BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF005D19

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631700.1|  PREDICTED: squalene synthase                       288   6e-92   Nicotiana tomentosiformis
sp|P53800.1|FDFT_NICBE  RecName: Full=Squalene synthase; Short=SQ...    286   2e-91   Nicotiana benthamiana
ref|XP_009802568.1|  PREDICTED: squalene synthase                       285   6e-91   Nicotiana sylvestris
gb|AAB08578.1|  squalene synthase                                       285   6e-91   Nicotiana tabacum [American tobacco]
gb|AAY22201.1|  squalene synthase                                       280   3e-89   Datura inoxia [downy thornapple]
dbj|BAA82093.1|  squalene synthase                                      280   5e-89   Solanum tuberosum [potatoes]
gb|AAD20626.1|  squalene synthase                                       280   5e-89   Capsicum annuum
gb|AEX26929.1|  squalene synthase 1-1                                   280   5e-89   Solanum tuberosum [potatoes]
gb|ADW78251.1|  squalene synthase                                       279   1e-88   Withania somnifera [ashwagandha]
ref|XP_006362006.1|  PREDICTED: squalene synthase-like isoform X1       278   3e-88   Solanum tuberosum [potatoes]
gb|AEX26932.1|  squalene synthase                                       277   6e-88   Solanum chacoense
gb|AGS57530.1|  squalene synthase                                       277   8e-88   Solanum nigrum
gb|AEX26930.1|  squalene synthase 1-2                                   277   9e-88   Solanum tuberosum [potatoes]
ref|NP_001234716.1|  squalene synthase                                  275   3e-87   
gb|AGB05603.1|  squalene synthase                                       271   1e-85   Camellia oleifera [abura-tsubaki]
gb|AAB02945.1|  squalene synthase                                       268   1e-84   Nicotiana tabacum [American tobacco]
ref|XP_007042047.1|  Squalene synthase 1 isoform 1                      268   3e-84   
ref|XP_009594336.1|  PREDICTED: squalene synthase-like                  268   3e-84   Nicotiana tomentosiformis
ref|XP_009759256.1|  PREDICTED: squalene synthase-like                  267   6e-84   Nicotiana sylvestris
gb|AFR77735.1|  squalene synthase                                       267   7e-84   Camellia oleifera [abura-tsubaki]
ref|XP_006360639.1|  PREDICTED: squalene synthase-like                  265   5e-83   
gb|KJB12167.1|  hypothetical protein B456_002G004400                    260   7e-83   Gossypium raimondii
gb|ACS66750.1|  squalene synthase                                       264   1e-82   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_011088477.1|  PREDICTED: squalene synthase-like                  263   2e-82   Sesamum indicum [beniseed]
ref|XP_004248691.1|  PREDICTED: squalene synthase-like                  263   2e-82   Solanum lycopersicum
gb|KJB12168.1|  hypothetical protein B456_002G004400                    259   3e-82   Gossypium raimondii
gb|KJB32575.1|  hypothetical protein B456_005G247700                    259   3e-82   Gossypium raimondii
emb|CDP20866.1|  unnamed protein product                                263   4e-82   Coffea canephora [robusta coffee]
ref|XP_002266150.1|  PREDICTED: squalene synthase                       262   4e-82   Vitis vinifera
gb|ACN69082.1|  squalene synthase                                       262   6e-82   Diospyros kaki [Japanese persimmon]
gb|ADG36709.1|  squalene synthase 1                                     261   7e-82   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36702.1|  squalene synthase 1                                     261   1e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36707.1|  squalene synthase 1                                     261   1e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|KHG01756.1|  Squalene synthase                                       260   3e-81   Gossypium arboreum [tree cotton]
gb|ADG36705.1|  squalene synthase 1                                     260   3e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36708.1|  squalene synthase 1                                     259   4e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|KJB12166.1|  hypothetical protein B456_002G004400                    259   4e-81   Gossypium raimondii
gb|KJB12171.1|  hypothetical protein B456_002G004400                    259   5e-81   Gossypium raimondii
gb|KJB32578.1|  hypothetical protein B456_005G247700                    259   8e-81   Gossypium raimondii
gb|KJB32577.1|  hypothetical protein B456_005G247700                    258   9e-81   Gossypium raimondii
gb|AFJ15526.1|  squalene synthase                                       258   1e-80   Azadirachta indica [Indian-lilac]
ref|XP_002313765.1|  squalene synthase family protein                   259   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_011047498.1|  PREDICTED: squalene synthase isoform X1            258   1e-80   Populus euphratica
gb|KJB32574.1|  hypothetical protein B456_005G247700                    258   2e-80   Gossypium raimondii
dbj|BAA13083.1|  squalene synthase                                      258   2e-80   Glycyrrhiza glabra
gb|AED99863.1|  squalene synthase                                       258   2e-80   Panax quinquefolius
gb|AER23670.1|  squalene synthase                                       258   2e-80   Eleutherococcus senticosus
gb|ACT52826.1|  squalene synthase 1                                     258   2e-80   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36704.1|  squalene synthase 1                                     258   2e-80   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36703.1|  squalene synthase 1                                     258   2e-80   Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ77652.1|  squalene synthase 1                                    257   4e-80   Glycyrrhiza uralensis [Chinese licorice]
gb|KHN25422.1|  Squalene synthase                                       257   5e-80   Glycine soja [wild soybean]
ref|XP_010039888.1|  PREDICTED: squalene synthase-like isoform X2       257   6e-80   Eucalyptus grandis [rose gum]
ref|XP_010109768.1|  hypothetical protein L484_008444                   256   6e-80   Morus notabilis
ref|XP_010039880.1|  PREDICTED: squalene synthase-like isoform X1       257   7e-80   Eucalyptus grandis [rose gum]
gb|ADC95435.1|  squalene synthase                                       256   8e-80   Withania somnifera [ashwagandha]
gb|ADC32654.1|  squalene synthase                                       256   1e-79   Aralia elata
ref|XP_010066209.1|  PREDICTED: squalene synthase                       256   1e-79   Eucalyptus grandis [rose gum]
gb|EYU42585.1|  hypothetical protein MIMGU_mgv1a007225mg                256   2e-79   Erythranthe guttata [common monkey flower]
gb|ABX10442.1|  squalene synthase 2                                     255   2e-79   Gossypium hirsutum [American cotton]
ref|XP_011092839.1|  PREDICTED: squalene synthase-like                  255   2e-79   Sesamum indicum [beniseed]
ref|XP_008236983.1|  PREDICTED: squalene synthase-like                  255   2e-79   Prunus mume [ume]
gb|ACU21003.1|  unknown                                                 255   3e-79   Glycine max [soybeans]
gb|ADD54645.1|  squalene synthase                                       255   3e-79   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_006591920.1|  PREDICTED: squalene synthase isoform X2            255   3e-79   
gb|ADG36699.1|  squalene synthase 1                                     254   4e-79   Glycyrrhiza uralensis [Chinese licorice]
gb|ACV88718.1|  squalene synthase                                       255   4e-79   Panax ginseng [Asiatic ginseng]
gb|ACZ71037.1|  squalene synthase                                       254   4e-79   Panax ginseng [Asiatic ginseng]
emb|CAJ77654.1|  squalene synthase 1                                    254   4e-79   Glycyrrhiza eurycarpa
ref|XP_002512982.1|  farnesyl-diphosphate farnesyltransferase, pu...    254   5e-79   
dbj|BAH23428.1|  squalene synthetase                                    254   6e-79   Euphorbia tirucalli
gb|AIK21786.1|  squalene synthase                                       254   7e-79   Panax notoginseng [san-qi]
gb|KDP41726.1|  hypothetical protein JCGZ_26744                         254   7e-79   Jatropha curcas
ref|XP_007199882.1|  hypothetical protein PRUPE_ppa006420mg             254   8e-79   
dbj|BAA24289.1|  squalene synthase                                      254   8e-79   Panax ginseng [Asiatic ginseng]
gb|EYU37850.1|  hypothetical protein MIMGU_mgv1a007228mg                254   1e-78   Erythranthe guttata [common monkey flower]
gb|ABA29019.1|  squalene synthase                                       254   1e-78   Panax notoginseng [san-qi]
gb|KHG07441.1|  Squalene synthase                                       253   1e-78   Gossypium arboreum [tree cotton]
ref|XP_003537842.1|  PREDICTED: squalene synthase-like isoform X1       253   1e-78   Glycine max [soybeans]
ref|XP_004507500.1|  PREDICTED: squalene synthase-like                  253   1e-78   Cicer arietinum [garbanzo]
ref|XP_010263865.1|  PREDICTED: squalene synthase-like                  253   1e-78   Nelumbo nucifera [Indian lotus]
gb|AEA41713.1|  squalene synthase                                       253   1e-78   Eleutherococcus senticosus
gb|AGI19256.1|  squalene synthase                                       253   1e-78   Panax notoginseng [san-qi]
ref|NP_001236365.1|  squalene synthase                                  253   1e-78   
gb|AEA41712.1|  squalene synthase                                       253   1e-78   Eleutherococcus senticosus
emb|CAJ58418.1|  squalene synthase                                      253   2e-78   Panax quinquefolius
emb|CAD23250.1|  farnesyl-diphosphate farnesyltransferase               253   2e-78   Medicago truncatula
gb|ACA66014.1|  squalene synthase                                       253   2e-78   Panax ginseng [Asiatic ginseng]
gb|AFZ93644.1|  squalene synthetase                                     253   2e-78   Euphorbia lathyris
ref|XP_011037190.1|  PREDICTED: squalene synthase-like                  253   3e-78   Populus euphratica
emb|CAJ58419.1|  squalene synthase                                      252   4e-78   Panax quinquefolius
ref|XP_009376518.1|  PREDICTED: squalene synthase-like                  252   5e-78   Pyrus x bretschneideri [bai li]
ref|XP_002305455.2|  hypothetical protein POPTR_0004s16830g             253   6e-78   
gb|AFK36923.1|  unknown                                                 251   6e-78   Medicago truncatula
gb|AFT92039.1|  squalene synthase                                       251   7e-78   Euphorbia pekinensis
gb|ADG36701.1|  squalene synthase 1                                     251   7e-78   Glycyrrhiza uralensis [Chinese licorice]
gb|ADX01171.1|  putative squalene synthase                              251   8e-78   Bacopa monnieri
ref|XP_008461009.1|  PREDICTED: squalene synthase-like                  251   8e-78   Cucumis melo [Oriental melon]
ref|XP_004150142.1|  PREDICTED: squalene synthase-like                  251   9e-78   
gb|ACQ90302.1|  squalene synthase                                       251   1e-77   Gynostemma pentaphyllum [jiaogulan]
dbj|BAC56854.1|  squalene synthase                                      251   1e-77   Lotus japonicus
gb|ACX42423.1|  squalene synthase                                       251   1e-77   Bupleurum chinense
gb|AGS78117.1|  squalene synthase 1                                     250   2e-77   Malus domestica [apple tree]
gb|ADG36711.1|  squalene synthase 1                                     250   2e-77   Glycyrrhiza uralensis [Chinese licorice]
emb|CAN81937.1|  hypothetical protein VITISV_028001                     251   2e-77   Vitis vinifera
gb|ADG36706.1|  squalene synthase 1                                     250   2e-77   Glycyrrhiza uralensis [Chinese licorice]
gb|ADV57358.1|  squalene synthase                                       250   2e-77   Astragalus membranaceus
gb|ADW27427.1|  squalene synthase                                       250   2e-77   Astragalus membranaceus
gb|KJB12169.1|  hypothetical protein B456_002G004400                    250   3e-77   Gossypium raimondii
ref|XP_003607040.1|  Squalene synthase                                  249   4e-77   
ref|XP_006591919.1|  PREDICTED: squalene synthase isoform X1            250   8e-77   
emb|CDX72493.1|  BnaC07g45150D                                          249   8e-77   
gb|ACX42425.1|  squalene synthase                                       248   9e-77   Bupleurum chinense
ref|XP_009378420.1|  PREDICTED: squalene synthase-like                  247   3e-76   Pyrus x bretschneideri [bai li]
gb|AFK29283.1|  putative squalene synthase 1                            246   7e-76   Salvia miltiorrhiza [Chinese salvia]
gb|ADG36717.1|  squalene synthase 2                                     246   1e-75   Glycyrrhiza uralensis [Chinese licorice]
gb|ACS66749.1|  squalene synthase                                       246   1e-75   Glycyrrhiza uralensis [Chinese licorice]
gb|AAY46017.1|  squalene synthase                                       246   1e-75   Bupleurum falcatum
ref|XP_009138312.1|  PREDICTED: squalene synthase-like                  246   1e-75   Brassica rapa
emb|CDY45322.1|  BnaA03g52950D                                          245   2e-75   Brassica napus [oilseed rape]
gb|AAR20329.1|  squalene synthase                                       245   2e-75   Artemisia annua [sweet Annie]
gb|ABQ96265.1|  squalene synthase                                       245   2e-75   Psammosilene tunicoides
gb|AEM42980.1|  squalene synthase                                       245   3e-75   Siraitia grosvenorii [arhat fruit]
gb|KDO43891.1|  hypothetical protein CISIN_1g015087mg                   238   3e-75   Citrus sinensis [apfelsine]
ref|XP_006412201.1|  hypothetical protein EUTSA_v10025338mg             244   3e-75   Eutrema salsugineum [saltwater cress]
gb|ADG36719.1|  squalene synthase 2                                     244   3e-75   Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ77653.1|  squalene synthase 2                                    244   3e-75   Glycyrrhiza uralensis [Chinese licorice]
gb|AFI33135.3|  squalene synthase                                       244   3e-75   Eriobotrya japonica [loquat]
ref|XP_006283828.1|  hypothetical protein CARUB_v10004929mg             244   4e-75   Capsella rubella
gb|ACR57219.1|  squalene synthase                                       244   4e-75   Salvia miltiorrhiza [Chinese salvia]
gb|AAR20328.1|  squalene synthase                                       244   4e-75   Artemisia annua [sweet Annie]
dbj|BAA13084.1|  squalene synthase                                      244   4e-75   Glycyrrhiza glabra
gb|AFK29284.1|  putative squalene synthase 2                            244   5e-75   Salvia miltiorrhiza [Chinese salvia]
gb|ACX42426.1|  squalene synthase                                       244   6e-75   Bupleurum chinense
ref|XP_007131767.1|  hypothetical protein PHAVU_011G040100g             244   6e-75   Phaseolus vulgaris [French bean]
gb|AHA84150.1|  squalene synthase                                       244   7e-75   Phaseolus vulgaris [French bean]
emb|CDY17472.1|  BnaC03g65910D                                          244   1e-74   Brassica napus [oilseed rape]
ref|XP_002869133.1|  hypothetical protein ARALYDRAFT_912921             243   1e-74   Arabidopsis lyrata subsp. lyrata
gb|ACT52825.1|  squalene synthase 2                                     243   1e-74   Glycyrrhiza uralensis [Chinese licorice]
ref|NP_001280921.1|  squalene synthase-like                             243   1e-74   Malus domestica [apple tree]
ref|XP_009108714.1|  PREDICTED: squalene synthase-like isoform X1       242   2e-74   Brassica rapa
ref|XP_010548076.1|  PREDICTED: squalene synthase-like isoform X2       242   3e-74   Tarenaya hassleriana [spider flower]
gb|ABG66304.1|  squalene synthase                                       242   4e-74   Polygala tenuifolia [Chinese senega-root]
gb|AAV58897.1|  squalene synthase                                       242   4e-74   Centella asiatica [Asiatic pennywort]
ref|XP_006487315.1|  PREDICTED: squalene synthase isoform X2            238   4e-74   
emb|CDX69075.1|  BnaC01g03780D                                          241   4e-74   
gb|KFK30097.1|  hypothetical protein AALP_AA7G216600                    241   5e-74   Arabis alpina [alpine rockcress]
emb|CAJ77655.1|  squalene synthase 2                                    241   6e-74   Glycyrrhiza eurycarpa
ref|XP_010432389.1|  PREDICTED: squalene synthase                       241   6e-74   Camelina sativa [gold-of-pleasure]
emb|CDX75450.1|  BnaA01g02520D                                          240   8e-74   
emb|CDX76294.1|  BnaA08g11060D                                          240   1e-73   
ref|XP_009110610.1|  PREDICTED: squalene synthase                       240   2e-73   
ref|XP_011458278.1|  PREDICTED: squalene synthase-like isoform X2       240   2e-73   Fragaria vesca subsp. vesca
gb|AAG14896.2|AF302464_1  squalene synthase                             239   6e-73   Artemisia annua [sweet Annie]
ref|XP_010437580.1|  PREDICTED: squalene synthase-like isoform X2       238   8e-73   Camelina sativa [gold-of-pleasure]
ref|XP_004290304.1|  PREDICTED: squalene synthase-like isoform X1       238   1e-72   Fragaria vesca subsp. vesca
gb|ACX42424.1|  squalene synthase                                       238   2e-72   Bupleurum chinense
ref|XP_010548075.1|  PREDICTED: squalene synthase-like isoform X1       237   2e-72   Tarenaya hassleriana [spider flower]
ref|NP_195190.1|  Squalene synthase 1                                   237   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447048.1|  PREDICTED: squalene synthase-like                  237   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006423444.1|  hypothetical protein CICLE_v10028537mg             232   3e-72   
ref|XP_006487314.1|  PREDICTED: squalene synthase isoform X1            237   3e-72   
gb|AIX97193.1|  squalene synthase                                       235   2e-71   Matricaria chamomilla var. recutita [German chamomile]
ref|XP_009619298.1|  PREDICTED: squalene synthase-like                  234   3e-71   
ref|XP_006423443.1|  hypothetical protein CICLE_v10028537mg             233   3e-71   
ref|XP_010690775.1|  PREDICTED: squalene synthase-like                  234   3e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010526913.1|  PREDICTED: squalene synthase-like                  234   5e-71   
ref|XP_010690774.1|  PREDICTED: squalene synthase-like                  233   7e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009760451.1|  PREDICTED: squalene synthase-like                  233   1e-70   Nicotiana sylvestris
ref|XP_006423442.1|  hypothetical protein CICLE_v10028537mg             232   2e-70   
ref|XP_006351216.1|  PREDICTED: squalene synthase-like                  232   2e-70   Solanum tuberosum [potatoes]
ref|XP_010027379.1|  PREDICTED: squalene synthase-like                  227   3e-70   
ref|XP_010437579.1|  PREDICTED: squalene synthase-like isoform X1       231   8e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006841632.1|  hypothetical protein AMTR_s00003p00232080          230   1e-69   Amborella trichopoda
ref|XP_010065915.1|  PREDICTED: squalene synthase-like                  230   2e-69   Eucalyptus grandis [rose gum]
ref|XP_004249733.1|  PREDICTED: squalene synthase-like isoform X1       228   6e-69   Solanum lycopersicum
ref|XP_010025621.1|  PREDICTED: squalene synthase-like                  227   2e-68   Eucalyptus grandis [rose gum]
emb|CDX69076.1|  BnaC01g03770D                                          226   7e-68   
ref|XP_010025618.1|  PREDICTED: squalene synthase-like                  225   1e-67   Eucalyptus grandis [rose gum]
ref|XP_009769885.1|  PREDICTED: squalene synthase-like                  224   2e-67   Nicotiana sylvestris
ref|XP_009110500.1|  PREDICTED: squalene synthase                       224   2e-67   Brassica rapa
gb|AAB61927.1|  squalene synthase 2                                     224   2e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75451.1|  BnaA01g02510D                                          224   3e-67   
ref|XP_010312074.1|  PREDICTED: squalene synthase-like isoform X2       223   5e-67   
gb|KDO43893.1|  hypothetical protein CISIN_1g015087mg                   222   6e-67   Citrus sinensis [apfelsine]
gb|KDO43892.1|  hypothetical protein CISIN_1g015087mg                   222   7e-67   Citrus sinensis [apfelsine]
gb|AGN32410.1|  squalene synthase                                       223   9e-67   Dioscorea zingiberensis
ref|NP_195191.2|  squalene synthase 2                                   222   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437577.1|  PREDICTED: squalene synthase-like isoform X1       222   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008795796.1|  PREDICTED: squalene synthase-like isoform X1       221   4e-66   Phoenix dactylifera
ref|XP_010447047.1|  PREDICTED: squalene synthase-like                  220   1e-65   Camelina sativa [gold-of-pleasure]
gb|AFN61199.1|  squalene synthase                                       219   1e-65   Chlorophytum borivilianum
ref|XP_008796678.1|  PREDICTED: squalene synthase-like isoform X1       219   2e-65   Phoenix dactylifera
ref|XP_008796681.1|  PREDICTED: squalene synthase-like isoform X2       219   2e-65   Phoenix dactylifera
gb|KFK30098.1|  hypothetical protein AALP_AA7G216700                    218   5e-65   Arabis alpina [alpine rockcress]
ref|XP_002869132.1|  squalene synthase 2                                218   6e-65   
ref|XP_010432387.1|  PREDICTED: squalene synthase-like                  218   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010934354.1|  PREDICTED: squalene synthase-like                  217   1e-64   Elaeis guineensis
ref|XP_009396917.1|  PREDICTED: squalene synthase-like                  216   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGW25489.1|  squalene synthase                                       216   4e-64   Paris polyphylla var. yunnanensis
gb|AHB20141.2|  squalene synthase                                       214   2e-63   Fritillaria thunbergii
ref|XP_010437578.1|  PREDICTED: squalene synthase-like isoform X2       213   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006412200.1|  hypothetical protein EUTSA_v10025392mg             212   7e-63   
gb|AFY63035.1|  squalene synthase                                       213   7e-63   Alisma plantago-aquatica subsp. orientale
ref|XP_009389044.1|  PREDICTED: squalene synthase-like                  212   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY92248.1|  hypothetical protein OsI_13969                          211   2e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001051625.1|  Os03g0805100                                       210   4e-62   
gb|EEE60131.1|  hypothetical protein OsJ_13016                          211   4e-62   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99680.1|  predicted protein                                      205   9e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004981370.1|  PREDICTED: squalene synthase-like                  204   8e-61   
ref|NP_001104839.1|  squalene synthase1                                 206   1e-60   Zea mays [maize]
ref|XP_003559279.1|  PREDICTED: squalene synthase-like                  206   1e-60   Brachypodium distachyon [annual false brome]
dbj|BAJ87710.1|  predicted protein                                      205   6e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006651930.1|  PREDICTED: squalene synthase-like                  204   7e-60   Oryza brachyantha
gb|AGI56082.1|  squalene synthase                                       204   9e-60   Dendrobium officinale
ref|XP_008795798.1|  PREDICTED: squalene synthase-like isoform X2       202   2e-59   
emb|CDX72494.1|  BnaC07g45160D                                          203   2e-59   
gb|AIW04729.1|  squalene synthase                                       204   2e-59   Dryopteris fragrans
gb|EMT03383.1|  Squalene synthetase                                     204   2e-59   
ref|XP_006351382.1|  PREDICTED: squalene synthase-like                  202   4e-59   
gb|ACN33457.1|  unknown                                                 199   5e-59   Zea mays [maize]
ref|XP_007042048.1|  Squalene synthase 1 isoform 2                      199   5e-59   
gb|AFS28708.1|  putative squalene synthase                              195   5e-59   Olea europaea
ref|XP_002466259.1|  hypothetical protein SORBIDRAFT_01g004550          201   2e-58   Sorghum bicolor [broomcorn]
