPV +GAQIVQLTA+GNFEEALALCK
Sbjct  116  PYPLIQT-VLQNIRHLVKSNNAVIVGLDNSVHVLFPVSIGAQIVQLTAAGNFEEALALCK  174

Query  540  LLPPEDSSLRAAKEQSIHIRY  478
             LPPEDSSLRAAKE SIH RY
Sbjct  175  SLPPEDSSLRAAKESSIHTRY  195



>emb|CDX83649.1| BnaC07g23890D [Brassica napus]
Length=243

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = -2

Query  357  VIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESD-ETDIESKKMSHNTLMALI  187
            +IPEP+K VD+SGD   LSRGSS  SDDMES++  ++ ES+    +ESKKMSHNTLMALI
Sbjct  1    MIPEPDKNVDISGDEAALSRGSSGFSDDMESSSPRYLFESEGNAALESKKMSHNTLMALI  60

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDS  97
            K+LQK+R G+IEKAT+EGTEEV+SDAVG S
Sbjct  61   KYLQKRRPGMIEKATSEGTEEVISDAVGKS  90



>emb|CDY53083.1| BnaC03g76730D [Brassica napus]
Length=479

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = -2

Query  357  VIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNT--HILESD-ETDIESKKMSHNTLMALI  187
            +IPEP+K VD+SGD   LSRGSS  SDDMES++  ++ ES+    +ESKKMSHNTLMALI
Sbjct  1    MIPEPDKNVDISGDEAALSRGSSGFSDDMESSSPRYLFESEGNAALESKKMSHNTLMALI  60

Query  186  KFLQKKRYGIIEKATAEGTEEVVSDAVGDS  97
            K+LQK+R G+IEKAT+EGTEEV+SDAVG S
Sbjct  61   KYLQKRRPGMIEKATSEGTEEVISDAVGKS  90



>gb|ESA12188.1| hypothetical protein GLOINDRAFT_27429 [Rhizophagus irregularis 
DAOM 181602]
Length=693

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 93/200 (47%), Gaps = 27/200 (14%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            V   L+QT  L   R + Q     + ++ N V+ F P+    QI QL     F+EAL+L 
Sbjct  282  VTQKLVQTFDLPQARLINQGKYLYVASISN-VWRFIPLNFEKQIDQLVEQNEFDEALSLA  340

Query  543  K----LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSI  376
            K    LL  +D+ +R  +       YAHYL+    +++A+  F    V+   V++LYP  
Sbjct  341  KIEPTLLKDKDAKIRETRR-----LYAHYLFHQNKFDDAITIFQELDVDPKEVIALYPPS  395

Query  375  ILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESK-------K  217
            I   S  + +P +        P + + S  + DD  +N    +S E +IE++       K
Sbjct  396  I---SGALHKPVQ-------RPKVLKPSDEIVDDEINNDQEEKSSEDEIETENLEILEGK  445

Query  216  MSHNTLMALIKFLQKKRYGI  157
            +    +  LIKFL  +R+ I
Sbjct  446  LLEEAVQTLIKFLTDRRHRI  465



>gb|EXX74416.1| Vam6p [Rhizophagus irregularis DAOM 197198w]
Length=902

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 93/200 (47%), Gaps = 27/200 (14%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            V   L+QT  L   R + Q     + ++ N V+ F P+    QI QL     F+EAL+L 
Sbjct  278  VTQKLVQTFDLPQARLINQGKYLYVASISN-VWRFIPLNFEKQIDQLVEQNEFDEALSLA  336

Query  543  K----LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSI  376
            K    LL  +D+ +R  +       YAHYL+    +++A+  F    V+   V++LYP  
Sbjct  337  KIEPTLLKDKDAKIRETRR-----LYAHYLFHQNKFDDAITIFQELDVDPKEVIALYPPS  391

Query  375  ILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESK-------K  217
            I   S  + +P +        P + + S  + DD  +N    +S E +IE++       K
Sbjct  392  I---SGALHKPVQ-------RPKVLKPSDEIVDDEINNDQEEKSSEDEIETENLEILEGK  441

Query  216  MSHNTLMALIKFLQKKRYGI  157
            +    +  LIKFL  +R+ I
Sbjct  442  LLEEAVQTLIKFLTDRRHRI  461



>gb|EXX74414.1| Vam6p [Rhizophagus irregularis DAOM 197198w]
Length=911

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 93/200 (47%), Gaps = 27/200 (14%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            V   L+QT  L   R + Q     + ++ N V+ F P+    QI QL     F+EAL+L 
Sbjct  278  VTQKLVQTFDLPQARLINQGKYLYVASISN-VWRFIPLNFEKQIDQLVEQNEFDEALSLA  336

Query  543  K----LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSI  376
            K    LL  +D+ +R  +       YAHYL+    +++A+  F    V+   V++LYP  
Sbjct  337  KIEPTLLKDKDAKIRETRR-----LYAHYLFHQNKFDDAITIFQELDVDPKEVIALYPPS  391

Query  375  ILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESK-------K  217
            I   S  + +P +        P + + S  + DD  +N    +S E +IE++       K
Sbjct  392  I---SGALHKPVQ-------RPKVLKPSDEIVDDEINNDQEEKSSEDEIETENLEILEGK  441

Query  216  MSHNTLMALIKFLQKKRYGI  157
            +    +  LIKFL  +R+ I
Sbjct  442  LLEEAVQTLIKFLTDRRHRI  461



>emb|CBJ28092.1| conserved unknown protein [Ectocarpus siliculosus]
Length=1234

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 85/178 (48%), Gaps = 25/178 (14%)
 Frame = -2

Query  648  VALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHY  469
            VA  NSV     +P+  Q+  L  SG++E+AL+LC +   + S L +    SIH RYA+ 
Sbjct  331  VATANSVNLLKLIPIEFQVETLAESGSYEDALSLCAMCK-DMSVLGSVNVLSIHERYAYD  389