tpg|DAA52015.1|  TPA: hypothetical protein ZEAMMB73_299336              197   2e-58   
ref|XP_003564211.1|  PREDICTED: squalene synthase-like                  200   3e-58   Brachypodium distachyon [annual false brome]
gb|AHI96421.1|  squalene synthase                                       200   5e-58   Pinus massoniana [Chinese red pine]
gb|EYU37849.1|  hypothetical protein MIMGU_mgv1a007228mg                197   9e-58   Erythranthe guttata [common monkey flower]
ref|NP_001130502.1|  uncharacterized protein LOC100191601               198   2e-57   
gb|ABK24732.1|  unknown                                                 197   5e-57   Picea sitchensis
ref|XP_011047507.1|  PREDICTED: squalene synthase isoform X2            196   5e-57   Populus euphratica
tpg|DAA52014.1|  TPA: hypothetical protein ZEAMMB73_299336              197   5e-57   
ref|XP_006658375.1|  PREDICTED: squalene synthase-like                  196   6e-57   
ref|XP_006285747.1|  hypothetical protein CARUB_v10007220mg             193   3e-55   Capsella rubella
gb|EMS67019.1|  Squalene synthase                                       192   3e-55   Triticum urartu
gb|ABI14439.1|  squalene synthase                                       191   9e-55   Taxus cuspidata [ichii]
ref|NP_001059129.1|  Os07g0200700                                       191   9e-55   
gb|AEX58673.1|  squalene synthase                                       182   2e-51   Huperzia serrata [toothed club-moss]
ref|XP_002971951.1|  hypothetical protein SELMODRAFT_96714              170   6e-47   
ref|XP_001775898.1|  predicted protein                                  169   3e-46   
ref|XP_001773253.1|  predicted protein                                  166   4e-46   
ref|XP_009138586.1|  PREDICTED: squalene synthase-like                  163   2e-45   
ref|XP_008796682.1|  PREDICTED: squalene synthase-like isoform X3       157   6e-42   
emb|CEF97547.1|  Squalene/phytoene synthase                             155   3e-41   Ostreococcus tauri
ref|XP_001756673.1|  predicted protein                                  153   3e-40   
gb|KDO43895.1|  hypothetical protein CISIN_1g015087mg                   146   3e-38   Citrus sinensis [apfelsine]
gb|KIZ04121.1|  farnesyl-diphosphatefarnesyltransferase                 149   3e-38   Monoraphidium neglectum
ref|XP_001417488.1|  predicted protein                                  146   2e-37   Ostreococcus lucimarinus CCE9901
ref|XP_001703447.1|  farnesyl-diphosphate farnesyltransferase           144   4e-37   Chlamydomonas reinhardtii
gb|EEC81691.1|  hypothetical protein OsI_25282                          135   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_629811.1|  farnesyl-diphosphate farnesyltransferase              138   1e-34   Dictyostelium discoideum AX4
ref|XP_007512409.1|  squalene synthase                                  136   8e-34   Bathycoccus prasinos
ref|XP_006115891.1|  PREDICTED: squalene synthase-like                  135   1e-33   
ref|XP_003283681.1|  farnesyl-diphosphate farnesyltransferase           135   1e-33   Dictyostelium purpureum
ref|XP_002588443.1|  hypothetical protein BRAFLDRAFT_198742             131   1e-33   Branchiostoma floridae
ref|XP_005651444.1|  farnesyl-diphosphate farnesyltransferase           134   2e-33   Coccomyxa subellipsoidea C-169
ref|XP_003058046.1|  predicted protein                                  134   3e-33   Micromonas pusilla CCMP1545
ref|XP_010200276.1|  PREDICTED: squalene synthase                       132   5e-33   Colius striatus
ref|XP_002501456.1|  predicted protein                                  133   8e-33   Micromonas commoda
ref|XP_010706473.1|  PREDICTED: squalene synthase                       131   1e-32   Meleagris gallopavo [common turkey]
ref|XP_008943984.1|  PREDICTED: squalene synthase                       131   1e-32   Merops nubicus
ref|XP_006008978.1|  PREDICTED: squalene synthase                       132   1e-32   
gb|KFP31735.1|  Squalene synthase                                       131   2e-32   Colius striatus
gb|KFQ22809.1|  Squalene synthase                                       130   2e-32   Merops nubicus
ref|XP_010072080.1|  PREDICTED: squalene synthase                       129   4e-32   Pterocles gutturalis
ref|XP_002946755.1|  hypothetical protein VOLCADRAFT_79344              131   5e-32   Volvox carteri f. nagariensis
ref|XP_009465636.1|  PREDICTED: squalene synthase                       129   5e-32   Nipponia nippon
ref|XP_009094381.1|  PREDICTED: squalene synthase-like                  129   6e-32   
ref|XP_009819304.1|  PREDICTED: squalene synthase                       128   9e-32   Gavia stellata
ref|XP_007429053.1|  PREDICTED: squalene synthase isoform X1            130   9e-32   Python bivittatus
ref|XP_009579009.1|  PREDICTED: squalene synthase                       128   9e-32   Fulmarus glacialis
gb|KFQ99234.1|  Squalene synthase                                       129   1e-31   Nipponia nippon
ref|NP_001034383.1|  squalene synthase                                  130   1e-31   Gallus gallus [bantam]
ref|XP_010286029.1|  PREDICTED: squalene synthase                       128   1e-31   Phaethon lepturus
ref|XP_009940610.1|  PREDICTED: squalene synthase                       128   1e-31   Opisthocomus hoazin [hoatzin]
ref|XP_010021685.1|  PREDICTED: squalene synthase                       128   1e-31   Nestor notabilis
ref|XP_010119923.1|  PREDICTED: squalene synthase                       128   1e-31   Chlamydotis macqueenii
ref|XP_004358616.1|  farnesyl-diphosphate farnesyltransferase           132   1e-31   Cavenderia fasciculata
gb|KFQ67434.1|  Squalene synthase                                       128   2e-31   Phaethon lepturus
ref|XP_009317975.1|  PREDICTED: squalene synthase                       128   2e-31   
gb|KFR16753.1|  Squalene synthase                                       128   2e-31   
gb|KFP42539.1|  Squalene synthase                                       128   2e-31   
gb|KFQ43993.1|  Squalene synthase                                       128   2e-31   
gb|EFA80770.1|  farnesyl-diphosphate farnesyltransferase                129   2e-31   
ref|XP_009287225.1|  PREDICTED: squalene synthase                       128   2e-31   
ref|XP_010000497.1|  PREDICTED: squalene synthase                       127   2e-31   
gb|KFM13981.1|  Squalene synthase                                       128   3e-31   
ref|XP_010186209.1|  PREDICTED: squalene synthase                       127   3e-31   
ref|XP_009886241.1|  PREDICTED: squalene synthase                       127   3e-31   
ref|XP_010581427.1|  PREDICTED: squalene synthase isoform X1            128   3e-31   
ref|XP_005146462.1|  PREDICTED: squalene synthase                       129   3e-31   
ref|XP_008917712.1|  PREDICTED: squalene synthase                       127   3e-31   
ref|XP_010146008.1|  PREDICTED: squalene synthase                       127   4e-31   
gb|EOA95205.1|  Squalene synthetase                                     127   4e-31   
gb|KFW64115.1|  Squalene synthase                                       127   4e-31   
ref|XP_005028302.1|  PREDICTED: squalene synthase                       127   4e-31   
gb|KFU93067.1|  Squalene synthase                                       127   4e-31   
ref|XP_009638212.1|  PREDICTED: squalene synthase                       127   4e-31   
gb|KFQ38302.1|  Squalene synthase                                       127   4e-31   
gb|KFQ73762.1|  Squalene synthase                                       127   5e-31   
gb|KGL95687.1|  Squalene synthase                                       127   5e-31   
sp|Q9SDW9.1|BSS_BOTBR  RecName: Full=Squalene synthase                  128   5e-31   
ref|XP_008170096.1|  PREDICTED: squalene synthase                       128   6e-31   
ref|XP_009957016.1|  PREDICTED: squalene synthase                       126   6e-31   
gb|KFP16881.1|  Squalene synthase                                       127   7e-31   
ref|XP_010305165.1|  PREDICTED: squalene synthase                       126   8e-31   
ref|XP_010211000.1|  PREDICTED: squalene synthase                       126   8e-31   
ref|XP_010409682.1|  PREDICTED: squalene synthase                       126   9e-31   
gb|KFQ15889.1|  Squalene synthase                                       126   9e-31   
ref|XP_009078811.1|  PREDICTED: squalene synthase                       126   9e-31   
ref|XP_009986797.1|  PREDICTED: squalene synthase                       126   9e-31   
ref|XP_009906050.1|  PREDICTED: squalene synthase isoform X2            126   9e-31   
gb|KFW77295.1|  Squalene synthase                                       127   1e-30   
ref|XP_002114185.1|  hypothetical protein TRIADDRAFT_27912              127   1e-30   
gb|KFW01543.1|  Squalene synthase                                       127   1e-30   
ref|XP_005443614.1|  PREDICTED: squalene synthase                       126   1e-30   
gb|KFO13053.1|  Squalene synthase                                       126   1e-30   
ref|XP_008490611.1|  PREDICTED: squalene synthase                       125   1e-30   
ref|XP_005709250.1|  farnesyl-diphosphate farnesyltransferase           123   1e-30   
gb|KGL75930.1|  Squalene synthase                                       126   1e-30   
gb|KFV19358.1|  Squalene synthase                                       125   1e-30   
gb|KFP86331.1|  Squalene synthase                                       125   2e-30   
ref|XP_010165413.1|  PREDICTED: squalene synthase                       125   2e-30   
ref|XP_009921323.1|  PREDICTED: squalene synthase                       124   2e-30   
ref|XP_006033877.1|  PREDICTED: squalene synthase-like                  125   3e-30   
ref|XP_005513697.1|  PREDICTED: squalene synthase                       125   3e-30   
gb|KFZ57398.1|  Squalene synthase                                       125   3e-30   
gb|KFV73970.1|  Squalene synthase                                       125   3e-30   
ref|XP_009906049.1|  PREDICTED: squalene synthase isoform X1            125   4e-30   
ref|XP_003225597.2|  PREDICTED: squalene synthase                       125   4e-30   
gb|KFO99755.1|  Squalene synthase                                       125   4e-30   
ref|XP_008629248.1|  PREDICTED: squalene synthase                       125   5e-30   
ref|XP_005236741.1|  PREDICTED: squalene synthase                       125   5e-30   
ref|NP_001189454.1|  squalene synthase                                  125   5e-30   
ref|XP_006263357.1|  PREDICTED: squalene synthase-like                  125   6e-30   
ref|XP_005528843.1|  PREDICTED: squalene synthase                       125   7e-30   
ref|XP_009560858.1|  PREDICTED: squalene synthase isoform X2            124   8e-30   
gb|KFO77427.1|  Squalene synthase                                       124   9e-30   
ref|XP_007068988.1|  PREDICTED: squalene synthase-like                  124   9e-30   
ref|XP_004614762.1|  PREDICTED: squalene synthase                       124   9e-30   
ref|XP_007068989.1|  PREDICTED: squalene synthase-like                  123   1e-29   
ref|XP_008977275.1|  PREDICTED: squalene synthase isoform X3            123   1e-29   
ref|XP_006172265.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl-dip...    124   1e-29   
ref|XP_009560856.1|  PREDICTED: squalene synthase isoform X1            124   1e-29   
ref|XP_005044492.1|  PREDICTED: squalene synthase                       124   1e-29   
ref|XP_007517289.1|  PREDICTED: squalene synthase isoform X2            123   1e-29   
ref|XP_005290732.1|  PREDICTED: squalene synthase-like                  124   1e-29   
ref|XP_007097199.1|  PREDICTED: squalene synthase isoform X1            123   1e-29   
ref|XP_007882609.1|  PREDICTED: squalene synthase                       124   2e-29   
ref|XP_009665209.1|  PREDICTED: squalene synthase                       123   2e-29   
gb|KDD74507.1|  squalene/phytoene synthase                              122   2e-29   
gb|ACN60238.1|  Squalene synthetase                                     120   2e-29   
gb|KFV76998.1|  Squalene synthase                                       122   2e-29   
ref|XP_007517287.1|  PREDICTED: squalene synthase isoform X1            123   2e-29   
ref|XP_003984893.2|  PREDICTED: squalene synthase                       123   2e-29   
ref|XP_004449107.1|  PREDICTED: squalene synthase                       122   3e-29   
ref|XP_002749744.1|  PREDICTED: squalene synthase-like isoform X1       122   3e-29   
sp|G0Y288.1|BOCS_BOTBR  RecName: Full=Botryococcene synthase; Alt...    122   3e-29   
ref|XP_002756812.1|  PREDICTED: squalene synthase isoform X1            122   4e-29   
ref|NP_001274685.1|  squalene synthase isoform 5                        120   4e-29   
gb|EMP27211.1|  Squalene synthase                                       124   4e-29   
ref|XP_008968069.1|  PREDICTED: squalene synthase isoform X2            120   4e-29   
ref|XP_005712480.1|  unnamed protein product                            123   4e-29   
ref|XP_003757973.1|  PREDICTED: squalene synthase                       122   4e-29   
ref|XP_002186800.1|  PREDICTED: squalene synthase                       122   4e-29   
ref|XP_008977276.1|  PREDICTED: squalene synthase isoform X4            122   5e-29   
ref|XP_005535962.1|  squalene synthase                                  122   5e-29   
ref|XP_010330374.1|  PREDICTED: squalene synthase isoform X3            121   5e-29   
gb|EMP27212.1|  Squalene synthase                                       122   5e-29   
ref|XP_003479432.1|  PREDICTED: squalene synthase isoform X1            122   5e-29   
ref|XP_010590633.1|  PREDICTED: squalene synthase                       121   5e-29   
ref|XP_006039244.1|  PREDICTED: squalene synthase-like                  122   6e-29   
ref|XP_008703290.1|  PREDICTED: squalene synthase                       121   6e-29   
ref|XP_009025212.1|  hypothetical protein HELRODRAFT_68312              121   7e-29   
emb|CDQ56794.1|  unnamed protein product                                120   7e-29   
ref|XP_006518610.1|  PREDICTED: squalene synthase isoform X3            120   7e-29   
ref|XP_009699274.1|  PREDICTED: squalene synthase                       117   8e-29   
ref|XP_005425026.1|  PREDICTED: squalene synthase                       122   8e-29   
ref|XP_008574545.1|  PREDICTED: squalene synthase isoform X2            121   9e-29   
ref|XP_006884953.1|  PREDICTED: squalene synthase isoform X3            121   1e-28   
ref|XP_005008182.1|  PREDICTED: squalene synthase isoform X2            122   1e-28   
ref|XP_008574544.1|  PREDICTED: squalene synthase isoform X1            122   1e-28   
ref|XP_001567320.1|  putative farnesyltransferase                       121   1e-28   
ref|XP_005495474.1|  PREDICTED: squalene synthase                       121   1e-28   
ref|XP_010863270.1|  PREDICTED: squalene synthase                       121   1e-28   
ref|XP_002923714.1|  PREDICTED: squalene synthase isoform X2            121   1e-28   
ref|XP_011395550.1|  Squalene synthase                                  121   1e-28   
ref|XP_003793969.1|  PREDICTED: squalene synthase isoform 3             120   1e-28   
ref|XP_011228676.1|  PREDICTED: squalene synthase isoform X1            121   1e-28   
ref|XP_006884952.1|  PREDICTED: squalene synthase isoform X2            121   1e-28   
ref|XP_003944232.1|  PREDICTED: squalene synthase isoform X2            121   2e-28   
ref|XP_008148989.1|  PREDICTED: squalene synthase isoform X3            120   2e-28   
ref|XP_001685284.1|  putative squalene synthase                         120   2e-28   
dbj|BAG51957.1|  unnamed protein product                                119   2e-28   
ref|XP_003793968.1|  PREDICTED: squalene synthase isoform 2             120   2e-28   
gb|EPY33320.1|  farnesyl-diphosphate farnesyltransferase                119   2e-28   
ref|XP_008070645.1|  PREDICTED: squalene synthase isoform X2            119   2e-28   
ref|XP_001915483.1|  PREDICTED: squalene synthase                       120   2e-28   
dbj|GAM21817.1|  hypothetical protein SAMD00019534_049920               120   2e-28   
ref|XP_009486915.1|  PREDICTED: squalene synthase                       116   2e-28   
ref|XP_010701665.1|  squalene synthase, putative                        120   2e-28   
ref|NP_001274680.1|  squalene synthase isoform 4                        119   2e-28   
ref|XP_008529254.1|  PREDICTED: squalene synthase isoform X2            120   2e-28   
ref|XP_006774849.1|  PREDICTED: squalene synthase isoform X2            120   2e-28   
ref|XP_008148988.1|  PREDICTED: squalene synthase isoform X2            120   3e-28   
ref|XP_005859689.1|  PREDICTED: squalene synthase                       120   3e-28   
ref|XP_006864385.1|  PREDICTED: squalene synthase isoform X3            120   3e-28   
ref|XP_006884951.1|  PREDICTED: squalene synthase isoform X1            120   3e-28   
ref|XP_010330373.1|  PREDICTED: squalene synthase isoform X1            120   3e-28   
ref|XP_003793967.1|  PREDICTED: squalene synthase isoform 1             120   3e-28   
ref|XP_006774848.1|  PREDICTED: squalene synthase isoform X1            120   3e-28   
ref|XP_004433568.1|  PREDICTED: squalene synthase isoform 2             120   3e-28   
emb|CBJ48968.1|  Isopentenyl-diphosphate delta-isomerase type 1 f...    122   3e-28   
gb|EPY35876.1|  farnesyltransferase                                     120   3e-28   
ref|XP_008070644.1|  PREDICTED: squalene synthase isoform X1            119   3e-28   
ref|XP_008529253.1|  PREDICTED: squalene synthase isoform X1            120   3e-28   
ref|XP_004046702.1|  PREDICTED: squalene synthase isoform 3             119   3e-28   
ref|XP_007959828.1|  PREDICTED: squalene synthase isoform X3            119   3e-28   
ref|XP_004046701.1|  PREDICTED: squalene synthase isoform 2             119   3e-28   
ref|XP_006864384.1|  PREDICTED: squalene synthase isoform X2            120   3e-28   
ref|NP_001135642.2|  farnesyl-diphosphate farnesyltransferase 1         120   4e-28   
ref|XP_003271491.1|  PREDICTED: squalene synthase isoform 3             119   4e-28   
emb|CAJ76132.2|  squalene synthase                                      120   4e-28   
pdb|3LEE|A  Chain A, Crystal Structure Of The Human Squalene Synt...    119   4e-28   
ref|XP_008148987.1|  PREDICTED: squalene synthase isoform X1            120   4e-28   
ref|XP_001372440.1|  PREDICTED: squalene synthase isoform X1            120   4e-28   
dbj|BAH14404.1|  unnamed protein product                                119   4e-28   
pdb|1EZF|A  Chain A, Crystal Structure Of Human Squalene Synthase       119   4e-28   
ref|NP_001274673.1|  squalene synthase isoform 2                        119   4e-28   
pdb|3WEI|A  Chain A, Crystal Structure Of The Human Squalene Synt...    119   4e-28   
dbj|BAG58807.1|  unnamed protein product                                119   4e-28   
pdb|3VJ8|A  Chain A, Crystal Structure Of The Human Squalene Synt...    119   4e-28   
ref|XP_003271490.1|  PREDICTED: squalene synthase isoform 2             119   4e-28   
dbj|BAE36836.1|  unnamed protein product                                119   4e-28   
ref|XP_004046700.1|  PREDICTED: squalene synthase isoform 1             119   5e-28   
ref|XP_007936897.1|  PREDICTED: squalene synthase isoform X3            119   5e-28   
gb|AAF00038.1|  squalene synthase                                       119   6e-28   
ref|XP_002709483.1|  PREDICTED: squalene synthase isoform X2            119   6e-28   
ref|XP_003877813.1|  putative farnesyltransferase                       119   6e-28   
dbj|BAA06102.1|  squalene synthase                                      119   6e-28   
ref|XP_004088003.1|  PREDICTED: squalene synthase                       119   6e-28   
ref|NP_034321.2|  squalene synthase                                     119   6e-28   
ref|XP_003271489.1|  PREDICTED: squalene synthase isoform 1             119   6e-28   
ref|XP_006864383.1|  PREDICTED: squalene synthase isoform X1            119   6e-28   
gb|AAP36671.1|  Homo sapiens farnesyl-diphosphate farnesyltransfe...    119   6e-28   
ref|NP_004453.3|  squalene synthase isoform 1                           119   6e-28   
emb|CAA48896.1|  farnesyl-diphosphate farnesyltransferase               119   6e-28   
ref|XP_010382892.1|  PREDICTED: squalene synthase isoform X2            119   6e-28   
gb|AAH09251.1|  Farnesyl-diphosphate farnesyltransferase 1              119   6e-28   
ref|NP_001247653.1|  squalene synthase                                  119   6e-28   
ref|XP_008247080.1|  PREDICTED: squalene synthase isoform X1            119   7e-28   
ref|XP_004382267.1|  PREDICTED: squalene synthase isoform 3             119   7e-28   
ref|XP_011243253.1|  PREDICTED: squalene synthase isoform X2            119   7e-28   
ref|NP_001267081.1|  squalene synthase                                  119   7e-28   
ref|XP_004433567.1|  PREDICTED: squalene synthase isoform 1             119   7e-28   
ref|XP_007476301.1|  PREDICTED: squalene synthase isoform X2            119   7e-28   
ref|XP_009438499.1|  PREDICTED: squalene synthase isoform X1            119   8e-28   
ref|NP_062111.1|  squalene synthase                                     119   9e-28   
ref|XP_007936895.1|  PREDICTED: squalene synthase isoform X2            119   9e-28   
ref|XP_004382266.1|  PREDICTED: squalene synthase isoform 2             119   9e-28   
ref|XP_003449965.1|  PREDICTED: squalene synthase-like                  119   1e-27   
gb|KFP74853.1|  Squalene synthase                                       115   1e-27   
ref|XP_010382891.1|  PREDICTED: squalene synthase isoform X1            119   1e-27   
ref|XP_003863390.1|  farnesyltransferase, putative                      118   1e-27   
ref|XP_009864778.1|  PREDICTED: squalene synthase                       115   1e-27   
ref|XP_009438497.1|  PREDICTED: squalene synthase isoform X2            119   1e-27   
dbj|BAG60195.1|  unnamed protein product                                119   1e-27   
ref|XP_007936894.1|  PREDICTED: squalene synthase isoform X1            119   1e-27   
ref|XP_005562629.1|  PREDICTED: squalene synthase isoform X1            119   1e-27   
ref|NP_001274679.1|  squalene synthase isoform 3                        119   1e-27   
ref|XP_007959826.1|  PREDICTED: squalene synthase isoform X1            119   1e-27   
ref|XP_008396056.1|  PREDICTED: squalene synthase isoform X2            118   1e-27   
ref|XP_008768968.1|  PREDICTED: squalene synthase isoform X1            119   1e-27   
ref|XP_004382265.1|  PREDICTED: squalene synthase isoform 1             119   1e-27   
ref|XP_005635705.1|  PREDICTED: squalene synthase isoform X2            118   1e-27   
ref|XP_007429056.1|  PREDICTED: squalene synthase isoform X4            117   1e-27   
ref|XP_009241805.1|  PREDICTED: squalene synthase isoform X1            118   1e-27   
ref|XP_534557.2|  PREDICTED: squalene synthase isoformX1                118   1e-27   
ref|XP_007552931.1|  PREDICTED: squalene synthase isoform X2            118   1e-27   
gb|AAI68496.1|  Unknown (protein for MGC:173117)                        118   2e-27   
ref|XP_008396055.1|  PREDICTED: squalene synthase isoform X1            118   2e-27   
ref|XP_009513193.1|  PREDICTED: squalene synthase                       115   2e-27   
ref|XP_006797166.1|  PREDICTED: squalene synthase-like                  117   2e-27   
ref|XP_006729443.1|  PREDICTED: squalene synthase isoform X2            117   2e-27   
ref|XP_007552930.1|  PREDICTED: squalene synthase isoform X1            118   2e-27   
ref|XP_005800260.1|  PREDICTED: squalene synthase-like                  117   2e-27   
ref|XP_006115892.1|  PREDICTED: squalene synthase-like                  117   2e-27   
ref|XP_006729442.1|  PREDICTED: squalene synthase isoform X1            118   2e-27   
ref|XP_008290518.1|  PREDICTED: squalene synthase                       117   3e-27   
ref|XP_007655110.1|  PREDICTED: squalene synthase                       114   3e-27   
gb|KFW85850.1|  Squalene synthase                                       115   3e-27   
pdb|3WEK|A  Chain A, Crystal Structure Of The Human Squalene Synt...    117   3e-27   
ref|XP_004083804.1|  PREDICTED: squalene synthase                       117   3e-27   
gb|AAB33404.1|  squalene synthase                                       117   3e-27   
gb|ELT92149.1|  hypothetical protein CAPTEDRAFT_164295                  117   3e-27   
ref|XP_004395310.1|  PREDICTED: squalene synthase isoform 3             117   3e-27   
ref|XP_005977636.1|  PREDICTED: squalene synthase                       117   3e-27   
ref|XP_005914533.1|  PREDICTED: squalene synthase-like                  117   3e-27   
ref|XP_005734456.1|  PREDICTED: squalene synthase-like                  117   3e-27   
ref|XP_004766138.1|  PREDICTED: squalene synthase isoform X1            117   3e-27   



>ref|XP_009631700.1| PREDICTED: squalene synthase [Nicotiana tomentosiformis]
Length=411

 Score =   288 bits (736),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRL++ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLDVILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>sp|P53800.1|FDFT_NICBE RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Nicotiana benthamiana]
 gb|AAA87048.1| squalene synthetase [Nicotiana benthamiana]
Length=411

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLEELKYE+NS  AVQCLNDMVT+AL HVEDCLTYMSALRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALPHVEDCLTYMSALRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRT+ DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTIADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRLE+ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLEVILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>ref|XP_009802568.1| PREDICTED: squalene synthase [Nicotiana sylvestris]
Length=411

 Score =   285 bits (729),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRLE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|AAB08578.1| squalene synthase [Nicotiana tabacum]
Length=411

 Score =   285 bits (729),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRLE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|AAY22201.1| squalene synthase [Datura inoxia]
Length=387

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLEELKYEENSV AVQCLNDMVT+ALSHVEDCLTYMS LRDP+IFRF
Sbjct  203  MFWPREIWSKYVNKLEELKYEENSVKAVQCLNDMVTNALSHVEDCLTYMSNLRDPAIFRF  262

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTMEDVYG FFDFSCMLKSK
Sbjct  263  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMEDVYGAFFDFSCMLKSK  322

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++N P A+KTLK LE +LKTCRDSGTLNKRKSYI+R+E NY+P LI++ FIILAI+L +
Sbjct  323  VNNNGPNATKTLKGLEAVLKTCRDSGTLNKRKSYIIRSERNYSPVLIVIIFIILAIILAH  382

Query  124  LSGNK  110
            LSGN+
Sbjct  383  LSGNR  387



>dbj|BAA82093.1| squalene synthase [Solanum tuberosum]
Length=411

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|AAD20626.1| squalene synthase [Capsicum annuum]
Length=411

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLEELKYEENSV AVQCLNDMVT+ALSHVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPREIWSKYVNKLEELKYEENSVKAVQCLNDMVTNALSHVEDCLIYMSNLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAK IDRTRTM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKAIDRTRTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRLE ILKTCRDSGTLNKRKSY++++EP Y+P LI V FIILAI+L +
Sbjct  346  VNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYVIKSEPTYSPVLIFVIFIILAIILAH  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|AEX26929.1| squalene synthase 1-1 [Solanum tuberosum]
Length=411

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|ADW78251.1| squalene synthase [Withania somnifera]
 gb|ADO22708.1| squalene synthase [Withania somnifera]
Length=413

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYMS LRDP+IFRF
Sbjct  228  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMSNLRDPAIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            C IPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTM DVYG FFDFSCMLKSK
Sbjct  288  CGIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAFFDFSCMLKSK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP ++KTLK+LE ILKTCR+SG LNKRKSY++R+EPNY+P LIIV F+ILA++L  
Sbjct  348  VNNNDPNSTKTLKKLEAILKTCRNSGMLNKRKSYVIRSEPNYSPVLIIVIFVILAVILSQ  407

Query  124  LSGNK  110
            LSGN+
Sbjct  408  LSGNR  412



>ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum]
 ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum]
Length=411

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTY+  LRDP+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYLFNLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|AEX26932.1| squalene synthase [Solanum chacoense]
Length=411

 Score =   277 bits (709),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKY ENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYVENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVI RT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIGRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|AGS57530.1| squalene synthase [Solanum nigrum]
Length=411

 Score =   277 bits (708),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM  LRDP+IFRF
Sbjct  226  MFWPREIWSKYANKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMYNLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CY+NI +FRGVVKMRRGLTAKVIDRTRT+ DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAICYDNIELFRGVVKMRRGLTAKVIDRTRTIADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRLE ILKTCRDSGTLNKRKSY++++EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYVIKSEPNYSPVLIVVIFIILAIILAR  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNQ  410



>gb|AEX26930.1| squalene synthase 1-2 [Solanum tuberosum]
Length=411

 Score =   277 bits (708),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM  LRDPSIFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMFNLRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMC++NI  FRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCHDNIEAFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  
Sbjct  346  VNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQ  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>ref|NP_001234716.1| squalene synthase [Solanum lycopersicum]
 gb|ACY25092.1| squalene synthase [Solanum lycopersicum]
Length=411

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM  L DP+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMFNLHDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            V++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R EPNY+P
Sbjct  346  VNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRNEPNYSP  389



>gb|AGB05603.1| squalene synthase [Camellia oleifera]
Length=414

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK +ENSV AV+CLNDMVT+AL HVEDCLTYMSALRDPSIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKDKENSVKAVECLNDMVTNALIHVEDCLTYMSALRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ +DP A K L RLE I K CR+SGTLNKRKSYI+++EP Y   L+ V FIILAIL  Y
Sbjct  346  VNKSDPNAMKALSRLEAIQKICRESGTLNKRKSYIVKSEPRYNSTLVFVLFIILAILFAY  405