Query  468  LYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDY--PNL-SR  298
            L+  G YE A+ HFL ++  + +VLSL+PS+          P +FV   G    PN   +
Sbjct  390  LFSWGDYEGAVGHFLVAETPVDHVLSLFPSL---------APPEFVPPGGSLQGPNTPKK  440

Query  297  GSSSLSDDMESNTHILESDETDIESKKMSHNTLMALIKFLQKKRYGIIEKATAEGTEE  124
            G +S  +     T +  S                A++ FL++ R  I+  A  E  ++
Sbjct  441  GPTSSGEPPRQLTGVSRSRAAS------------AVMTFLERHRPAILAAAEREDCQK  486



>gb|EXX74415.1| Vam6p [Rhizophagus irregularis DAOM 197198w]
Length=916

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 93/200 (47%), Gaps = 27/200 (14%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            V   L+QT  L   R + Q     + ++ N V+ F P+    QI QL     F+EAL+L 
Sbjct  278  VTQKLVQTFDLPQARLINQGKYLYVASISN-VWRFIPLNFEKQIDQLVEQNEFDEALSLA  336

Query  543  K----LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSI  376
            K    LL  +D+ +R  +       YAHYL+    +++A+  F    V+   V++LYP  
Sbjct  337  KIEPTLLKDKDAKIRETRR-----LYAHYLFHQNKFDDAITIFQELDVDPKEVIALYPPS  391

Query  375  ILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESK-------K  217
            I   S  + +P +        P + + S  + DD  +N    +S E +IE++       K
Sbjct  392  I---SGALHKPVQ-------RPKVLKPSDEIVDDEINNDQEEKSSEDEIETENLEILEGK  441

Query  216  MSHNTLMALIKFLQKKRYGI  157
            +    +  LIKFL  +R+ I
Sbjct  442  LLEEAVQTLIKFLTDRRHRI  461



>ref|XP_008902429.1| hypothetical protein PPTG_09287 [Phytophthora parasitica INRA-310]
 ref|XP_008902430.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 ref|XP_008902431.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN12461.1| hypothetical protein PPTG_09287 [Phytophthora parasitica INRA-310]
 gb|ETN12462.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN12463.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
Length=1004

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (51%), Gaps = 32/150 (21%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ALCKL P E+S L  A ++ ++  Y   L+ +GS   AM 
Sbjct  386  LPVAQQVAASMGNRRLEDAVALCKLCP-EESPLSDADQRKLYADYGFDLFRSGSRLGAMN  444

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
            +F  S++++  VL L+P  +LP+ A                      S+L  D  +N ++
Sbjct  445  YFFESEIDVMEVLLLFPRNLLPRKA----------------------SALRKDSNNNKNM  482

Query  252  -LESDETDIESKKMSHNTLMALIKFLQKKR  166
             LE DE  +ES       L+ALI FL++KR
Sbjct  483  TLEGDEL-VES-------LLALIGFLRRKR  504



>gb|ETL98061.1| hypothetical protein L917_04787, partial [Phytophthora parasitica]
 gb|ETL98062.1| hypothetical protein, variant 1, partial [Phytophthora parasitica]
 gb|ETL98063.1| hypothetical protein, variant 2, partial [Phytophthora parasitica]
Length=1011

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (51%), Gaps = 32/150 (21%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ALCKL P E+S L  A ++ ++  Y   L+ +GS   AM 
Sbjct  393  LPVAQQVAASMGNRRLEDAVALCKLCP-EESPLSDADQRKLYADYGFDLFRSGSRLGAMN  451

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
            +F  S++++  VL L+P  +LP+ A                      S+L  D  +N ++
Sbjct  452  YFFESEIDVMEVLLLFPRNLLPRKA----------------------SALRKDSNNNKNM  489

Query  252  -LESDETDIESKKMSHNTLMALIKFLQKKR  166
             LE DE  +ES       L+ALI FL++KR
Sbjct  490  TLEGDEL-VES-------LLALIGFLRRKR  511



>gb|ETK91497.1| hypothetical protein L915_04940, partial [Phytophthora parasitica]
 gb|ETK91498.1| hypothetical protein, variant 1, partial [Phytophthora parasitica]
 gb|ETK91499.1| hypothetical protein, variant 2, partial [Phytophthora parasitica]
 gb|ETL44907.1| hypothetical protein L916_04887, partial [Phytophthora parasitica]
 gb|ETL44908.1| hypothetical protein, variant 1, partial [Phytophthora parasitica]
 gb|ETL44909.1| hypothetical protein, variant 2, partial [Phytophthora parasitica]
Length=1011

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (51%), Gaps = 32/150 (21%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ALCKL P E+S L  A ++ ++  Y   L+ +GS   AM 
Sbjct  393  LPVAQQVAASMGNRRLEDAVALCKLCP-EESPLSDADQRKLYADYGFDLFRSGSRLGAMN  451

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
            +F  S++++  VL L+P  +LP+ A                      S+L  D  +N ++
Sbjct  452  YFFESEIDVMEVLLLFPRNLLPRKA----------------------SALRKDSNNNKNM  489

Query  252  -LESDETDIESKKMSHNTLMALIKFLQKKR  166
             LE DE  +ES       L+ALI FL++KR
Sbjct  490  TLEGDEL-VES-------LLALIGFLRRKR  511



>gb|ETM51227.1| hypothetical protein L914_04891, partial [Phytophthora parasitica]
 gb|ETM51228.1| hypothetical protein, variant 1, partial [Phytophthora parasitica]
 gb|ETM51229.1| hypothetical protein, variant 2, partial [Phytophthora parasitica]
 gb|ETO80361.1| hypothetical protein F444_05119, partial [Phytophthora parasitica 
P1976]
 gb|ETO80362.1| hypothetical protein, variant 1, partial [Phytophthora parasitica 
P1976]
 gb|ETO80363.1| hypothetical protein, variant 2, partial [Phytophthora parasitica 
P1976]
Length=1011