Query  124  LSGNKP  107
            LS N+P
Sbjct  406  LSANRP  411



>gb|AAB02945.1| squalene synthase [Nicotiana tabacum]
Length=376

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -1

Query  598  NSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVF  419
            NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRFCAIPQ+MAIGTLAMCY+NI VF
Sbjct  213  NSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRFCAIPQVMAIGTLAMCYDNIEVF  272

Query  418  RGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKRLEIILKTC  239
            RGVVKMRRGLTAKVID+TRT+ DVYG FFDFSCMLKSKV++NDP A+KTLKRLE ILKTC
Sbjct  273  RGVVKMRRGLTAKVIDQTRTIADVYGAFFDFSCMLKSKVNNNDPNATKTLKRLEAILKTC  332

Query  238  RDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSGNK  110
            RDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSGN+
Sbjct  333  RDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSGNR  375



>ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
 gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
Length=413

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+K
Sbjct  286  CAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD+NDP A KTL RL++ILKTCRDSG LNKRKSYI++ + NYTP
Sbjct  346  VDNNDPNAQKTLSRLDLILKTCRDSGVLNKRKSYIIQNQSNYTP  389



>ref|XP_009594336.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=411

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLEELK EENSV AVQCLN+MVT+ALSHVED LTYMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEELKCEENSVKAVQCLNEMVTNALSHVEDSLTYMSTLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLTAKVIDRTR M DVYG F+DFSC+LKSK
Sbjct  286  CAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAKVIDRTRNMADVYGAFYDFSCILKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++ DP A+KTL+RLE IL+TC+DSGTLNKRKS+++++ PNY  AL++V  +I+AIL  Y
Sbjct  346  VEYKDPNAAKTLRRLETILRTCKDSGTLNKRKSFVIQSRPNYNSALVVVLVVIIAILSAY  405

Query  124  LSGNKP  107
             SGN+P
Sbjct  406  QSGNRP  411



>ref|XP_009759256.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=411

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENSV AVQCLN+MVT+ALSHVED LTYMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKCEENSVKAVQCLNEMVTNALSHVEDSLTYMSTLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLTAKVIDRTRTM DVYG F+DFSC+LK+K
Sbjct  286  CAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAFYDFSCILKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++ DP A+KTL+RLE IL+TC++SGTLNKRKS+++++ PNY  AL++V  +I+AIL+ Y
Sbjct  346  VEYKDPNAAKTLRRLETILRTCKNSGTLNKRKSFVIQSRPNYNSALVVVLVVIIAILIAY  405

Query  124  LSGNKP  107
            LSGN+P
Sbjct  406  LSGNRP  411



>gb|AFR77735.1| squalene synthase, partial [Camellia oleifera]
Length=413

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK +ENSV AV+CLNDMVT+AL HVEDCLTYMSALRDPSIFRF
Sbjct  233  MFWPRQIWSKYVNKLEDLKDKENSVKAVECLNDMVTNALIHVEDCLTYMSALRDPSIFRF  292

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYGGFFDFSCMLKSK
Sbjct  293  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMSDVYGGFFDFSCMLKSK  352

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            V+ +DP A K L RLE I K CR+SGTLNKRKSYI+++EP Y
Sbjct  353  VNKSDPNAMKALSRLEAIQKICRESGTLNKRKSYIIKSEPRY  394



>ref|XP_006360639.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=411

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV A+QCLN+MVT++LSHVEDCLT++S LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSVKAIQCLNEMVTNSLSHVEDCLTFLSTLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLTA+VIDRTR M DVYG FFDFSC+LKSK
Sbjct  286  CAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAQVIDRTRNMADVYGAFFDFSCILKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++ DP  +KTLKRLE+IL+TC++SGTLNKRKS+++++ PNY    ++V  +++AILLGY
Sbjct  346  VEYKDPQVAKTLKRLEVILRTCKNSGTLNKRKSFVIKSGPNYNSTFVVVLVVLVAILLGY  405

Query  124  LSGNK  110
             SGN+
Sbjct  406  QSGNR  410



>gb|KJB12167.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
 gb|KJB12170.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=295

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  108  MFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRF  167

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+K
Sbjct  168  CAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAK  227

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  228  VDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  271



>gb|ACS66750.1| squalene synthase [Glycyrrhiza uralensis]
Length=413

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>ref|XP_011088477.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011088478.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL+HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALTHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG F+DFS MLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTISDVYGAFYDFSRMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
             D NDP A KT + LE ILK CRDSGTLN+RKSYI++++P+Y+P LI+V FIILAILL Y
Sbjct  346  ADDNDPNARKTKEFLETILKLCRDSGTLNQRKSYIIQSKPHYSPTLIVVIFIILAILLAY  405

Query  124  LSGNKP  107
            LS  +P
Sbjct  406  LSAARP  411



>ref|XP_004248691.1| PREDICTED: squalene synthase-like [Solanum lycopersicum]
Length=411

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLN+MVT+ALSH+EDCLT++S LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSVKAVQCLNEMVTNALSHIEDCLTFLSTLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLT +VIDRTR M DVYG FFDFSC+LKSK
Sbjct  286  CAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTTQVIDRTRNMADVYGAFFDFSCILKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+  DP  +KTLKRLE+IL+TC++SGTLNKRKS+++++ PNY    ++V  +++AILLGY
Sbjct  346  VEFKDPHVAKTLKRLEVILRTCKNSGTLNKRKSFVIKSGPNYNSTFVVVLVVLVAILLGY  405

Query  124  LSGNK  110
             SGN+
Sbjct  406  QSGNR  410



>gb|KJB12168.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=313

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  126  MFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRF  185

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+K
Sbjct  186  CAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAK  245

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  246  VDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  289



>gb|KJB32575.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=294

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  108  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRF  167

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+K
Sbjct  168  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAK  227

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  228  VDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  271



>emb|CDP20866.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKY+ENS  AV CLNDMVT+AL H EDCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYKENSDKAVHCLNDMVTNALMHAEDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD ND  A KT  RLE ILK CRDSGTLNKRKSYIL +EP + P +I++F ++LAILL Y
Sbjct  346  VDDNDLNAKKTKSRLEDILKICRDSGTLNKRKSYILGSEPTFNPTMILIFVVMLAILLAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera]
 ref|XP_010647676.1| PREDICTED: squalene synthase [Vitis vinifera]
 emb|CBI38008.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LK EENS+ AVQCLNDMVT+AL H+EDCLTYMSAL+ P+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKEEENSIKAVQCLNDMVTNALIHMEDCLTYMSALQSPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+ M DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKAMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+K L RLE + K CR+SG L KRKSY++R+EP Y  ALI+ FFIIL+I+  Y
Sbjct  346  VDKNDPNATKALSRLEAVQKICRESGALTKRKSYVIRSEPRYNSALIVAFFIILSIIFAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>gb|ACN69082.1| squalene synthase [Diospyros kaki]
Length=415

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE+NSV +VQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEKNSVKSVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVID+T+T+ DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDQTKTISDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ NDP ++KTL R+E I KTCR+SGTL+KRKSYILR++  +   LI V FIILAIL  Y
Sbjct  346  VEKNDPNSTKTLSRIEAIQKTCRESGTLSKRKSYILRSKRTHNSTLIFVLFIILAILFAY  405

Query  124  LSGNKP  107
            LS N+P
Sbjct  406  LSANRP  411



>gb|ADG36709.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   261 bits (668),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV K+E+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKIEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E  Y+  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTYSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ADG36702.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36710.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36712.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36713.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ADG36707.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|KHG01756.1| Squalene synthase [Gossypium arboreum]
Length=413

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKY+ KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYIKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFSC+LK+K
Sbjct  286  CAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMADVYGAFYDFSCILKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            VD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + +YT
Sbjct  346  VDKNDPNAQKTMSRLDSILKTCRDSGVLNKRKSYIIENQSDYT  388



>gb|ADG36705.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP+QIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPQQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ADG36708.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV K+E+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKIEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTIADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E  Y+  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTYSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|KJB12166.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=413

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+K
Sbjct  286  CAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  346  VDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  389



>gb|KJB12171.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=412

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  225  MFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRF  284

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS +LK+K
Sbjct  285  CAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAFYDFSYILKAK  344

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  345  VDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  388



>gb|KJB32578.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=406

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  220  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRF  279

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+K
Sbjct  280  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAK  339

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  340  VDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  383



>gb|KJB32577.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=388

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  202  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRF  261

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+K
Sbjct  262  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAK  321

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  322  VDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  365



>gb|AFJ15526.1| squalene synthase [Azadirachta indica]
Length=392

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT+AL+HVEDCL YMSALRDP+IFRF
Sbjct  205  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALNHVEDCLKYMSALRDPAIFRF  264

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK IDRT  M DVYG F+DFSCMLK K
Sbjct  265  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKAIDRTNKMADVYGAFYDFSCMLKPK  324

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            ++ NDP A+KTL R+E I K C +SG LN+RKSYI++ EP Y   +II+ FIILAI+  Y
Sbjct  325  INENDPNATKTLSRVEAIQKACMESGLLNRRKSYIIQREPKYNTTMIIMLFIILAIIFAY  384

Query  124  LSGNKPHS  101
            LS N+P++
Sbjct  385  LSANRPNN  392



>ref|XP_002313765.1| squalene synthase family protein [Populus trichocarpa]
 gb|EEE87720.1| squalene synthase family protein [Populus trichocarpa]
Length=413

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT++L HV+DCL YMSALR+P+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVEAVQCLNDMVTNSLIHVDDCLKYMSALREPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA++  RT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQIFHRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL  LE + KTCR+SG LNKRKSYILR E  Y   LI++ FIIL+I+  Y
Sbjct  346  VDRNDPNATKTLSSLEAVQKTCRESGALNKRKSYILRNELKYNSVLIVLLFIILSIIFAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>ref|XP_011047498.1| PREDICTED: squalene synthase isoform X1 [Populus euphratica]
Length=413

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKY+ENSV AVQCLN+MVT++L HV+DCL YMSALR+P+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYDENSVKAVQCLNEMVTNSLIHVDDCLKYMSALREPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA+VI RT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQVIHRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL  LE + KTCR+SG LNKRKSY+LR E  Y   LI++ FIIL+++  Y
Sbjct  346  VDKNDPNATKTLSSLEAVQKTCRESGALNKRKSYVLRNELKYNSVLIVLLFIILSVIFAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>gb|KJB32574.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
 gb|KJB32576.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=412

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+K
Sbjct  286  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  346  VDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra]
Length=413

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|AED99863.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>gb|AER23670.1| squalene synthase [Eleutherococcus senticosus]
Length=414

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLENLKYEENSAKAVQCLNDMVTNALLHAEDCLKYMSNLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ ++  +  ALI + FIILAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESKSAHNSALIAIIFIILAILYAY  405

Query  124  LSGNKPHS  101
            LS N P++
Sbjct  406  LSSNLPNN  413



>gb|ACT52826.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36700.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ADG36704.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ADG36703.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>emb|CAJ77652.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAY  405

Query  124  LSGNKPHS  101
            LS N+ ++
Sbjct  406  LSANRQNN  413



>gb|KHN25422.1| Squalene synthase [Glycine soja]
Length=408

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWS+YV KLE+LKYEENSV AVQCLNDMVT+AL H EDCLTYM+ALRDP IFRF
Sbjct  221  MFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLTYMAALRDPPIFRF  280

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ K
Sbjct  281  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPK  340

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  Y
Sbjct  341  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAY  400

Query  124  LSGNKPHS  101
            LS N  +S
Sbjct  401  LSANHHNS  408



>ref|XP_010039888.1| PREDICTED: squalene synthase-like isoform X2 [Eucalyptus grandis]
Length=414

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENS  AV+CLNDMVT+AL+HVEDCLTYMSAL DPSIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKCEENSEKAVRCLNDMVTNALTHVEDCLTYMSALGDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VF+GVVK+RRGLTAKVIDRTRTM DVYG F+DFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFKGVVKIRRGLTAKVIDRTRTMADVYGAFYDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A+KTL R+EI  K CRD+G  NKRKSYIL +EP Y
Sbjct  346  VDKNDPNATKTLSRIEITQKACRDAGLRNKRKSYILPSEPRY  387



>ref|XP_010109768.1| hypothetical protein L484_008444 [Morus notabilis]
 gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis]
Length=411

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LK EENSV AVQCLNDMVT+AL H+EDCL YMSALR P+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKDEENSVKAVQCLNDMVTNALLHMEDCLKYMSALRHPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILR  194
            VD NDP A KTL RLE I KTCRDSGTLNKRKSY+L+
Sbjct  346  VDDNDPNAKKTLSRLETIQKTCRDSGTLNKRKSYVLK  382



>ref|XP_010039880.1| PREDICTED: squalene synthase-like isoform X1 [Eucalyptus grandis]
Length=419

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENS  AV+CLNDMVT+AL+HVEDCLTYMSAL DPSIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKCEENSEKAVRCLNDMVTNALTHVEDCLTYMSALGDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VF+GVVK+RRGLTAKVIDRTRTM DVYG F+DFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFKGVVKIRRGLTAKVIDRTRTMADVYGAFYDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A+KTL R+EI  K CRD+G  NKRKSYIL +EP Y
Sbjct  346  VDKNDPNATKTLSRIEITQKACRDAGLRNKRKSYILPSEPRY  387



>gb|ADC95435.1| squalene synthase [Withania somnifera]
Length=411

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM  LRDP+I R 
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMPNLRDPAICRL  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
              IPQ+M IGTLAMCY NI VF     MRRGLTAKVIDRTRTM DVYG FFDFSCMLKSK
Sbjct  286  RGIPQVMVIGTLAMCYYNIEVFSRSGSMRRGLTAKVIDRTRTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V++NDP A+KTLKRLE ILKTCR+SGTLNKRKSY++R+EPNY+P LI+V FIILA++L +
Sbjct  346  VNNNDPNATKTLKRLEAILKTCRNSGTLNKRKSYVIRSEPNYSPVLIVVIFIILAVILAH  405

Query  124  LSGNK  110
            LSGN+
Sbjct  406  LSGNR  410



>gb|ADC32654.1| squalene synthase [Aralia elata]
Length=414

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQ WSKYV KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQSWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALLHAEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FI+LAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIMLAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>ref|XP_010066209.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 ref|XP_010066210.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 gb|KCW64053.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64054.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64055.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64056.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
Length=413

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL+HVEDCLTYMSAL DP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALTHVEDCLTYMSALSDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFYDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            VD NDP A+KTL R+E   K CR+SG LNKRKSYI+ ++  Y+
Sbjct  346  VDKNDPNATKTLSRIEASQKACRNSGLLNKRKSYIIASKSRYS  388



>gb|EYU42585.1| hypothetical protein MIMGU_mgv1a007225mg [Erythranthe guttata]
Length=414

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLEELKYEENSV AV+CLNDMVT++L HVEDCL YM+ALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEELKYEENSVKAVRCLNDMVTNSLIHVEDCLNYMAALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSLMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP ASKT +RLE I K CRDSGTL++RKS I++ +P      I + FI+LAI++ Y
Sbjct  346  VDENDPNASKTKERLEAIFKLCRDSGTLSQRKSCIIQNKPQLNATSIALVFIVLAIIVAY  405

Query  124  LSGNKP  107
            LS ++P
Sbjct  406  LSQSRP  411



>gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum]
Length=412

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSAL DP+IFRF
Sbjct  226  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALPDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK+K
Sbjct  286  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  346  VDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>ref|XP_011092839.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011092841.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALVHVEDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFS MLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMTDVYGAFYDFSRMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD  DP A KT + LE ILK CRDSGTL++RKSYI++++P Y
Sbjct  346  VDDADPNAKKTKENLEAILKICRDSGTLSQRKSYIIQSKPQY  387



>ref|XP_008236983.1| PREDICTED: squalene synthase-like [Prunus mume]
Length=412

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YM+ALRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALIHVEDCLKYMAALRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS ++KSK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSIIKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE + KTCR SG L+KRKSYI++ EP+Y   LI+  FIILAI+  Y
Sbjct  346  VDKNDPNATKTLSRLEAVQKTCRASGALSKRKSYIVKGEPSYNSTLIVALFIILAIVYAY  405

Query  124  LSGN  113
            LS +
Sbjct  406  LSAS  409



>gb|ACU21003.1| unknown [Glycine max]
Length=413

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWS+YV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRF
Sbjct  226  MFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDPPIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAY  405

Query  124  LSGNKPHS  101
            LS N  +S
Sbjct  406  LSANHHNS  413



>gb|ADD54645.1| squalene synthase [Bruguiera gymnorhiza]
Length=416

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+ WSKYV KLE+LKYEENSV AVQCLNDMVT++L HV+DCL YMSAL+DP+IFRF
Sbjct  226  MFWPRETWSKYVDKLEDLKYEENSVKAVQCLNDMVTNSLIHVDDCLKYMSALQDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLAMCYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLK+K
Sbjct  286  CAIPQIMAIGTLAMCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD +DP A+KTL RLE I KTCR SG L K KS IL +EP Y  AL  + F+ILAI+  Y
Sbjct  346  VDKSDPNATKTLSRLEAIQKTCRASGFLTKSKSRILGSEPRYNSALAALGFLILAIVFVY  405

Query  124  LSGNKP  107
            LS N+P
Sbjct  406  LSANRP  411



>ref|XP_006591920.1| PREDICTED: squalene synthase isoform X2 [Glycine max]
Length=413

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWS+YV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRF
Sbjct  226  MFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDPPIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAY  405

Query  124  LSGNKPHS  101
            LS N  +S
Sbjct  406  LSANHHNS  413



>gb|ADG36699.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG  +KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLPSKRKPYILRNESTNSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ACV88718.1| squalene synthase [Panax ginseng]
Length=415

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIM+IGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMSIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  
Sbjct  346  VDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYA  405

Query  127  YLSGNKPHSV  98
            YLS N P+S+
Sbjct  406  YLSSNLPNSL  415



>gb|ACZ71037.1| squalene synthase [Panax ginseng]
Length=415

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGTFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LII+ FIILAIL  
Sbjct  346  VDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIIILFIILAILYA  405

Query  127  YLSGNKPHSV  98
            YLS N P+S+
Sbjct  406  YLSSNLPNSL  415



>emb|CAJ77654.1| squalene synthase 1 [Glycyrrhiza eurycarpa]
Length=413

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAE  188
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNE  384



>ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
 gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
Length=412

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 161/186 (87%), Gaps = 1/186 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP QIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMSALRDPSIFRF
Sbjct  226  MFWPHQIWSKYVTKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFYDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ NDP A KTL RLE + K+CR+SG L++R+SYI R+EP     ++++ FIIL+I+  Y
Sbjct  346  VEMNDPNAEKTLSRLEALQKSCRESGLLSRRRSYI-RSEPRINSVIVVLLFIILSIIFAY  404

Query  124  LSGNKP  107
            LS N+P
Sbjct  405  LSANRP  410



>dbj|BAH23428.1| squalene synthetase [Euphorbia tirucalli]
 dbj|BAH23429.1| squalene synthetase [Euphorbia tirucalli]
Length=411

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            C IPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRTRTM DVY  FFDFSCM+KSK
Sbjct  286  CGIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTRTMADVYRAFFDFSCMMKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            VD NDP A KTL RLE + KTC+DSG LNKRKSYI  + P Y 
Sbjct  346  VDRNDPNAEKTLNRLEAVQKTCKDSGMLNKRKSYINGSNPIYN  388



>gb|AIK21786.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVRCLNDMVTNALVHAEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>gb|KDP41726.1| hypothetical protein JCGZ_26744 [Jatropha curcas]
Length=413

 Score =   254 bits (648),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS+ AV+CLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSLKAVRCLNDMVTNALMHVDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            C IPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVI +T++M DVYG FFDFSCMLKSK
Sbjct  286  CVIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIYQTKSMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD +DP A KTL RLE I K C++SG LNKRKSYI R++P Y  ALI++ F+IL+I+  Y
Sbjct  346  VDMSDPNAEKTLSRLEGIQKACQESGLLNKRKSYINRSKPRYNSALIVLLFVILSIVFSY  405

Query  124  LSGNKP  107
            LS N+P
Sbjct  406  LSANRP  411



>ref|XP_007199882.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
 gb|EMJ01081.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
Length=412

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS +LKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSILKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE + KTCR SG L+KRKSYI+R EP++   LI+  FIILAI+  Y
Sbjct  346  VDKNDPNATKTLSRLEAVQKTCRASGALSKRKSYIVRGEPSHNSTLIVALFIILAIVYAY  405

Query  124  LSGN  113
            LS +
Sbjct  406  LSAS  409



>dbj|BAA24289.1| squalene synthase [Panax ginseng]
 dbj|BAD08242.1| squalene synthase [Panax ginseng]
Length=415

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS LR P+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMSDLRGPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVID+T+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>gb|EYU37850.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=414

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK+EENSV AVQCLNDMVT+AL H+EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKHEENSVKAVQCLNDMVTNALIHIEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSRMLKYK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            +D +DP A KT   LE +LK CRDSGTLN+RKSYI++++P     +I++FFIILAILL Y
Sbjct  346  IDDSDPNARKTKDSLEAVLKICRDSGTLNQRKSYIIQSKPQINATVIVIFFIILAILLAY  405

Query  124  LSGNKPHSV  98
            LS ++P ++
Sbjct  406  LSASRPSNI  414



>gb|ABA29019.1| squalene synthase [Panax notoginseng]
 gb|AGS79226.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVRCLNDMVTNALVHAEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>gb|KHG07441.1| Squalene synthase [Gossypium arboreum]
Length=412

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLNDM+T+AL HV+DCL YMSAL DP+IFRF
Sbjct  226  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMITNALIHVDDCLKYMSALPDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRR LTAKVIDRT TM DVYG F+DFSCMLK+K
Sbjct  286  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRSLTAKVIDRTNTMADVYGAFYDFSCMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD NDP+A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  346  VDKNDPSAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>ref|XP_003537842.1| PREDICTED: squalene synthase-like isoform X1 [Glycine max]
 ref|XP_006590871.1| PREDICTED: squalene synthase-like isoform X2 [Glycine max]
 gb|KHN39832.1| Squalene synthase [Glycine soja]
Length=413

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCLTYM+ALRDP IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLTYMAALRDPPIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTTTMADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+K L RLE I KTCR+SG L+KRKSYI++ E  Y   +IIV  I+++I+  Y
Sbjct  346  VDKNDPNATKALSRLEAIQKTCRESGLLSKRKSYIVKDESGYGSTMIIVLVIMVSIIFSY  405

Query  124  LSGN  113
            LS +
Sbjct  406  LSAS  409



>ref|XP_004507500.1| PREDICTED: squalene synthase-like [Cicer arietinum]
Length=413

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H ED L YMSALR P+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLKYMSALRHPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTIADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L KRKSYILR E  Y   +I++  I+ +I   Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGVLTKRKSYILRNENGYGSTMIVILVILFSITYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSAN  409



>ref|XP_010263865.1| PREDICTED: squalene synthase-like [Nelumbo nucifera]
Length=415

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKY+ENS+ AV+CLNDM+T+AL HVEDCL YMSALRDP++FRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYDENSIKAVECLNDMITNALLHVEDCLKYMSALRDPAVFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT+A+CYNNI VF+GVVKMRRGLTAKVIDRT++M DVYG FFDFSC+LK K
Sbjct  286  CAIPQIMAIGTIALCYNNIEVFKGVVKMRRGLTAKVIDRTKSMSDVYGAFFDFSCLLKMK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ NDP A+KTL R+E I KTCR+SG LNKR SY++ ++P+Y    II  FI+L+I L +
Sbjct  346  VEKNDPNATKTLSRIEAIQKTCRNSGLLNKRSSYMVESKPSYNSVAIIAVFILLSIFLAF  405

Query  124  LSGNKP-HS  101
            LS  +P HS
Sbjct  406  LSTKQPIHS  414



>gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWS YV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSIYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKLRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+KTL RLE I K+C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  
Sbjct  346  VDNNDPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYA  405

Query  127  YLSGNKPHSV  98
            YLS + P+S+
Sbjct  406  YLSSSLPNSL  415



>gb|AGI19256.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+L YEENS  AV+CLNDMVT+AL H EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLXYEENSAKAVRCLNDMVTNALVHAEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>ref|NP_001236365.1| squalene synthase [Glycine max]
 dbj|BAA22559.1| squalene synthase [Glycine max]
Length=413

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWS+YV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRF
Sbjct  226  MFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHPEDCLKYMAALRDPPIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++  I+++I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVILVIMVSIIFAY  405

Query  124  LSGNKPHS  101
            LS N  +S
Sbjct  406  LSANHHNS  413



>gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKLRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+KTL RLE I K+C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  
Sbjct  346  VDNNDPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYA  405

Query  127  YLSGNKPHSV  98
            YLS + P+S+
Sbjct  406  YLSSSLPNSL  415



>emb|CAJ58418.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI++IGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIVSIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  
Sbjct  346  VDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYA  405

Query  127  YLSGNKPHSV  98
            YLS N P+S+
Sbjct  406  YLSSNLPNSL  415



>emb|CAD23250.1| farnesyl-diphosphate farnesyltransferase [Medicago truncatula]
 gb|AES89237.2| squalene synthase [Medicago truncatula]
Length=413

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H +DCL YMSALRD S FRF
Sbjct  226  MFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHADDCLQYMSALRDSSNFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SK
Sbjct  286  CAIPQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++  I+ +I+  Y
Sbjct  346  VDKNDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLLVILFSIIFAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>gb|ACA66014.1| squalene synthase [Panax ginseng]
Length=415

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS LR P++FRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMSDLRGPAVFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVID+T+TM DVYG FFDFSC+LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAFFDFSCLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + FIILAIL  Y
Sbjct  346  VDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAIIFIILAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>gb|AFZ93644.1| squalene synthetase [Euphorbia lathyris]
Length=410

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRTRTM DVY  FFDFSCM+KSK
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTRTMADVYRAFFDFSCMMKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  185
            VD NDP A KTL RLE + KTC++SG LNKR+SYI  ++P
Sbjct  346  VDRNDPNAEKTLNRLEAVQKTCKESGLLNKRRSYINESKP  385



>ref|XP_011037190.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=413

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LK+E NSV AVQCLNDMVT+AL H++DCL Y+S LRDP+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKHEGNSVKAVQCLNDMVTNALIHMDDCLKYLSELRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLAMCYNN+ VFRGVVKMRRGLTA+V+ +T+TM+DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLAMCYNNVNVFRGVVKMRRGLTAQVLHQTKTMDDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD++DP A KTL RLE   K+CR+SG LNKRKSYI+R E  Y   LI++ F++L+I+  Y
Sbjct  346  VDNSDPNAIKTLSRLEAAQKSCRESGALNKRKSYIIRNEAKYNSVLIVLLFVLLSIIFAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>emb|CAJ58419.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP QIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPCQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++ FIILAIL  
Sbjct  346  VDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYA  405

Query  127  YLSGNKPHSV  98
            YLS N P+S+
Sbjct  406  YLSSNLPNSL  415



>ref|XP_009376518.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=412

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS +LKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSILKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL R+E + K CRDSG L+KRKSYI   E +Y+  LI+  FIILAI+  Y
Sbjct  346  VDKNDPNATKTLSRVEAVQKLCRDSGALSKRKSYIANHEQSYSSTLIVALFIILAIIYAY  405

Query  124  LSGN  113
            LS +
Sbjct  406  LSAS  409



>ref|XP_002305455.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
 gb|EEE85966.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
Length=476

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H++DCL Y+S LRDP+IFRF
Sbjct  289  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYLSELRDPAIFRF  348

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VI +T+TM+DVYG FFDFSCMLK K
Sbjct  349  CAIPQIMAIGTLALCYNNVNVFRGVVKMRRGLTAQVIHQTKTMDDVYGAFFDFSCMLKFK  408

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD++DP A KTL RLE   K+CR+SG LNKRKSYI+R EP Y   LI++ FIIL+I+  Y
Sbjct  409  VDNSDPNAIKTLSRLEAAQKSCRESGALNKRKSYIIRNEPKYNSVLIVLLFIILSIIFAY  468

Query  124  LSGNK  110
            LS N+
Sbjct  469  LSANR  473



>gb|AFK36923.1| unknown [Medicago truncatula]
Length=413

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H  DCL YMSALRD S FRF
Sbjct  226  MFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHAGDCLQYMSALRDSSNFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SK
Sbjct  286  CAIPQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++  I+ +I+  Y
Sbjct  346  VDKNDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLLVILFSIIFAY  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>gb|AFT92039.1| squalene synthase [Euphorbia pekinensis]
Length=411

 Score =   251 bits (642),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEE+SV AVQCLNDMVT+AL H++DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEEDSVKAVQCLNDMVTNALIHMDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKV+DRTRTM DVY  FFDFSCM+KSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVVDRTRTMADVYRAFFDFSCMMKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A KTL RLE + KTC++SG LNKRKSY+  ++P Y
Sbjct  346  VDRNDPNAEKTLNRLEAVQKTCKESGLLNKRKSYVNGSKPYY  387



>gb|ADG36701.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   251 bits (642),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD ND  A+KTL RLE I KTCR+SG  +KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  346  VDKNDLNATKTLSRLEAIQKTCRESGLSSKRKPYILRNESTNSSTMVLILVIILSIIFAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ADX01171.1| putative squalene synthase [Bacopa monnieri]
Length=414

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL HVEDC+ YMSAL DP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHVEDCIKYMSALGDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F+DFS MLKSK
Sbjct  286  CAIPQVMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKSMADVYGAFYDFSRMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ +DP A KT  RLE ILK CR+SGTLN+RKSYI++++P      I++ FII+AILL Y
Sbjct  346  VEDSDPNARKTKDRLEAILKICRESGTLNQRKSYIIQSKPQNYATSIVIIFIIIAILLAY  405

Query  124  LSGNKP  107
            LS  +P
Sbjct  406  LSATRP  411



>ref|XP_008461009.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461010.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461011.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461012.1| PREDICTED: squalene synthase-like [Cucumis melo]
Length=417

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS LRD SIFRF
Sbjct  226  MFWPREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMSNLRDLSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+K
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSVMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ NDP ASKTL R+E I +TC+ SG +NKRK Y++R+EP Y PA+I++ F +L I+L Y
Sbjct  346  VNSNDPNASKTLSRIEAIQQTCQQSGLMNKRKLYVVRSEPMYNPAVIVILFSLLCIILAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>ref|XP_004150142.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 ref|XP_004167323.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 gb|KGN61845.1| hypothetical protein Csa_2G251460 [Cucumis sativus]
Length=417

 Score =   251 bits (641),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS LRD SIFRF
Sbjct  226  MFWPREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMSNLRDLSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+K
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSVMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ NDP ASKTL R+E I KTC+ SG LN+RK Y++R+EP + PA+I++ F +L I+L Y
Sbjct  346  VNSNDPNASKTLSRIEAIQKTCKQSGILNRRKLYVVRSEPMFNPAVIVILFSLLCIILAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|ACQ90302.1| squalene synthase [Gynostemma pentaphyllum]
Length=417

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AV CLNDMVT+AL HVEDCL YMS L+D SIFRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSVKAVHCLNDMVTNALIHVEDCLIYMSNLKDLSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+K
Sbjct  286  CAIPQIMAIGTLAICYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSVMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V  +DP A+KTL RLE I KTC+ SG LNKRK Y++R+EP Y P LI++ F +L I+L Y
Sbjct  346  VKRSDPNATKTLSRLEAIQKTCQQSGLLNKRKLYVVRSEPIYNPTLIVIIFSLLCIILAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>dbj|BAC56854.1| squalene synthase [Lotus japonicus]
Length=413

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS LRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMSDLRDDSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+T+ DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLAICYNNVEVFRGVVKMRRGLTAKVIDRTKTIADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A+KTL RL  I KTCR+SG LNKRKSYILR E  Y
Sbjct  346  VDKNDPNATKTLSRLVAIQKTCRESGLLNKRKSYILRKENGY  387



>gb|ACX42423.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+K
Sbjct  286  CAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VDH+DP+A  TL RLE I +TC++SGTL KRKSYIL  E  Y   LI + FIILA    Y
Sbjct  346  VDHDDPSAKITLSRLEAIQQTCKNSGTLTKRKSYILENESRYNSVLIAIIFIILAFFYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>gb|AGS78117.1| squalene synthase 1 [Malus domestica]
Length=412

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M+DVYG FFDFS +LKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFSSILKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL R+E + K CRDSG L+KRKSYI   E +Y   LI+  FIILAI+  Y
Sbjct  346  VDKNDPNATKTLSRVEAVQKLCRDSGALSKRKSYIANREQSYNSTLIVALFIILAIIYAY  405

Query  124  LSGN  113
            LS +
Sbjct  406  LSAS  409



>gb|ADG36711.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE NSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYE-NSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  284

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  285  CAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  344

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  345  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAY  404

Query  124  LSGNK  110
            LS  +
Sbjct  405  LSAKR  409



>emb|CAN81937.1| hypothetical protein VITISV_028001 [Vitis vinifera]
Length=431

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 162/206 (79%), Gaps = 18/206 (9%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LK EENS+ AVQCLNDMVT+AL H+EDCLTYMSAL+ P+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKEEENSIKAVQCLNDMVTNALIHMEDCLTYMSALQSPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKS-  308
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+ M DVYG FFDFSCMLKS 
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKAMSDVYGAFFDFSCMLKSK  345

Query  307  -----------------KVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
                             KVD NDP A+K L RLE + K CR+SG L KRKSY++R+EP Y
Sbjct  346  XRRLFICTIRDALASKEKVDKNDPNATKALSRLEAVQKICRESGALTKRKSYVIRSEPRY  405

Query  178  TPaliivffiilailLGYLSGNKPHS  101
              ALI+ FFIIL+I+  YLS N+ ++
Sbjct  406  NSALIVAFFIILSIIFAYLSANRQNN  431



>gb|ADG36706.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE NSV AVQCLNDMVT+AL H EDCL YMSALRD SIFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYE-NSVKAVQCLNDMVTNALLHAEDCLKYMSALRDMSIFRF  284

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG FFDFSCMLKSK
Sbjct  285  CAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAFFDFSCMLKSK  344

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++  IIL+I+  Y
Sbjct  345  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLILVIILSIIFAY  404

Query  124  LSGNK  110
            LS  +
Sbjct  405  LSAKR  409



>gb|ADV57358.1| squalene synthase [Astragalus membranaceus]
Length=405

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLEELKYEENSV AVQCLNDM+T+AL H EDCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEELKYEENSVEAVQCLNDMITNALIHAEDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+ K
Sbjct  286  CAIPQIMAIGTLALCYNNIVVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASLLECK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A+KTL RLE I K CR+SG L+KRKSY+LR+   Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKNCRESGLLSKRKSYVLRSADTY  387



>gb|ADW27427.1| squalene synthase [Astragalus membranaceus]
Length=413

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLEELKYEENSV AVQCLNDM+T+AL H EDCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEELKYEENSVEAVQCLNDMITNALIHAEDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+ K
Sbjct  286  CAIPQIMAIGTLALCYNNIVVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASLLECK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A+KTL RLE I K CR+SG L+KRKSY+LR+   Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKNCRESGLLSKRKSYVLRSADTY  387



>gb|KJB12169.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=427

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 146/178 (82%), Gaps = 14/178 (8%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  226  MFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRR--------------GLTAKVIDRTRTMEDV  347
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRR              GLTAKVIDRT++M DV
Sbjct  286  CAIPQIMAIGTLALCYNNIKVFRGVVKMRRVFQVDVHFISASFPGLTAKVIDRTKSMTDV  345

Query  346  YGGFFDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            YG F+DFS +LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  346  YGAFYDFSYILKAKVDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  403