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (51%), Gaps = 32/150 (21%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ALCKL P E+S L  A ++ ++  Y   L+ +GS   AM 
Sbjct  393  LPVAQQVAASMGNRRLEDAVALCKLCP-EESPLSDADQRKLYADYGFDLFRSGSRLGAMN  451

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
            +F  S++++  VL L+P  +LP+ A                      S+L  D  +N ++
Sbjct  452  YFFESEIDVMEVLLLFPRNLLPRKA----------------------SALRKDSNNNKNM  489

Query  252  -LESDETDIESKKMSHNTLMALIKFLQKKR  166
             LE DE  +ES       L+ALI FL++KR
Sbjct  490  TLEGDEL-VES-------LLALIGFLRRKR  511



>gb|ETP21385.1| hypothetical protein F441_05078, partial [Phytophthora parasitica 
CJ01A1]
 gb|ETP21386.1| hypothetical protein, variant 1, partial [Phytophthora parasitica 
CJ01A1]
 gb|ETP21387.1| hypothetical protein, variant 2, partial [Phytophthora parasitica 
CJ01A1]
Length=1011

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (51%), Gaps = 32/150 (21%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ALCKL P E+S L  A ++ ++  Y   L+ +GS   AM 
Sbjct  393  LPVAQQVAASMGNRRLEDAVALCKLCP-EESPLSDADQRKLYADYGFDLFRSGSRLGAMN  451

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
            +F  S++++  VL L+P  +LP+ A                      S+L  D  +N ++
Sbjct  452  YFFESEIDVMEVLLLFPRNLLPRKA----------------------SALRKDSNNNKNM  489

Query  252  -LESDETDIESKKMSHNTLMALIKFLQKKR  166
             LE DE  +ES       L+ALI FL++KR
Sbjct  490  TLEGDEL-VES-------LLALIGFLRRKR  511



>gb|ETP49310.1| hypothetical protein F442_05136, partial [Phytophthora parasitica 
P10297]
 gb|ETP49311.1| hypothetical protein, variant 1, partial [Phytophthora parasitica 
P10297]
 gb|ETP49312.1| hypothetical protein, variant 2, partial [Phytophthora parasitica 
P10297]
Length=1011

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 75/150 (50%), Gaps = 32/150 (21%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ LCKL P E+S L  A ++ ++  Y   L+ +GS   AM 
Sbjct  393  LPVAQQVAASMGNRRLEDAVTLCKLCP-EESPLSDADQRKLYADYGFDLFRSGSRLGAMN  451

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
            +F  S++++  VL L+P  +LP+ A                      S+L  D  +N ++
Sbjct  452  YFFESEIDVMEVLLLFPRNLLPRKA----------------------SALRKDSNNNKNM  489

Query  252  -LESDETDIESKKMSHNTLMALIKFLQKKR  166
             LE DE  +ES       L+ALI FL++KR
Sbjct  490  TLEGDEL-VES-------LLALIGFLRRKR  511



>gb|ETI51606.1| hypothetical protein F443_05073, partial [Phytophthora parasitica 
P1569]
 gb|ETI51607.1| hypothetical protein, variant 1, partial [Phytophthora parasitica 
P1569]
 gb|ETI51608.1| hypothetical protein, variant 2, partial [Phytophthora parasitica 
P1569]
Length=1011

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 75/150 (50%), Gaps = 32/150 (21%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ALCKL P E+S L  A ++ ++      L+ +GS   AM 
Sbjct  393  LPVAQQVAASMGNRRLEDAVALCKLCP-EESPLSDADQRKLYADCGFDLFRSGSRLGAMN  451

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
            +F  S++++  VL L+P  +LP+ A                      S+L  D  +N ++
Sbjct  452  YFFESEIDVMEVLLLFPRNLLPRKA----------------------SALRKDSNNNKNM  489

Query  252  -LESDETDIESKKMSHNTLMALIKFLQKKR  166
             LE DE  +ES       L+ALI FL++KR
Sbjct  490  TLEGDEL-VES-------LLALIGFLRRKR  511



>gb|EPS66254.1| hypothetical protein M569_08522, partial [Genlisea aurea]
Length=315

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQ  595
            PYPLIQT VLRN R ++     + +ALE+SV+G FPVPLGAQ
Sbjct  274  PYPLIQTVVLRNARCILHKTAVIFIALESSVYGLFPVPLGAQ  315



>ref|XP_009526848.1| hypothetical protein PHYSODRAFT_331721 [Phytophthora sojae]
 gb|EGZ17790.1| hypothetical protein PHYSODRAFT_331721 [Phytophthora sojae]
Length=1065

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 76/163 (47%), Gaps = 33/163 (20%)
 Frame = -2

Query  630  VFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGS  451
            V  F  + +  Q+     +   E+A++LCKL P E+S L    ++ ++  Y   L+ +G 
Sbjct  404  VQSFQMLSIAQQVAASMGNRRLEDAVSLCKLCP-EESPLSDTDQRKLYADYGFKLFRSGH  462

Query  450  YEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDM  271
             +EAM  F  S +++  VL L+P  +LP+ A                      S+L  D 
Sbjct  463  RKEAMNFFFESDIDVMEVLLLFPRNLLPRKA----------------------SALHKDN  500

Query  270  ESNT--HILESDETDIESKKMSHNTLMALIKFLQKKRYGIIEK  148
             +N   H LE DE  +ES       L+ALI  L++KR   +++
Sbjct  501  SNNNKDHTLEGDEL-VES-------LLALIGLLRRKRNAYLQR  535



>ref|XP_005847817.1| hypothetical protein CHLNCDRAFT_134018 [Chlorella variabilis]
 gb|EFN55715.1| hypothetical protein CHLNCDRAFT_134018 [Chlorella variabilis]
Length=1118

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = -2

Query  615  PVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAM  436
            PV    Q  QL   G  EEALA+  L+P E +  R   E  IH+ Y   L+  G YEEAM
Sbjct  345  PVSFARQAEQLLGLGEHEEALAMAALIPLEQAEERRQLEDIIHLGYGRLLFRQGQYEEAM  404

Query  435  EHF-LASQVEITYVLSLYPSIILPK  364
             HF ++      ++L L+PS+  PK
Sbjct  405  LHFGMSGLAGPLHLLRLFPSLAPPK  429



>ref|XP_008613257.1| hypothetical protein SDRG_09121 [Saprolegnia diclina VS20]
 gb|EQC33134.1| hypothetical protein SDRG_09121 [Saprolegnia diclina VS20]
Length=913

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 17/108 (16%)
 Frame = -2

Query  609  PLGAQIVQLTASGNFEEALALCKLLPPE----DSSLRAAKEQSIHIRYAHYLYENGSYEE  442
            PL  Q+     +G ++EA+ LC+L P E    +  LRA     IH++ A   +E  ++ +
Sbjct  333  PLSDQLRLHLDAGRYQEAIDLCRLCPVECHLPNDDLRA-----IHLQLALQQFERHAFSQ  387

Query  441  AMEHFLASQVEITYVLSLYPSIILPKS------AVIPEPEKFVDMSGD  316
            AM++FLAS V    VL+L+P  +LP+S      A +P P   V ++GD
Sbjct  388  AMDNFLASHVPAEEVLALFPEELLPRSRHRLAMATLPRPS--VALAGD  433



>gb|KDO29045.1| hypothetical protein SPRG_06100 [Saprolegnia parasitica CBS 223.65]
Length=917

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 11/115 (10%)
 Frame = -2

Query  609  PLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEH  430
            PL  Q+     +G ++EA+ LC+L P E   L A + + IH++ A   +E   +  AM++
Sbjct  335  PLSDQLRLHLDAGRYQEAIDLCRLCPVE-CHLSADELRRIHLQLALQQFERHEFRRAMDN  393

Query  429  FLASQVEITYVLSLYPSIILPKS------AVIPEPEKFVDMSGDYPNLSRGSSSL  283
            FLAS V    VL+L+P  +LP+S      A +P P   V ++G+   LS   S+L
Sbjct  394  FLASHVPAEEVLALFPDELLPRSRHRLALATLPRPS--VALAGE--TLSAALSAL  444



>ref|XP_004751240.1| PREDICTED: vam6/Vps39-like protein isoform X1 [Mustela putorius 
furo]
Length=957

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 63/119 (53%), Gaps = 6/119 (5%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQS-NNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            P  L+Q+  L+  R +    +N + VA  + V+   PVP+  QI QL     FE AL L 
Sbjct  261  PRLLVQSIELQRPRFITSGGSNIIYVASNHFVWRLIPVPMATQIQQLLQDKQFELALQLA  320

Query  543  KLLPPEDSSLRAAKEQSIHIR--YAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSII  373
            ++   +D S    ++Q  HI+  YA YL+    ++E+M+ F     + T+V+ LYP ++
Sbjct  321  EM---KDDSDSEKQQQIHHIKNLYAFYLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLL  376



>ref|XP_004751241.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Mustela putorius 
furo]
 ref|XP_004796461.1| PREDICTED: vam6/Vps39-like protein [Mustela putorius furo]
Length=875

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 63/119 (53%), Gaps = 6/119 (5%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQS-NNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            P  L+Q+  L+  R +    +N + VA  + V+   PVP+  QI QL     FE AL L 
Sbjct  261  PRLLVQSIELQRPRFITSGGSNIIYVASNHFVWRLIPVPMATQIQQLLQDKQFELALQLA  320

Query  543  KLLPPEDSSLRAAKEQSIHIR--YAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSII  373
            ++   +D S    ++Q  HI+  YA YL+    ++E+M+ F     + T+V+ LYP ++
Sbjct  321  EM---KDDSDSEKQQQIHHIKNLYAFYLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLL  376



>gb|KFH64948.1| hypothetical protein MVEG_09676 [Mortierella verticillata NRRL 
6337]
Length=913

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 83/185 (45%), Gaps = 14/185 (8%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L+Q+A +   R L+     + +A  N V+   P     QI +L     +EEA++L   + 
Sbjct  308  LVQSADMPQARLLLTQGKLLYIASSNEVWRLIPNSFPRQIEELVQKEEYEEAISLINQID  367

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVI  352
            P           SI   +AH+L+    YEEA+  FL   V    V++LYP+ I   S+ +
Sbjct  368  PVHLDESVDTLGSIKKLHAHHLFSTHHYEEALSMFLDLNVPAAEVIALYPANI---SSHL  424

Query  351  PEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILESDETDIESKKMSHNTLMALIKFLQK  172
            P P+          ++   SS  S D+E+      + +  + S K   + +  LI+FL  
Sbjct  425  P-PQ----------DIEAVSSPKSADLEAAETKATNTQPSVMSTKELEDAVGCLIRFLAD  473

Query  171  KRYGI  157
            KR  I
Sbjct  474  KRQKI  478



>ref|XP_007783065.1| hypothetical protein W97_07002 [Coniosporium apollinis CBS 100218]
 gb|EON67748.1| hypothetical protein W97_07002 [Coniosporium apollinis CBS 100218]
Length=1036

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 72/151 (48%), Gaps = 16/151 (11%)
 Frame = -2

Query  723  VPYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALC  544
            VP P I          L  +    +VA +  ++    +   AQI  L +S  ++EA++L 
Sbjct  335  VPQPYIS---------LAHAGKGFLVASDRCIWRMGALEYEAQIDALVSSKRYDEAISLL  385

Query  543  KLLPPEDSSLR--AAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIIL  370
             +L  ED+ L+    + +   +R AH L+E   Y EA++ F  ++     V+SLYP ++ 
Sbjct  386  NML--EDTLLKDKVGRLRETKMRKAHGLFEQRKYREAIDLFSEAEAPPQRVISLYPRVVA  443