>ref|XP_003607040.1| Squalene synthase [Medicago truncatula]
Length=423

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H +DCL YMSALRD S FRF
Sbjct  226  MFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHADDCLQYMSALRDSSNFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SK
Sbjct  286  CAIPQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++  I+ +I+  Y
Sbjct  346  VDKNDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLLVILFSIIFAY  405

Query  124  LS  119
            LS
Sbjct  406  LS  407



>ref|XP_006591919.1| PREDICTED: squalene synthase isoform X1 [Glycine max]
Length=451

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWS+YV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRDP IFRF
Sbjct  226  MFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDPPIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+ K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLEPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGY  387



>emb|CDX72493.1| BnaC07g45150D [Brassica napus]
Length=426

 Score =   249 bits (636),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYE+NS NAVQCLN+MVTDAL+H+EDCL YM+ALRDPSIFRF
Sbjct  237  MFWPRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTDALTHIEDCLKYMAALRDPSIFRF  296

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  297  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  356

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  357  VDKNDPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  391



>gb|ACX42425.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+K
Sbjct  286  CAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VDH+DP+A  TL RLE I +TC++SGTL KR SYIL  E  Y   LI + FIILA    Y
Sbjct  346  VDHDDPSAKITLSRLEAIQQTCKNSGTLTKRNSYILENESRYNSVLIAIIFIILAFFYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSSN  409



>ref|XP_009378420.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=410

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VF+GVVKMRRGLTAKVIDRT++M+DVYG FFDF+ ++KSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFKGVVKMRRGLTAKVIDRTKSMDDVYGAFFDFASVIKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            VD NDP A+KTL R+E + K CRDSG L+KRKSYI+  E N T
Sbjct  346  VDKNDPHATKTLSRVEAVQKLCRDSGALSKRKSYIINNEQNST  388



>gb|AFK29283.1| putative squalene synthase 1 [Salvia miltiorrhiza]
 gb|AFV13322.1| putative squalene synthase 1 [Salvia miltiorrhiza]
Length=413

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK +ENSV AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKSQENSVKAVQCLNDMVTNALVHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK K
Sbjct  286  CAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSRMLKFK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD  DP A  T  RL+ ILK CRDSGTLN+RKSYI+ + P Y
Sbjct  346  VDDKDPNAGTTKDRLDSILKICRDSGTLNERKSYIIESGPQY  387



>gb|ADG36717.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36718.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+   I+  I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFLVILFGIMFAY  404

Query  124  LSGNKPHS  101
            LS N+ ++
Sbjct  405  LSANRQNN  412



>gb|ACS66749.1| squalene synthase [Glycyrrhiza uralensis]
 gb|ADG36715.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36716.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36720.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36722.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36723.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36724.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+   I+  I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFLVILFGIMFAY  404

Query  124  LSGNKPHS  101
            LS N+ ++
Sbjct  405  LSANRQNN  412



>gb|AAY46017.1| squalene synthase [Bupleurum falcatum]
Length=415

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+K
Sbjct  286  CAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliivffiilailLG  128
            VDH+DP+A  TL RLE I +TC++SGTL K RKSYIL  E  Y   LI + FIILA    
Sbjct  346  VDHDDPSAKITLSRLEAIQQTCKNSGTLTKSRKSYILENESRYNSVLIAIIFIILAFFYA  405

Query  127  YLSGN  113
            YLS N
Sbjct  406  YLSSN  410



>ref|XP_009138312.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138313.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138314.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=417

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYE+NS NAVQCLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTNALTHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD N+P ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  348  VDKNEPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  382



>emb|CDY45322.1| BnaA03g52950D [Brassica napus]
Length=407

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYE+NS NAVQCLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  218  MFWPRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTNALTHIEDCLKYMAALRDPSIFRF  277

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  278  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  337

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD N+P ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  338  VDKNEPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  372



>gb|AAR20329.1| squalene synthase [Artemisia annua]
Length=418

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YMS L+DP+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHIEDCLKYMSQLKDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F DFS MLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAFSDFSDMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + F ILAIL  Y
Sbjct  346  VDMHDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALLFTILAILYAY  405

Query  124  LSGNKPHSV  98
            LS N+P+ +
Sbjct  406  LSANRPNKI  414



>gb|ABQ96265.1| squalene synthase [Psammosilene tunicoides]
Length=414

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLEELKYE+NS  AVQCLNDMVT+AL HVED LTYMSALRD +IFRF
Sbjct  226  MFWPREIWSKYVDKLEELKYEQNSEKAVQCLNDMVTNALLHVEDSLTYMSALRDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTA VI++T +M DVYG FFDF+CMLK K
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAIVIEQTNSMADVYGAFFDFACMLKPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD  DP A+KTL R+E I K CRDSGTLNKRK Y+++++P  TP
Sbjct  346  VDKRDPNATKTLSRIEAIQKICRDSGTLNKRKLYVVKSKPGLTP  389



>gb|AEM42980.1| squalene synthase [Siraitia grosvenorii]
Length=417

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS LRD SIFRF
Sbjct  226  MFWPREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMSNLRDLSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDFS MLK+K
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTQTMADVYGAFFDFSVMLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V+ +DP A+KTL R+E I KTC  SG LNKRK Y +++EP + P LI++ F +L I+L Y
Sbjct  346  VNSSDPNATKTLSRIEAIQKTCEQSGLLNKRKLYAVKSEPMFNPTLIVILFSLLCIILAY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSAKR  410



>gb|KDO43891.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=213

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRF
Sbjct  26   MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRF  85

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  86   CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  145

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            ++ NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++FFIILAI+  Y
Sbjct  146  INKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIFFIILAIIFSY  205

Query  124  LSGNK  110
            LS  +
Sbjct  206  LSSTR  210



>ref|XP_006412201.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 ref|XP_006412202.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53654.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53655.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
Length=409

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLNDMVT+AL H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPRKIWGKYADKLEDLKYEENSTKAVHCLNDMVTNALIHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFSCMLK K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKMRRGLTAKVIDRTKTMADVYGAFYDFSCMLKIK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP ASKTL RLE + K CRD+G L++RKSY+
Sbjct  348  VDKNDPNASKTLNRLEAVQKVCRDTGVLHQRKSYV  382



>gb|ADG36719.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36721.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++  I+  I+  +
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILILVILFGIMFAH  404

Query  124  LSGNKPHS  101
            LS N+ ++
Sbjct  405  LSANRQNN  412



>emb|CAJ77653.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++  I+  I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILILVILFGIMFAY  404

Query  124  LSGN  113
            LS N
Sbjct  405  LSAN  408



>gb|AFI33135.3| squalene synthase [Eriobotrya japonica]
 gb|AGU36305.1| squalene synthase [Eriobotrya japonica]
Length=412

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTA+VIDRT++M+DVYG FFDFS +L SK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAEVIDRTKSMDDVYGAFFDFSSILNSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD NDP A+K+L R+E + K CRDSG L+KRKSYI   E +Y
Sbjct  346  VDKNDPNATKSLSRVEAVQKLCRDSGALSKRKSYIANREQSY  387



>ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
 gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
Length=414

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  +VQCLN+MVT+AL H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPREIWGKYADKLEDLKYEENSTKSVQCLNEMVTNALMHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  182
            VD NDP  SKTL RLE + K CRDSG LN RKSY+  + +PN
Sbjct  348  VDKNDPNGSKTLNRLEAVQKLCRDSGVLNNRKSYVDDKGQPN  389



>gb|ACR57219.1| squalene synthase [Salvia miltiorrhiza]
Length=413

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK +ENSV AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKSQENSVKAVQCLNDMVTNALVHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK K
Sbjct  286  CAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKIIDRTKTMFDVYGAFYDFSRMLKFK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD  DP A  T  RL+ ILK CRDSGTLN RKSYI+ + P Y
Sbjct  346  VDDKDPNAGTTKDRLDSILKICRDSGTLNDRKSYIIESGPQY  387



>gb|AAR20328.1| squalene synthase [Artemisia annua]
Length=413

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YMS L+DP+IFRF
Sbjct  225  MFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHIEDCLKYMSQLKDPAIFRF  284

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F DFS MLKSK
Sbjct  285  CAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAFSDFSDMLKSK  344

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + F ILAIL  Y
Sbjct  345  VDMHDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALLFTILAILYAY  404

Query  124  LSGNKP  107
            LS N+P
Sbjct  405  LSANRP  410



>dbj|BAA13084.1| squalene synthase [Glycyrrhiza glabra]
Length=412

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMGDVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++  I+  I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILILVILFGIMFAY  404

Query  124  LSGN  113
            LS N
Sbjct  405  LSAN  408



>gb|AFK29284.1| putative squalene synthase 2 [Salvia miltiorrhiza]
 gb|AGE45641.1| squalene synthase 2 [Salvia miltiorrhiza]
 gb|AJR21118.1| squalene synthase 2 [Salvia miltiorrhiza]
Length=414

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+LKYEENSV AV CLNDMVT+AL HVEDCL YM ALRDP+IFRF
Sbjct  226  MFWPREIWSKYANKLEDLKYEENSVKAVHCLNDMVTNALIHVEDCLNYMLALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFS MLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAFYDFSLMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD  DP A KT   LE +LK CRDSG L +R SYI++ +P Y
Sbjct  346  VDDADPNARKTKANLEKVLKLCRDSGALGQRNSYIIQRKPQY  387



>gb|ACX42426.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP+ FRF
Sbjct  226  MFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPANFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG FFDFSC+LK+K
Sbjct  286  CAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFFDFSCLLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliivffiilailLG  128
            VDH+DP+A  TL RLE I +TC++SGTL K R SYIL  E  Y   LI + FIILA    
Sbjct  346  VDHDDPSAKITLSRLEAIQQTCKNSGTLTKSRNSYILENESRYNSVLIAIIFIILAFFYA  405

Query  127  YLSGN  113
            YLS N
Sbjct  406  YLSSN  410



>ref|XP_007131767.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 ref|XP_007131768.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03761.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03762.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
Length=413

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H ED L YM+ALRD SIFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLIYMAALRDSSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RL  I K+CR+SG L+KRKS+I++ E  Y   +I++  I+++I+  Y
Sbjct  346  VDKNDPNATKTLSRLVAIQKSCRESGLLSKRKSFIVKNENGYGSFMIVMLVIMVSIIFAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSAN  409



>gb|AHA84150.1| squalene synthase [Phaseolus vulgaris]
Length=413

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H ED L YMSALRD SIFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLIYMSALRDSSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ +L+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASVLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RL  I K+CR+SG L+KRKS+I++ E  Y   +I++  I+++I+  Y
Sbjct  346  VDKNDPNATKTLSRLVAIQKSCRESGLLSKRKSFIVKNENGYGSFMIVMLVIMVSIIFAY  405

Query  124  LSGNKPHS  101
            L  N PH+
Sbjct  406  LFAN-PHN  412



>emb|CDY17472.1| BnaC03g65910D [Brassica napus]
Length=426

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  244  MFWPRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLKYMAALRDPSIFRF  303

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  304  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  363

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP AS TL RLE + K CRD+G L+KRKSYI
Sbjct  364  VDKNDPNASMTLNRLEAVQKVCRDTGVLHKRKSYI  398



>ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  +VQCLN+MVT+AL H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPREIWGKYADKLEDLKYEENSTKSVQCLNEMVTNALIHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  182
            VD+NDP ASKTL RLE + K C+D+G L+ RKSY+  + +PN
Sbjct  348  VDNNDPNASKTLNRLEAVQKLCKDTGVLHNRKSYVNDKGQPN  389



>gb|ACT52825.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36714.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM  VYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMAGVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+   I+  I+  Y
Sbjct  346  VDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFLVILFGIMFAY  404

Query  124  LSGNKPHS  101
            LS N+ ++
Sbjct  405  LSANRQNN  412



>ref|NP_001280921.1| squalene synthase-like [Malus domestica]
 ref|XP_008382334.1| PREDICTED: squalene synthase-like [Malus domestica]
 gb|AGS78118.1| squalene synthase 2 [Malus domestica]
Length=410

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+ALRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMAALRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++++DVYG FFDF+ ++KSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSIDDVYGAFFDFASVIKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            VD ND  A+KTL R+E + K CRDSG L+KRKSYI+  E N T
Sbjct  346  VDKNDLHATKTLSRVEAVQKLCRDSGALSKRKSYIINNEQNST  388



>ref|XP_009108714.1| PREDICTED: squalene synthase-like isoform X1 [Brassica rapa]
 ref|XP_009108715.1| PREDICTED: squalene synthase-like isoform X2 [Brassica rapa]
Length=410

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLNYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP AS TL RL+ + K CRD+G L+KRKSYI
Sbjct  348  VDKNDPNASMTLNRLDAVQKVCRDTGVLHKRKSYI  382



>ref|XP_010548076.1| PREDICTED: squalene synthase-like isoform X2 [Tarenaya hassleriana]
Length=415

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL+H+EDC+ YM++LRDP+IFRF
Sbjct  228  MFWPRQIWSKYVDKLEDLKYEENSTKAVQCLNDMVTNALTHIEDCVKYMASLRDPAIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT+A+CYNNI VFRGVVKMRRGLTAKV+DRT TM DVYG F+ FS +LK+K
Sbjct  288  CAIPQIMAIGTIALCYNNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAFYSFSRLLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL +LE + K CR+SG L+KRKSY+   +P + P  + +  I+L+I+  Y
Sbjct  348  VDKNDPNATKTLNQLEAVQKVCRESGMLHKRKSYVDDDKPQFNPLYVAILVILLSIVFAY  407

Query  124  LSGNK  110
            L  N+
Sbjct  408  LKANQ  412



>gb|ABG66304.1| squalene synthase [Polygala tenuifolia]
Length=413

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK+EENS  AVQCLNDMVT+AL H EDCL Y+SAL+D +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKHEENSDKAVQCLNDMVTNALMHAEDCLKYVSALKDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVI +T TM DVYG F+DFSCMLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNVQVFRGVVKMRRGLTAKVIHQTNTMADVYGAFYDFSCMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP A+KTL RLE I +TC DS  +NKRKS++   +P Y+ +++I+ FI+LAI+L Y
Sbjct  346  VDRNDPNATKTLSRLESIQRTCLDSRLINKRKSFVNEGQPTYSSSMVIILFIVLAIILAY  405

Query  124  LSGN  113
            L+ N
Sbjct  406  LTAN  409



>gb|AAV58897.1| squalene synthase [Centella asiatica]
Length=415

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW+KYV KLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMS LRDP+IFRF
Sbjct  226  MFWPRKIWNKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHVEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT  M DVYG F+DFSCMLK+K
Sbjct  286  CAIPQIMAIGTLALCYNNLQVFRGVVKMRRGLTAKVIDRTNKMSDVYGAFYDFSCMLKTK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLN-KRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+KTL RLE I K C++SG +   RKSY+L  +  Y   LI + FIILA++  
Sbjct  346  VDNNDPNATKTLSRLEAIQKKCKESGVITPNRKSYVLENDSGYNLVLIAILFIILALVYA  405

Query  127  YLSGN  113
            YLS N
Sbjct  406  YLSSN  410



>ref|XP_006487315.1| PREDICTED: squalene synthase isoform X2 [Citrus sinensis]
 gb|KDO43890.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=295

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRF
Sbjct  108  MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRF  167

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  168  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  227

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            ++ NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++FFIILAI+  Y
Sbjct  228  INKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIFFIILAIIFSY  287

Query  124  LSGNKP  107
            LS  + 
Sbjct  288  LSSTRA  293



>emb|CDX69075.1| BnaC01g03780D [Brassica napus]
Length=398

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  217  MFWPRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMAALRDPSIFRF  276

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  277  CAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  336

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP AS TL RLE + K CRD+G L KRKSY+
Sbjct  337  VDKNDPNASNTLNRLEAMQKVCRDTGVLQKRKSYV  371



>gb|KFK30097.1| hypothetical protein AALP_AA7G216600 [Arabis alpina]
Length=412

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL H+EDCL YM ALRDPSIFRF
Sbjct  228  MFWPRKIWGKYAGKLEDLKYEENSTKAVHCLNEMVTNALMHIEDCLKYMVALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  182
            VD +DP ASKTL R+E + K CRD+G L KRKSY+  + +PN
Sbjct  348  VDKDDPNASKTLNRIEAVQKICRDTGVLQKRKSYVNDKGQPN  389



>emb|CAJ77655.1| squalene synthase 2 [Glycyrrhiza eurycarpa]
Length=412

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+ALRD +IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMAALRDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG FFDF+ ML+SK
Sbjct  286  CAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAFFDFASMLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            V  NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   + +   I+  I+  Y
Sbjct  346  VVKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMTLFLVIVFGIMFAY  404

Query  124  LSGN  113
            LS N
Sbjct  405  LSAN  408



>ref|XP_010432389.1| PREDICTED: squalene synthase [Camelina sativa]
Length=410

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  182
            VD NDP ASKTL RLE + K C D+G LN RKSY+  + +PN
Sbjct  348  VDRNDPNASKTLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  389



>emb|CDX75450.1| BnaA01g02520D [Brassica napus]
Length=398

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  217  MFWPRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMAALRDPSIFRF  276

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  277  CAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  336

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP AS TL RLE + K C+D+G L KRKSY+
Sbjct  337  VDKNDPNASNTLNRLEAVEKVCKDTGVLQKRKSYV  371



>emb|CDX76294.1| BnaA08g11060D [Brassica napus]
Length=400

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  217  MFWPRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLNYMAALRDPSIFRF  276

Query  484  CAIPQ-IMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKS  308
            CAIPQ IMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+
Sbjct  277  CAIPQQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKT  336

Query  307  KVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            KVD NDP AS TL RLE + K CRD+G L+KRKSYI
Sbjct  337  KVDKNDPNASMTLNRLEAVQKVCRDTGVLHKRKSYI  372



>ref|XP_009110610.1| PREDICTED: squalene synthase [Brassica rapa]
 ref|XP_009110680.1| PREDICTED: squalene synthase [Brassica rapa]
Length=409