Query  369  PKSAVIPEPEKFVDMSGDYPNLSRGSSSLSD  277
               + I E E  +D   + P    G SS++D
Sbjct  444  GDLSTIEEKEDEIDGDNEEPA---GGSSVAD  471



>ref|XP_002899468.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61828.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=990

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 71/149 (48%), Gaps = 30/149 (20%)
 Frame = -2

Query  612  VPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAME  433
            +P+  Q+     +   E+A+ALCKL P E+S L  A ++ ++  Y   L+ +G  ++AM 
Sbjct  383  LPIAQQVAASMGNRRLEDAVALCKLCP-EESPLSDADQRKLYADYGFDLFRSGRRQDAMN  441

Query  432  HFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHI  253
                S++++  VL L+P  +LP+                     + S+   D+  +    
Sbjct  442  FLFESEIDVMEVLLLFPRNLLPR---------------------KTSALRKDNNNNKNRT  480

Query  252  LESDETDIESKKMSHNTLMALIKFLQKKR  166
            LE +E  +ES       L+AL  FL++KR
Sbjct  481  LEGEEL-VES-------LLALTGFLRRKR  501



>ref|XP_002678158.1| CNH domain-containing protein [Naegleria gruberi]
 gb|EFC45414.1| CNH domain-containing protein [Naegleria gruberi]
Length=905

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 55/101 (54%), Gaps = 0/101 (0%)
 Frame = -2

Query  660  NAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIR  481
            N + +A ++S++         Q  +L ++  FE AL LC  +      +   +  SIH +
Sbjct  323  NRIFLASKSSIYVMVMKQFDLQAGELLSNQQFELALHLCNTVENTRYKIEDWRVSSIHTQ  382

Query  480  YAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSA  358
            +  +L+  G +++AMEHF  ++ +   ++SL+P ++ PKS+
Sbjct  383  FGFHLFAKGEFDKAMEHFDKTKDDPRMIISLFPDLLPPKSS  423



>ref|XP_005090680.1| PREDICTED: vam6/Vps39-like protein-like isoform X2 [Aplysia californica]
Length=878

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 92/193 (48%), Gaps = 17/193 (9%)
 Frame = -2

Query  708  IQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPP  529
            IQ   L   R + Q + ++ VA  N+V+   PVP   QI QL     FE AL L +L   
Sbjct  269  IQDLTLPKARLICQGDGSIYVASPNNVWRLAPVPYSIQIRQLLQGKEFELALKLAEL-SK  327

Query  528  EDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS--AV  355
            E  S +  + ++I   YA  L+    +EE++  F     + ++V+ LYP+ +LP+     
Sbjct  328  EPESEKEKRIRNIKNLYAFELFCQRRFEESLTLFAKLGTDPSHVIGLYPN-LLPQDFRNK  386

Query  354  IPEPEKFVDMS---------GDYPNLSRGSSSLSDDME---SNTHILESDETDIESKKMS  211
            +  P K  D++         G    L++  + L  D++   S T I+E ++T    K++S
Sbjct  387  LEYPAKVPDLTDTECEKGYLGLIEYLTQKRNELLKDIDKEMSTTAIVEGNKTINSRKQLS  446

Query  210  HNTLMALIK-FLQ  175
                  L+K +LQ
Sbjct  447  QIIDTTLLKCYLQ  459



>ref|XP_005090679.1| PREDICTED: vam6/Vps39-like protein-like isoform X1 [Aplysia californica]
Length=911

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 92/193 (48%), Gaps = 17/193 (9%)
 Frame = -2

Query  708  IQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPP  529
            IQ   L   R + Q + ++ VA  N+V+   PVP   QI QL     FE AL L +L   
Sbjct  302  IQDLTLPKARLICQGDGSIYVASPNNVWRLAPVPYSIQIRQLLQGKEFELALKLAEL-SK  360

Query  528  EDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKS--AV  355
            E  S +  + ++I   YA  L+    +EE++  F     + ++V+ LYP+ +LP+     
Sbjct  361  EPESEKEKRIRNIKNLYAFELFCQRRFEESLTLFAKLGTDPSHVIGLYPN-LLPQDFRNK  419

Query  354  IPEPEKFVDMS---------GDYPNLSRGSSSLSDDME---SNTHILESDETDIESKKMS  211
            +  P K  D++         G    L++  + L  D++   S T I+E ++T    K++S
Sbjct  420  LEYPAKVPDLTDTECEKGYLGLIEYLTQKRNELLKDIDKEMSTTAIVEGNKTINSRKQLS  479

Query  210  HNTLMALIK-FLQ  175
                  L+K +LQ
Sbjct  480  QIIDTTLLKCYLQ  492



>ref|XP_003836838.1| similar to vacuolar morphogenesis protein AvaB [Leptosphaeria 
maculans JN3]
 emb|CBX93473.1| similar to vacuolar morphogenesis protein AvaB [Leptosphaeria 
maculans JN3]
Length=874

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 18/150 (12%)
 Frame = -2

Query  675  LVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQ  496
            L  +    +VA +  ++         QI QL A+G ++EAL+L  +L  ED+ L   +E+
Sbjct  346  LAHAGKGFLVASDRCIWRMGAQSYETQIDQLVANGRYDEALSLLNML--EDTLLLDKEER  403

Query  495  SIHIRY--AHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMS  322
               IR   AH L+++  Y+EAME F  ++     V++LYP  I    A    PE+ V   
Sbjct  404  VREIRMLKAHALFDHKKYQEAMELFTDARAPPERVIALYPRSIAGNLA----PEESV---  456

Query  321  GDYPNLSRGSSSLSDDMESNTHILESDETD  232
                   +G  S++D+ E      ++D  D
Sbjct  457  -------KGDGSVADEEEPTMERKDNDPKD  479