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP AS TL RLE + K C+D+G L KRKSY+
Sbjct  348  VDKNDPNASNTLNRLEAVEKVCKDTGVLQKRKSYV  382



>ref|XP_011458278.1| PREDICTED: squalene synthase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT++L H+EDCL YMS LRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNSLLHIEDCLKYMSDLRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAK+ID+TRTM DVY  F+DFS ++KSK
Sbjct  286  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDKTRTMADVYAAFYDFSSIIKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD  DP A+KTL RLE + KTCR+SG L  RKSYI+++E ++
Sbjct  346  VDKKDPNATKTLSRLESVQKTCRESGALTNRKSYIIKSEQSF  387



>gb|AAG14896.2|AF302464_1 squalene synthase [Artemisia annua]
 gb|AAK92539.1|AF405310_1 squalene synthase [Artemisia annua]
Length=418

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+I SKYV KLE+LKYEE+S  AVQCLNDMVT+AL H+EDCL YMS L+DP+IFRF
Sbjct  226  MFWPREIRSKYVNKLEDLKYEEDSEKAVQCLNDMVTNALIHIEDCLKYMSQLKDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F DFS MLKSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAFSDFSDMLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + F ILAIL  Y
Sbjct  346  VDMHDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALLFTILAILYAY  405

Query  124  LSGNKPHSV  98
            LS N+P+ +
Sbjct  406  LSANRPNKI  414



>ref|XP_010437580.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=410

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  182
            VD NDP AS TL RLE + K C D+G LN RKSY+  + +PN
Sbjct  348  VDKNDPNASITLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  389



>ref|XP_004290304.1| PREDICTED: squalene synthase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT++L H+EDCL YMS LRDP+IF+F
Sbjct  226  MFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNSLLHIEDCLKYMSDLRDPAIFKF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAK+ID+TRTM DVY  F+DFS ++KSK
Sbjct  286  CAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDKTRTMADVYAAFYDFSSIIKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNY  179
            VD  DP A+KTL RLE + KTCR+SG L N RKSYI+++E ++
Sbjct  346  VDKKDPNATKTLSRLESVQKTCRESGALTNSRKSYIIKSEQSF  388



>gb|ACX42424.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            +FWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS LRDP  FRF
Sbjct  226  IFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMSDLRDPGNFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAI QIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVY  FFDFSC+LK+K
Sbjct  286  CAISQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYDAFFDFSCLLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliivffiilailLG  128
            VDH+DP+A  TL RLE I +TC++SGTL K RKSYIL  E  Y   LI + FIILA    
Sbjct  346  VDHDDPSAKITLSRLEAIQQTCKNSGTLTKSRKSYILENESRYNSVLIAIIFIILAFFYA  405

Query  127  YLSGN  113
            YLS N
Sbjct  406  YLSSN  410



>ref|XP_010548075.1| PREDICTED: squalene synthase-like isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 152/187 (81%), Gaps = 2/187 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleel--kyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIF  491
            MFWPRQIWSKYV KLE    KYEENS  AVQCLNDMVT+AL+H+EDC+ YM++LRDP+IF
Sbjct  228  MFWPRQIWSKYVDKLEVHDLKYEENSTKAVQCLNDMVTNALTHIEDCVKYMASLRDPAIF  287

Query  490  RFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLK  311
            RFCAIPQIMAIGT+A+CYNNI VFRGVVKMRRGLTAKV+DRT TM DVYG F+ FS +LK
Sbjct  288  RFCAIPQIMAIGTIALCYNNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAFYSFSRLLK  347

Query  310  SKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailL  131
            +KVD NDP A+KTL +LE + K CR+SG L+KRKSY+   +P + P  + +  I+L+I+ 
Sbjct  348  TKVDKNDPNATKTLNQLEAVQKVCRESGMLHKRKSYVDDDKPQFNPLYVAILVILLSIVF  407

Query  130  GYLSGNK  110
             YL  N+
Sbjct  408  AYLKANQ  414



>ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana]
 sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Arabidopsis thaliana]
 emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana]
 gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana]
 emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAD00296.1| squalene synthase [Arabidopsis thaliana]
 emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana]
Length=410

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEEN+  +VQCLN+MVT+AL H+EDCL YM +LRDPSIFRF
Sbjct  228  MFWPREIWGKYADKLEDLKYEENTNKSVQCLNEMVTNALMHIEDCLKYMVSLRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN  VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNEQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  182
            VD NDP ASKTL RLE + K CRD+G L  RKSY+  + +PN
Sbjct  348  VDKNDPNASKTLNRLEAVQKLCRDAGVLQNRKSYVNDKGQPN  389



>ref|XP_010447048.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=410

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR++W KY  KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPREVWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP AS TL RLE + K C D+G LN RKSY+
Sbjct  348  VDKNDPNASMTLNRLEAVQKLCIDTGVLNNRKSYV  382



>ref|XP_006423444.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36684.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=267

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRD +IFRF
Sbjct  80   MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSVLRDHAIFRF  139

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  140  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  199

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            ++ NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++FFIILAI+  Y
Sbjct  200  INKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIFFIILAIIFSY  259

Query  124  LSGNK  110
            LS  +
Sbjct  260  LSSTR  264



>ref|XP_006487314.1| PREDICTED: squalene synthase isoform X1 [Citrus sinensis]
 gb|KDO43888.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43889.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=413

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            ++ NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++FFIILAI+  Y
Sbjct  346  INKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIFFIILAIIFSY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSSTR  410



>gb|AIX97193.1| squalene synthase [Matricaria chamomilla var. recutita]
Length=409

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWS YV KLE+LKYEENS  A+QCLN+MVT+AL H+EDCL YMS L+DP+IFRF
Sbjct  226  MFWPREIWSTYVNKLEDLKYEENSEMALQCLNNMVTNALIHIEDCLKYMSQLKDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRTRTM DVY  F DFS M+KSK
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTRTMADVYQAFSDFSDMIKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD +DP+A  T+ RLE   K C+DS TL+ RKSYI + E  Y PAL+ + FIILAIL  Y
Sbjct  346  VDMHDPSAQTTITRLEAAQKICKDSSTLSNRKSYIFKRESGYCPALLALLFIILAILYAY  405

Query  124  LSGN  113
            LS N
Sbjct  406  LSAN  409



>ref|XP_009619298.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=405

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 156/187 (83%), Gaps = 7/187 (4%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK+EENSV AVQCLNDM+T+ALSHVEDCL  +S LRDP+I R 
Sbjct  225  MFWPRQIWSKYVNKLEDLKFEENSVKAVQCLNDMITNALSHVEDCLVCLSTLRDPAILRS  284

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMA+GTL MCYNN  VFRG VKMRRGL+AKV D+TRTMEDVYG FF FS +LKSK
Sbjct  285  CAIPQIMAVGTLTMCYNNAEVFRGAVKMRRGLSAKVFDQTRTMEDVYGAFFHFSSILKSK  344

Query  304  VDHNDPTASKTLKRLEIILKTCRD-SGTLNKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+ TLKR+E I+KTCRD SGTL+KR       +PNY P LII+FFI++AILL 
Sbjct  345  VDNNDPNATNTLKRIESIMKTCRDYSGTLSKRN------KPNYIPTLIIIFFIVVAILLA  398

Query  127  YLSGNKP  107
            YLS  +P
Sbjct  399  YLSAKRP  405



>ref|XP_006423443.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36683.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=356

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRD +IFRF
Sbjct  169  MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSVLRDHAIFRF  228

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  229  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  288

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            ++ NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++FFIILAI+  Y
Sbjct  289  INKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIFFIILAIIFSY  348

Query  124  LSGNK  110
            LS  +
Sbjct  349  LSSTR  353



>ref|XP_010690775.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LK EENS  AVQCLN+M+T+AL HVEDC  YMSAL+D +IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKDEENSEKAVQCLNEMLTNALLHVEDCFKYMSALQDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIM+IGT A+CYNN+ VFRGVVKMRRGLTA VID+T TM DVYG F+DF+CM+K K
Sbjct  286  CAIPQIMSIGTYALCYNNVQVFRGVVKMRRGLTAVVIDQTNTMPDVYGAFYDFACMMKLK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD  DP A+KTL R+E I K CRDSGTLNKRK +I+  +  YTP +++V  II+AI+   
Sbjct  346  VDKRDPNATKTLSRIEAIQKICRDSGTLNKRKLHIVHTKSAYTPIMMMVLLIIVAIIFAR  405

Query  124  LSGNK  110
            LS N+
Sbjct  406  LSANR  410



>ref|XP_010526913.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526914.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526915.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
Length=413

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENS  AVQCLNDMVT+AL+H+EDCL YM++LRDP+IFRF
Sbjct  228  MFWPRQIWSKYVDKLEDLKYEENSNKAVQCLNDMVTNALTHIEDCLKYMASLRDPAIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKV+DRT TM DVYG F+DFS MLK+K
Sbjct  288  CAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAFYDFSPMLKTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD NDP ASKTL R+E + K C DSG  +KRKS+I   E  + P  I++  +ILAI+L Y
Sbjct  348  VDKNDPNASKTLSRIEAVQKICIDSGA-HKRKSFI-TDESRFNPLTIVMLIVILAIVLAY  405

Query  124  LSGNK  110
            L+ N+
Sbjct  406  LNPNQ  410



>ref|XP_010690774.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLN+MVT++L HVEDCL YMSAL+D +IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSEKAVQCLNEMVTNSLLHVEDCLKYMSALKDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIM+IGTLA+CYNNI VFRGVVKMRRGLTA VID+T TM DVYG F+DF+CM+K K
Sbjct  286  CAIPQIMSIGTLALCYNNIQVFRGVVKMRRGLTAIVIDQTNTMPDVYGAFYDFACMMKPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD  DP A KTL R+E I K CRDSGTLN+RK Y+ R +  YTP
Sbjct  346  VDKKDPNAIKTLNRIEAIQKICRDSGTLNQRKLYV-RNKSTYTP  388



>ref|XP_009760451.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
 ref|XP_009760452.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=406

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 153/187 (82%), Gaps = 7/187 (4%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK  ENSV AVQCLNDMVT+ALSH EDCL  +S L DP+IFR 
Sbjct  226  MFWPRQIWSKYVNKLEDLKCGENSVKAVQCLNDMVTNALSHGEDCLVCLSTLHDPAIFRS  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTL MCYNN+ VFRGVVKMRRGL+AKV D+TRTMEDVYG FF FS +LKSK
Sbjct  286  CAIPQIMAIGTLTMCYNNVEVFRGVVKMRRGLSAKVFDQTRTMEDVYGAFFHFSSILKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRD-SGTLNKRKSYILRAEPNYTPaliivffiilailLG  128
            VD+NDP A+ TLKR+E I+KTCRD S TL+KR       +PNY P LIIVFF ++AILL 
Sbjct  346  VDNNDPNATNTLKRIESIMKTCRDYSETLSKRN------KPNYIPTLIIVFFFVVAILLA  399

Query  127  YLSGNKP  107
            YLS  +P
Sbjct  400  YLSAKRP  406



>ref|XP_006423442.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36682.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=413

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS LRD +IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSVLRDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            ++ NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++FFIILAI+  Y
Sbjct  346  INKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIFFIILAIIFSY  405

Query  124  LSGNK  110
            LS  +
Sbjct  406  LSSTR  410



>ref|XP_006351216.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=412

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS+LRDP+IF+F
Sbjct  229  MFWPRQIWSKYVNKLEDFKYEENSVKAVQCLNEMVTNALLYVEDCLTSMSSLRDPAIFQF  288

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVY  F+DF C+++SK
Sbjct  289  CAIPQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYRAFYDFCCIMESK  348

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD +DP A+ TLKRLE ILKTCRDSGTLN+RKSY    +PNY
Sbjct  349  VDRDDPNATSTLKRLEAILKTCRDSGTLNQRKSYTFSHQPNY  390



>ref|XP_010027379.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=274

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP QIW KYV KLE+LKYEENSV AVQCLN+MVTDAL+HVED LTYMSALRDP+IFRF
Sbjct  87   MFWPHQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTDALTHVEDSLTYMSALRDPAIFRF  146

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
             AI QIMAIG LA+ YNNI VFRG VK+R GL AK+ D TRTM DVYG F+DFSCMLKSK
Sbjct  147  WAIFQIMAIGNLALSYNNIEVFRGEVKIRPGLAAKLRDHTRTMADVYGVFYDFSCMLKSK  206

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  185
            VD NDP A+KTL  +E + K CRDSG LNKRKSYIL  EP
Sbjct  207  VDKNDPNATKTLSIIEGMQKACRDSGLLNKRKSYILATEP  246



>ref|XP_010437579.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=419

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 10/171 (6%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KY  KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+ALRDPSIFRF
Sbjct  228  MFWPREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMAALRDPSIFRF  287

Query  484  CAIPQ---------IMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFF  332
            CAIPQ         IMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F+
Sbjct  288  CAIPQVGEGNIIILIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFY  347

Query  331  DFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  182
            DFSCMLK+KVD NDP AS TL RLE + K C D+G LN RKSY+  + +PN
Sbjct  348  DFSCMLKTKVDKNDPNASITLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  398



>ref|XP_006841632.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
 gb|ERN03307.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
Length=407

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW+KY  KLE+ KYEENS  AV+CLN+MVT+AL HVEDCL YMSALRDP+IFRF
Sbjct  226  MFWPREIWNKYALKLEDFKYEENSSEAVRCLNEMVTNALFHVEDCLKYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ +FRGVV+MRRGL A+V+D TR+M DVYG FFDFSCML SK
Sbjct  286  CAIPQIMAIGTLALCYNNVELFRGVVRMRRGLVARVMDETRSMADVYGAFFDFSCMLSSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  203
            VD  DP A+KTL R+E I K CR SG+L+KR+SY
Sbjct  346  VDKGDPNATKTLDRVEAIQKACRASGSLDKRRSY  379



>ref|XP_010065915.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLN+MVT+AL+HVED LTYMSALRDP+IFRF
Sbjct  226  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTNALTHVEDSLTYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
             AI QIMAIG L++ YNNI VFRG VK+R GL AKV DRTRTM DVYG F+DFSCM+KSK
Sbjct  286  WAIFQIMAIGNLSLSYNNIEVFRGEVKIRPGLAAKVRDRTRTMADVYGAFYDFSCMIKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            VD +D  A+KTL  +E I K CRDSG LNKRKSYIL  EP Y+  L+    +IL I++ +
Sbjct  346  VDKDDSNATKTLSIIEGIQKACRDSGLLNKRKSYILATEPTYSSILVAFLLMILVIVVAH  405

Query  124  LSGNK  110
            LS ++
Sbjct  406  LSASQ  410



>ref|XP_004249733.1| PREDICTED: squalene synthase-like isoform X1 [Solanum lycopersicum]
Length=412

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS+LR+P+IF F
Sbjct  229  MFWPRQIWSKYVNKLEDFKYEENSVMAVQCLNEMVTNALLYVEDCLTGMSSLRNPAIFHF  288

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG F+DF C+++SK
Sbjct  289  CAIPQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAFYDFCCIMESK  348

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VD +DP A+ TLKRLE ILKTCRDSGTLN+RKS+    +PNY
Sbjct  349  VDRDDPNATITLKRLEAILKTCRDSGTLNQRKSHTFSHQPNY  390



>ref|XP_010025621.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP QIW KYV KLE+LKYEENSV AVQCLN+MVTDAL+HVED LTYMSALRDP+IFRF
Sbjct  226  MFWPHQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTDALTHVEDSLTYMSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
             AI QIMAIG LA+ YNNI VFRG VK+R GL AK+ D TRTM DVYG F+DFSCMLK K
Sbjct  286  WAIFQIMAIGNLALSYNNIEVFRGEVKIRPGLAAKLRDHTRTMADVYGSFYDFSCMLKPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  185
            VD NDP A+KTL  +E I K CRDSG LNKRKSYIL  EP
Sbjct  346  VDKNDPNATKTLSIIEGIQKACRDSGLLNKRKSYILATEP  385



>emb|CDX69076.1| BnaC01g03770D [Brassica napus]
Length=428

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+LK EENS  AVQCLN+MVT+AL HVE CL  M+ LRDP+IF+ 
Sbjct  229  MFWPREIWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEVCLKSMAGLRDPAIFKS  288

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            C+IPQI+A+GTLA+CYNN+ VFRGVVK+RRGL AKVIDRT+TM+DVYG F+DFSCMLK+K
Sbjct  289  CSIPQIVAMGTLALCYNNVQVFRGVVKLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLKTK  348

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP A KTLKRLE I K CR++G L+KRKSY+
Sbjct  349  VDKNDPNAIKTLKRLEAIEKVCRENGDLHKRKSYV  383



>ref|XP_010025618.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=407

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW KYV KLE+LKYEENSV AVQCLN+MVT+AL+HVED LTYMS+LRDP+IFRF
Sbjct  220  MFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTNALTHVEDSLTYMSSLRDPTIFRF  279

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
             AI QIMAIG L + YNNI VF+G VK+R GL AKV DRTRTM DVYG F+DFSCMLKSK
Sbjct  280  WAIFQIMAIGNLVLSYNNIQVFKGEVKIRPGLAAKVRDRTRTMADVYGAFYDFSCMLKSK  339

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  185
            VD NDP A+KTL  +E I K CRDS  LNKRKSYIL  +P
Sbjct  340  VDKNDPNATKTLSIIEGIQKACRDSSLLNKRKSYILATKP  379



>ref|XP_009769885.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=398

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+ KYEENSV A QCLN+MVT+ALSH EDCLTYMS LRDP IF F
Sbjct  214  MFWPRQIWSKYVNKLEDFKYEENSVKAGQCLNEMVTNALSHAEDCLTYMSNLRDPVIFHF  273

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+ +G L M YNNI VF+GVV+MRRGL AKVI +TRTM DVY  FFDF  +L+SK
Sbjct  274  CAIPQIINMGNLTMYYNNIEVFKGVVEMRRGLCAKVIGQTRTMTDVYRAFFDFCRILESK  333