>ref|XP_005644041.1| hypothetical protein COCSUDRAFT_58773 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19497.1| hypothetical protein COCSUDRAFT_58773 [Coccomyxa subellipsoidea 
C-169]
Length=1090

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 81/191 (42%), Gaps = 28/191 (15%)
 Frame = -2

Query  666  SNNAVIVALENSVFG---FFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQ  496
            S+  V VA  +S  G     P P   Q   L   G F  AL L  L+P   +  R     
Sbjct  237  SSGDVFVASSSSDLGIRRLAPFPFADQASALAERGEFGAALELAALIPSTQAKARRTLND  296

Query  495  SIHIRYAHYLYENGSYEEAMEHF-LASQVEITYV-------LSLYPSIILPKSAVIPEPE  340
            ++HI+Y H+L+ +  Y+EAM HF + S+ ++T V            S++LP   ++    
Sbjct  297  TLHIQYGHHLFASKEYDEAMAHFGMCSRYKLTDVAEPKGKEYKKAVSVLLPY--LLSHRT  354

Query  339  KFVDMSGDYPNLSRGSSSLSDD---------------MESNTHILESDETDIESKKMSHN  205
            +   +  DY +    + S S +                E +  + E+ +T I    +  +
Sbjct  355  RLASVEQDYDDEEEAAESTSTEEERRHDTTAELSGLTAEQHAQLAEAVDTAILKAMLEMD  414

Query  204  TLMALIKFLQK  172
               AL++F+Q+
Sbjct  415  DTGALLRFVQR  425



>ref|XP_002941202.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_004911850.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 isoform X2 [Xenopus (Silurana) tropicalis]
Length=869

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 14/127 (11%)
 Frame = -2

Query  654  VIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYA  475
            VIVA  N V+   P+PL  QI  L +S   EEALAL K       + R   ++   + Y 
Sbjct  302  VIVASCNGVYVLIPLPLEKQIQDLLSSQRVEEALALAK------GARRNIPKEKFQVMYR  355

Query  474  HYLYENG-------SYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGD  316
              L + G        + EA E F +SQ++I  ++SLYP ++LP S+        +    D
Sbjct  356  RILQQAGFIQFAKLQFLEAKELFRSSQLDIRELISLYP-LMLPSSSSFIRTHPPLHEYAD  414

Query  315  YPNLSRG  295
               L+RG
Sbjct  415  LNQLTRG  421



>gb|EXX73335.1| Vam6p [Rhizophagus irregularis DAOM 197198w]
Length=599

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 78/167 (47%), Gaps = 28/167 (17%)
 Frame = -2

Query  624  GFFPVPLGAQIVQLTASGNFEEALALCK----LLPPEDSSLRAAKEQSIHIRYAHYLYEN  457
            G+    +G  I QL     F+EAL+L K    LL  +D+ +R  +       YAHYL+  
Sbjct  9    GYVKQSIG--IDQLVEQNEFDEALSLAKIEPTLLKDKDAKIRETRRL-----YAHYLFHQ  61

Query  456  GSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSD  277
              +++A+  F    V+   V++LYP  I   S  + +P +        P + + S  + D
Sbjct  62   NKFDDAITIFQELDVDPKEVIALYPPSI---SGALHKPVQ-------RPKVLKPSDEIVD  111

Query  276  DMESNTHILESDETDIESK-------KMSHNTLMALIKFLQKKRYGI  157
            D  +N    +S E +IE++       K+    +  LIKFL  +R+ I
Sbjct  112  DEINNDQEEKSSEDEIETENLEILEGKLLEEAVQTLIKFLTDRRHRI  158



>emb|CEG77263.1| hypothetical protein RMATCC62417_12049 [Rhizopus microsporus]
Length=381

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 55/113 (49%), Gaps = 1/113 (1%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L+Q   L N R L Q    V VA  + ++   P    +QI QL     ++EA++L   + 
Sbjct  176  LVQHIDLANTRFLNQ-GKLVYVASTSQIYRLTPYSFSSQIDQLVEKQEYKEAVSLLDQID  234

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSII  373
                  + AK  SI   YAH L+ +G Y++A+E F         V+SLYP +I
Sbjct  235  AVLVQDKEAKLTSIRTAYAHDLFRHGEYDKALELFQELDTSPEEVISLYPDMI  287



>emb|CBK20343.2| unnamed protein product [Blastocystis hominis]
Length=487

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = -2

Query  621  FFPVPLGAQIVQLTAS--GNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSY  448
            FF     AQI  L +    NF++AL LC L P     +R   +  I      YL+  G Y
Sbjct  341  FFLFVCNAQINILISDEYKNFDDALTLCNLFPRGKEMIRDQFKTQIARLKGLYLFSEGKY  400

Query  447  EEAMEHFLASQVEITYVLSLYPSII  373
            ++A+      QV    VLSLYPSII
Sbjct  401  DKAISFLQRGQVPTRQVLSLYPSII  425



>ref|XP_001805746.1| hypothetical protein SNOG_15601 [Phaeosphaeria nodorum SN15]
 gb|EAT76976.2| hypothetical protein SNOG_15601 [Phaeosphaeria nodorum SN15]
Length=1063

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 18/150 (12%)
 Frame = -2

Query  675  LVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSL--RAAK  502
            L  +    +VA +  ++         QI +L A G ++EAL+L  +L  ED+ L  +  +
Sbjct  345  LAHAGKGFLVASDRCIWRMGAESYATQIDELVAGGRYDEALSLLNML--EDTLLLDKEDR  402

Query  501  EQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMS  322
             + I I  AH L++   Y EAM+ F  ++     V+SLYPS I    A     E  V   
Sbjct  403  VREIMILKAHALFDMKKYREAMDLFTDAKAPPERVISLYPSAIAGSLAQ----EGSV---  455

Query  321  GDYPNLSRGSSSLSDDMESNTHILESDETD  232
                   +G+ S+ DD E+N     +D  D
Sbjct  456  -------KGTDSVGDDEEANGDKPTTDGKD  478



>emb|CBK23177.2| unnamed protein product [Blastocystis hominis]
Length=487

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = -2

Query  621  FFPVPLGAQIVQLTAS--GNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYLYENGSY  448
            FF     AQI  L +    NF++AL LC L P     +R   +  I      YL+  G Y
Sbjct  341  FFLFVCNAQINILISDEYKNFDDALTLCNLFPRGKEMIRDQFKTQIARLKGLYLFSEGKY  400

Query  447  EEAMEHFLASQVEITYVLSLYPSII  373
            ++A+      QV    VLSLYPSII
Sbjct  401  DKAISFLQRGQVPTRQVLSLYPSII  425



>ref|NP_001077023.1| transforming growth factor-beta receptor-associated protein 1 
homolog [Danio rerio]
 sp|A4IG72.1|TGFA1_DANRE RecName: Full=Transforming growth factor-beta receptor-associated 
protein 1 homolog; Short=TGF-beta receptor-associated protein 
1 homolog [Danio rerio]
 gb|AAI34957.1| Zgc:162302 protein [Danio rerio]
Length=863

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 22/153 (14%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L QT   R+ + L      V+VA   +V+   P+PL  QI  L AS   EEAL L     
Sbjct  278  LKQTLSFRDGQLLQDFEGKVVVASSKAVYMLVPLPLERQIQDLLASHRVEEALTL-----  332

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENG-------SYEEAMEHFLASQVEITYVLSLYPSII  373
              +++ R   ++   I +   L + G        + EA EHF   Q+++  ++SLYP ++
Sbjct  333  -TEAAQRNIPKEKYQILHRRILQQAGFIQFGQLQFLEAKEHFRKGQLDVRELISLYP-LL  390

Query  372  LPKSAVI----PEPEKFVDMS----GDYPNLSR  298
            LP S+      P   +F D++    GD   + R
Sbjct  391  LPASSSFTRCHPPLHEFADLNHLTQGDQEKVQR  423



>gb|EXX73336.1| Vam6p [Rhizophagus irregularis DAOM 197198w]
Length=607

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 74/157 (47%), Gaps = 26/157 (17%)
 Frame = -2

Query  594  IVQLTASGNFEEALALCK----LLPPEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHF  427
            I QL     F+EAL+L K    LL  +D+ +R  +       YAHYL+    +++A+  F
Sbjct  16   IDQLVEQNEFDEALSLAKIEPTLLKDKDAKIRETRRL-----YAHYLFHQNKFDDAITIF  70

Query  426  LASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSDDMESNTHILE  247
                V+   V++LYP  I   S  + +P +        P + + S  + DD  +N    +
Sbjct  71   QELDVDPKEVIALYPPSI---SGALHKPVQ-------RPKVLKPSDEIVDDEINNDQEEK  120

Query  246  SDETDIESK-------KMSHNTLMALIKFLQKKRYGI  157
            S E +IE++       K+    +  LIKFL  +R+ I
Sbjct  121  SSEDEIETENLEILEGKLLEEAVQTLIKFLTDRRHRI  157



>ref|XP_001729176.1| hypothetical protein MGL_3643 [Malassezia globosa CBS 7966]
 gb|EDP41962.1| hypothetical protein MGL_3643 [Malassezia globosa CBS 7966]
Length=792

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 70/157 (45%), Gaps = 25/157 (16%)
 Frame = -2

Query  630  VFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQSIHIRYAHYL--YEN  457
            ++   P P+  Q+  LT+SGN+ EALAL   L P          Q +HI+    L  + N
Sbjct  232  LYALEPSPVNDQLAALTSSGNYHEALALLDALDPALWP-HDIHNQRLHIQALVGLASFVN  290

Query  456  GSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMSGDYPNLSRGSSSLSD  277
            G ++ A++ F+ + +  TYVL+LYP  I                SG +       ++L D
Sbjct  291  GKFDVAVDLFIDTHMNPTYVLALYPETI----------------SGPHAQPPSSWATLFD  334

Query  276  DMESNTHILESDETDIESKKMSHNTLMALIKFLQKKR  166
                  H ++      E+K+ S   L AL ++L   R
Sbjct  335  AQIPWDHAVD------ETKRTSSEALDALARYLSDCR  365



>emb|CEG64743.1| hypothetical protein RMATCC62417_01664 [Rhizopus microsporus]
Length=910

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 1/113 (1%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L+Q   L N R L Q    V VA  + ++   P    +Q+ QL     ++EA++L   + 
Sbjct  292  LVQHIDLANTRFLNQGK-LVYVASTSQIYRLTPYSFSSQVDQLVEKQEYKEAVSLLDQID  350

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSII  373
                  + AK  SI   YAH L+ +G Y++A+E F         V+SLYP +I
Sbjct  351  AVLVQDKEAKLTSIRTAYAHDLFRHGEYDKALELFQELDTSPEEVISLYPDMI  403



>emb|CEI95304.1| hypothetical protein RMCBS344292_09494 [Rhizopus microsporus]
Length=858

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 1/113 (1%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L+Q   L N R L Q    V VA  + ++   P    +Q+ QL     ++EA++L   + 
Sbjct  283  LVQHIDLANTRFLNQGK-LVYVASTSQIYRLTPYSFSSQVDQLVEKQEYKEAVSLLDQID  341

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSII  373
                  + AK  SI   YAH L+ +G Y++A+E F         V+SLYP +I
Sbjct  342  AVLVQDKEAKLTSIRTAYAHDLFRHGEYDKALELFQELDTSPEEVISLYPDMI  394



>ref|XP_002670182.1| predicted protein [Naegleria gruberi]
 gb|EFC37438.1| predicted protein [Naegleria gruberi]
Length=1030

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 1/106 (1%)
 Frame = -2

Query  672  VQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSLRAAKEQS  493
            +  +N   +A +++++         Q  +L  +  FE  L +C+ +      L + + ++
Sbjct  192  IDPSNRCFLASKDAIYVIVMKQFDYQAGELLHNQQFERTLQICEAVENSIYKLESWRIEA  251

Query  492  IHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAV  355
            IH  Y  YL  NG + +AM HF    V+   ++SL+P +I P+S V
Sbjct  252  IHTEYGFYLVTNGDFGKAMVHFSKGNVDPRMIISLFPDLI-PRSIV  296



>emb|CEJ01119.1| hypothetical protein RMCBS344292_15155 [Rhizopus microsporus]
Length=810

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 1/113 (1%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L+Q   L N R L Q    V VA  + ++   P    +Q+ QL     ++EA++L   + 
Sbjct  192  LVQHIDLANTRFLNQGK-LVYVASTSQIYRLTPYSFSSQVDQLVEKQEYKEAVSLLDQID  250

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSII  373
                  + AK  SI   YAH L+ +G Y++A+E F         V+SLYP +I
Sbjct  251  AVLVQDKEAKLTSIRTAYAHDLFRHGEYDKALELFQELDTSPEEVISLYPDMI  303



>ref|XP_008021503.1| hypothetical protein SETTUDRAFT_174898 [Setosphaeria turcica 
Et28A]
 gb|EOA90746.1| hypothetical protein SETTUDRAFT_174898 [Setosphaeria turcica 
Et28A]
Length=1066

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (49%), Gaps = 18/140 (13%)
 Frame = -2

Query  675  LVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLPPEDSSL--RAAK  502
            L  +    +VA +  ++         QI +L A+G ++EAL+L  +L  ED+ L  +  +
Sbjct  346  LAHAGKGFLVASDRCIWRMGAQSYETQIDELVANGRYDEALSLLNML--EDTLLLDKEGR  403

Query  501  EQSIHIRYAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIILPKSAVIPEPEKFVDMS  322
             + I I  A  L+E   Y EAME F+ ++     V++LYP  I    A    PE+ V   
Sbjct  404  IREIQILKAQALFEIKKYREAMELFIDAKAPPERVIALYPRSIAGNLA----PEESV---  456

Query  321  GDYPNLSRGSSSLSDDMESN  262
                   +G  S++D+ E+N
Sbjct  457  -------KGDGSVTDEEETN  469



>ref|XP_005806816.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog [Xiphophorus maculatus]
Length=877

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 18/141 (13%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L QT   R+ R L      V++A   SV+   P+PL  QI  L AS   EEAL L     
Sbjct  281  LKQTLSFRDGRVLQDFEGKVMLASTKSVYVLVPLPLERQIQDLLASHRVEEALVL-----  335

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENG-------SYEEAMEHFLASQVEITYVLSLYPSII  373
              + + R   +    + Y   L + G        + EA EHF   ++++  ++SLYP ++
Sbjct  336  -TEGAQRNIPKDKFQVLYRRILQQAGFIKFGQLQFLEAKEHFRKGELDVRELISLYP-LL  393

Query  372  LPKSAVI----PEPEKFVDMS  322
            LP S+      P   +F D++
Sbjct  394  LPASSSFMRCHPPLHEFADLN  414



>ref|XP_011445059.1| PREDICTED: vam6/Vps39-like protein [Crassostrea gigas]
 gb|EKC27689.1| Vam6/Vps39-like protein [Crassostrea gigas]
Length=877

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 83/184 (45%), Gaps = 21/184 (11%)
 Frame = -2

Query  720  PYPLIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCK  541
            P  +IQ   L     + Q +  + ++ + SV+   P  L  QI QL  S  FE AL L  
Sbjct  266  PRLMIQNIPLSKAHTICQGSGHIYISSQTSVWKLTPRSLNFQIKQLLESKEFELALKLAD  325

Query  540  LLPPEDSSLRAAKEQSIH-IR--YAHYLYENGSYEEAMEHFLASQVEITYVLSLYPSIIL  370
            +   ED      K++ IH IR  YA + +    +EE+M  F+    + ++V+ LYP+ +L
Sbjct  326  M--TEDRP--EEKDRLIHRIRTLYAFHQFCQHKFEESMAIFVKLGTDPSHVIGLYPN-LL  380

Query  369  PK--SAVIPEPEKFVDMSG-----------DYPNLSRGSSSLSDDMESNTHILESDETDI  229
            P+     +  PE+  D+ G           DY    R   S   + E  T  ++  +  I
Sbjct  381  PQEFRNQLTYPERPPDLEGGELEKALLALQDYLTQKRKEVSKDINKEIETTAIKEGDVTI  440

Query  228  ESKK  217
            +SKK
Sbjct  441  KSKK  444



>ref|XP_009300553.1| PREDICTED: transforming growth factor-beta receptor-associated 
protein 1 homolog isoform X1 [Danio rerio]
Length=511

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 70/153 (46%), Gaps = 22/153 (14%)
 Frame = -2

Query  711  LIQTAVLRNVRRLVQSNNAVIVALENSVFGFFPVPLGAQIVQLTASGNFEEALALCKLLP  532
            L QT   R+ + L      V+VA   +V+   P+PL  QI  L  S   EEAL L     
Sbjct  278  LKQTLSFRDGQLLQDFEGKVVVASSKAVYMLVPLPLERQIQDLLTSHRVEEALTL-----  332

Query  531  PEDSSLRAAKEQSIHIRYAHYLYENG-------SYEEAMEHFLASQVEITYVLSLYPSII  373
              +++ R   ++   I +   L + G        + EA EHF   Q+++  ++SLYP ++
Sbjct  333  -TEAAQRNIPKEKYQILHRRILQQAGFIQFGQLQFLEAKEHFRKGQLDVRELISLYP-LL  390

Query  372  LPKSAVI----PEPEKFVDMS----GDYPNLSR  298
            LP S+      P   +F D++    GD   + R
Sbjct  391  LPASSSFTRCHPPLHEFADLNHLTQGDQEKVQR  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440