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            VDHNDP A+ TLKRLE I KTCRDSGTLN+RKS I   + NY
Sbjct  334  VDHNDPNATITLKRLEAISKTCRDSGTLNQRKSCIFSRQRNY  375



>ref|XP_009110500.1| PREDICTED: squalene synthase [Brassica rapa]
Length=418

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+LK EE S  AVQCLN+MVT+AL HVEDCL  M+ LRDP+IF+ 
Sbjct  229  MFWPREIWGKYVDKLEDLKNEEKSTKAVQCLNEMVTNALIHVEDCLKSMAGLRDPAIFKS  288

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+A+GTLA+CYNN+ VFRG VK+RRGL AKVIDRT+TM DVYG F+DFSCMLK+K
Sbjct  289  CAIPQIVAMGTLALCYNNVQVFRGAVKLRRGLIAKVIDRTKTMGDVYGAFYDFSCMLKTK  348

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP A KTL+RLE I K CR++G L+KRKSY+
Sbjct  349  VDKNDPNAMKTLQRLETIEKVCRENGDLHKRKSYV  383



>gb|AAB61927.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+ K EE +  AVQCLN+MVT+AL+HVEDCL  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDFKNEEKATKAVQCLNEMVTNALNHVEDCLKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTL +CYNN+ VFRGVV+MRRGL AKVIDRT+TM+DVYG F+DFSCML++K
Sbjct  288  CAIPQIVAIGTLTLCYNNVQVFRGVVRMRRGLIAKVIDRTKTMDDVYGAFYDFSCMLQTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD+NDP A KTL RLE I K CR++G L+KRKSY+
Sbjct  348  VDNNDPNAMKTLNRLETIKKVCRENGVLHKRKSYV  382



>emb|CDX75451.1| BnaA01g02510D [Brassica napus]
Length=413

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+LK EE S  AVQCLN+MVT+AL HVEDCL  M+ LRDP+IF+ 
Sbjct  229  MFWPREIWGKYVDKLEDLKNEEKSTKAVQCLNEMVTNALIHVEDCLKSMAGLRDPAIFKS  288

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+A+GTLA+CYNN+ VFRG VK+RRGL AKVIDRT+TM+DVYG F+DFSCMLK+K
Sbjct  289  CAIPQIVAMGTLALCYNNVQVFRGAVKLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLKTK  348

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD  DP A KTL+RLE I K CR++G L+KRKSY+
Sbjct  349  VDKKDPNAMKTLQRLETIEKVCRENGDLHKRKSYV  383



>ref|XP_010312074.1| PREDICTED: squalene synthase-like isoform X2 [Solanum lycopersicum]
Length=384

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS+LR+P+IF F
Sbjct  229  MFWPRQIWSKYVNKLEDFKYEENSVMAVQCLNEMVTNALLYVEDCLTGMSSLRNPAIFHF  288

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG F+DF C+++SK
Sbjct  289  CAIPQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAFYDFCCIMESK  348

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD +DP A+ TLKRLE ILKTCRDSGTLN+RK+YI
Sbjct  349  VDRDDPNATITLKRLEAILKTCRDSGTLNQRKNYI  383



>gb|KDO43893.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43894.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=386

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  212
            ++ NDP A+KTL R+E I K C DSG LNKR
Sbjct  346  INKNDPNATKTLSRVEAIQKACMDSGVLNKR  376



>gb|KDO43892.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=384

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F+DFS +LK K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  212
            ++ NDP A+KTL R+E I K C DSG LNKR
Sbjct  346  INKNDPNATKTLSRVEAIQKACMDSGVLNKR  376



>gb|AGN32410.1| squalene synthase [Dioscorea zingiberensis]
Length=409

 Score =   223 bits (567),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKY  KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMSAL+D +IFRF
Sbjct  226  MFWPRQIWSKYADKLEDLKYEENSAKAVECLNDMVTNALMHAEDCLVYMSALKDIAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TRTM DVYG F+DFS +LK+K
Sbjct  286  CAIPQVMAIGTLALCYNNLEVFRGVVKMRRGLTARVIDQTRTMADVYGAFYDFSSLLKAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            V+  DP A  T KR+E I K C  SG LNKR   +   +P + P
Sbjct  346  VNDKDPNAELTKKRVEAIQKACISSGLLNKRGLQVCDTKPTFNP  389



>ref|NP_195191.2| squalene synthase 2 [Arabidopsis thaliana]
 emb|CAA18844.2| putative squalene synthase [Arabidopsis thaliana]
 emb|CAB80182.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86404.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+ K EE +  AVQCLN+MVT+AL+HVEDCL  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDFKNEEKATKAVQCLNEMVTNALNHVEDCLKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AKVIDRT+TM+DVYG F+DFSCML++K
Sbjct  288  CAIPQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLQTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD+NDP A KTL RLE I K C+++G L+KRKSY+
Sbjct  348  VDNNDPNAMKTLNRLETIKKFCKENGGLHKRKSYV  382



>ref|XP_010437577.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=410

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+ K EENS  AVQCLN+MVT+AL HVEDCL  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDFKKEENSTKAVQCLNEMVTNALIHVEDCLKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNN+ VF GVV++RRGL AK+IDRT+TM+DVYG F+DFSCML+SK
Sbjct  288  CAIPQIVAIGTLALCYNNVQVFGGVVRLRRGLIAKIIDRTKTMDDVYGVFYDFSCMLQSK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP A KTL RLE I K CR++G L+KRK+Y+
Sbjct  348  VDKNDPNAMKTLNRLETIKKVCRENGVLHKRKTYV  382



>ref|XP_008795796.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=408

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+L+YEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRF
Sbjct  226  MFWPREIWSKYASKLEDLQYEENSTKAVQCLNDMVTNALVHAEDCLQYMSALKDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            C IPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK
Sbjct  286  CVIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAE  188
            +D NDP AS T  R+E I K C  SG LNKR  ++  ++
Sbjct  346  IDDNDPNASLTRHRVEAIHKACISSGLLNKRGRHMYESK  384



>ref|XP_010447047.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+ K EEN+  AVQCLN+MVT+AL HVEDCL  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDFKNEENATKAVQCLNEMVTNALIHVEDCLKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AK+IDRT+TM+DVYG F DFSCML+SK
Sbjct  288  CAIPQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKIIDRTKTMDDVYGVFCDFSCMLQSK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP A  TL RLE I K CRD+G L+KRK+Y+
Sbjct  348  VDKNDPNAVITLNRLETIKKVCRDNGVLHKRKTYV  382



>gb|AFN61199.1| squalene synthase [Chlorophytum borivilianum]
Length=410

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIW+KY  KLE+ KYEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRF
Sbjct  226  MFWPRQIWNKYADKLEDFKYEENSEKAVQCLNDMVTNALDHAEDCLQYMSALKDIAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLA+CYNN+ VFRGVVKMRRGLTAKVID+TRTM DVYG FF+FS ++K+K
Sbjct  286  CAIPQVMAIGTLALCYNNVKVFRGVVKMRRGLTAKVIDQTRTMSDVYGAFFEFSSLMKTK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            V+  DP A+ TLKR+E I K+C  SG L+KR   + +++  +
Sbjct  346  VNDLDPNAALTLKRIEAIQKSCISSGNLDKRGCSLYKSQTQH  387



>ref|XP_008796678.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796679.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=409

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+LKYEENS  AVQCLNDMVT+AL H EDCL Y+ AL+D +IF+F
Sbjct  226  MFWPREIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLQYLFALKDLAIFQF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            +D NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  346  IDDNDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  387



>ref|XP_008796681.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+LKYEENS  AVQCLNDMVT+AL H EDCL Y+ AL+D +IF+F
Sbjct  226  MFWPREIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLQYLFALKDLAIFQF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            +D NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  346  IDDNDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  387



>gb|KFK30098.1| hypothetical protein AALP_AA7G216700 [Arabis alpina]
Length=413

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR++W KYV KLE+LK EENS  AVQCLN+MVT+AL HVEDCL  +++LR+P I   
Sbjct  229  MFWPREMWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEDCLKCLASLRNPEILLS  288

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNN+ VFRGVVK+RRGL AKVIDRT+TM+DVYG F+DFSCML++K
Sbjct  289  CAIPQIVAIGTLALCYNNVQVFRGVVKLRRGLIAKVIDRTKTMDDVYGAFYDFSCMLQTK  348

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP A KTL RLE I K CR++G  +KRKSY+
Sbjct  349  VDKNDPNAMKTLNRLETIKKVCRENGAFHKRKSYV  383



>ref|XP_002869132.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45391.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+LK EE S  AVQCLN+MVT+AL+HVEDCL  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDLKNEEKSTQAVQCLNEMVTNALTHVEDCLKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTL +CYNN+ VFRG V++RRGL AKVID T+TM+DVYG F+DFSCML++K
Sbjct  288  CAIPQIVAIGTLTLCYNNVQVFRGAVRLRRGLIAKVIDLTKTMDDVYGAFYDFSCMLQTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP A KTL RLE I K C+++G ++KRKSY+
Sbjct  348  VDKNDPNAMKTLNRLETIKKVCKENGVIHKRKSYV  382



>ref|XP_010432387.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE L+YEENS  AV+CLN+MVT+AL HVEDCL  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEVLQYEENSTKAVKCLNEMVTNALIHVEDCLKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNNI VFRGVV++RRGL AK+IDRT+ M+DVYG F+DFSCML+SK
Sbjct  288  CAIPQIVAIGTLALCYNNIQVFRGVVRLRRGLIAKIIDRTKNMDDVYGLFYDFSCMLQSK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD +DP A KTL RLE I K  RD+G L+KRK+Y+
Sbjct  348  VDKSDPDAMKTLNRLETIKKVSRDNGVLHKRKTYV  382



>ref|XP_010934354.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
 ref|XP_010910886.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
Length=408

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP +IWSKY  KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRF
Sbjct  226  MFWPWEIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLHYMSALKDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +L+SK
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLESK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAE  188
            +D NDP AS T  R+E I K C  SG LNKR  ++  ++
Sbjct  346  IDDNDPNASLTRHRVEAIHKACISSGFLNKRGRHMYESK  384



>ref|XP_009396917.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396918.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP QIWSKY  KLE+ KY ENS  AVQCLND+VT+AL H EDCL YMS L+D SIFRF
Sbjct  226  MFWPHQIWSKYANKLEDFKYVENSTKAVQCLNDLVTNALIHAEDCLQYMSGLKDLSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
             AIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVID+T +M DVYG F++FS +LKSK
Sbjct  286  AAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDQTYSMSDVYGAFYEFSSLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            +D+NDP AS T +R++ I KTC  SG L+KR  ++  ++ +Y 
Sbjct  346  IDNNDPNASLTHQRVDAIQKTCISSGLLSKRSLHVYESKFHYV  388



>gb|AGW25489.1| squalene synthase [Paris polyphylla var. yunnanensis]
Length=403

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEENS NA+ CLNDMVT+AL H EDCL YMSAL++ SIFRF
Sbjct  226  MFWPREIWSKYANKLEDFKYEENSTNALHCLNDMVTNALMHAEDCLQYMSALKNLSIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN  +FRGVVKMRRGL A+VID+T+TM D YG F++FS +LKSK
Sbjct  286  CAIPQIMAIGTLALCYNNQELFRGVVKMRRGLVARVIDQTKTMSDTYGAFYEFSSLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            +D  DP A+ T +R+E I K+C  SG LNKR+  +  ++P Y
Sbjct  346  IDKKDPNATLTWERIEAIQKSCISSGLLNKRRCRMYESKPAY  387



>gb|AHB20141.2| squalene synthase [Fritillaria thunbergii]
Length=409

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR IWSKYV KLE+LKY+ENS  AVQCLNDMVT+AL H +DCL Y+S L+D S FRF
Sbjct  226  MFWPRAIWSKYVDKLEDLKYKENSTQAVQCLNDMVTNALLHAQDCLKYLSDLKDLSNFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMA+GTLA+CYNN+ +FRGVVKMRRG+ A+V+D+TRTM DVYG FF+FS +LKSK
Sbjct  286  CAIPQIMAMGTLALCYNNVEIFRGVVKMRRGVVARVMDQTRTMSDVYGAFFEFSSLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            +D+NDP AS T  R+E I  +C  SG LNKR  ++ R+ P Y
Sbjct  346  IDNNDPNASLTRMRIEAIQNSCVKSGMLNKRGCHMYRSSPAY  387



>ref|XP_010437578.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=407

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 131/155 (85%), Gaps = 3/155 (2%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+ K EENS  AVQCLN+MVT+AL HVEDCL  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDFKKEENSTKAVQCLNEMVTNALIHVEDCLKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNN+ VF GVV++RR   AK+IDRT+TM+DVYG F+DFSCML+SK
Sbjct  288  CAIPQIVAIGTLALCYNNVQVFGGVVRLRR---AKIIDRTKTMDDVYGVFYDFSCMLQSK  344

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD NDP A KTL RLE I K CR++G L+KRK+Y+
Sbjct  345  VDKNDPNAMKTLNRLETIKKVCRENGVLHKRKTYV  379



>ref|XP_006412200.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
 gb|ESQ53653.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
Length=396

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+LK EENS  AVQCLN+MVT+AL HVED L  +++LR+P+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEDSLKTIASLRNPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AKV DRT+TM+DVYG F+DFSCMLK+K
Sbjct  288  CAIPQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKVYDRTKTMDDVYGAFYDFSCMLKAK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  185
            VD NDP A KTL RLE I + CR++G  +KR+   L   P
Sbjct  348  VDKNDPNAIKTLNRLETIKRVCRENGVFHKRQGSFLLLVP  387



>gb|AFY63035.1| squalene synthase [Alisma plantago-aquatica subsp. orientale]
Length=409

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+LKYEE+S  AV+CLNDMVTDAL H EDCL YMS L+D SIFRF
Sbjct  226  MFWPREIWSKYADKLEDLKYEESSDKAVECLNDMVTDALRHAEDCLQYMSDLQDISIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+C+NNI VF+GVVKMRRGL AK+ID+T+TM DVY  F+ FS +LKSK
Sbjct  286  CAIPQIMAIGTLALCFNNIEVFQGVVKMRRGLAAKIIDQTKTMTDVYNAFYGFSHLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRK  209
            +++ DP AS TLKRL++I K C DSG L+KR+
Sbjct  346  INYKDPNASLTLKRLDVIQKVCLDSGLLDKRQ  377



>ref|XP_009389044.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=408

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKY  KLE  K   NS  AV+CLND+VT+AL H EDCL YMSAL+D +IFRF
Sbjct  226  MFWPRQIWSKYADKLEGFKNAGNSTKAVECLNDLVTNALIHAEDCLQYMSALKDLAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAK+ID+T +M DVYG F++FS +LKSK
Sbjct  286  CAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKIIDQTNSMSDVYGAFYEFSSLLKSK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  212
            +D NDP A  T K +E I K C  SG L+ R
Sbjct  346  IDDNDPNAKLTRKHVEAIQKACGSSGLLDTR  376



>gb|EAY92248.1| hypothetical protein OsI_13969 [Oryza sativa Indica Group]
Length=397

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMSAL+D +IFRF
Sbjct  216  MFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDHAIFRF  275

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F++FS +++SK
Sbjct  276  CAIPQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEFSSLIESK  335

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILR  194
            +D+NDP AS T KR++ I +TC+ S +L KR+ Y L 
Sbjct  336  IDNNDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDLE  371



>ref|NP_001051625.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAA22557.1| squalene synthase [Oryza sativa Japonica Group]
 gb|AAS07223.1| squalene synthase [Oryza sativa Japonica Group]
 gb|ABF99429.1| Squalene synthetase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13539.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAH01306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMSAL+D +IFRF
Sbjct  222  MFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDHAIFRF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F++FS +++SK
Sbjct  282  CAIPQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEFSSLIESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILR  194
            +D+NDP AS T KR++ I +TC+ S +L KR+ Y L 
Sbjct  342  IDNNDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDLE  377



>gb|EEE60131.1| hypothetical protein OsJ_13016 [Oryza sativa Japonica Group]
Length=413

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMSAL+D +IFRF
Sbjct  232  MFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDHAIFRF  291

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F++FS +++SK
Sbjct  292  CAIPQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEFSSLIESK  351

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILR  194
            +D+NDP AS T KR++ I +TC+ S +L KR+ Y L 
Sbjct  352  IDNNDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDLE  387



>dbj|BAJ99680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   205 bits (522),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H  DCL YMSAL+D S FRF
Sbjct  80   MFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAHDCLQYMSALKDNSNFRF  139

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T+++ DVY  F++FS +L+SK
Sbjct  140  CAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARIIDETKSISDVYSAFYEFSSLLESK  199

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            +D NDP A+ T KR++ I KTC+ SG L KR+ Y L       P LI++  ++ AI+LG 
Sbjct  200  IDDNDPNAALTRKRVDAIKKTCKSSGLL-KRRGYDLEKSKYRMPMLIMIVLLLAAIILGV  258

Query  124  LSG  116
            L G
Sbjct  259  LYG  261



>ref|XP_004981370.1| PREDICTED: squalene synthase-like [Setaria italica]
Length=289

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR IWSKY  KLE+ KYEENS   VQCLNDMVT+AL H EDCL YMSAL+D +IFRF
Sbjct  108  MFWPRDIWSKYADKLEDFKYEENSEKGVQCLNDMVTNALIHAEDCLQYMSALKDHTIFRF  167

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A CYNN+ VFRGVVKMRRGLTA+VI  T +M DVY  F++FS +L+SK
Sbjct  168  CAIPQIMAIGTCAFCYNNVNVFRGVVKMRRGLTARVIYETDSMSDVYTAFYEFSLLLESK  227

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP A+ T KR++ I +TC+ SG L KR+ Y L   P Y P
Sbjct  228  IDDNDPNAALTRKRVDSIKQTCKSSGLL-KRRGYHLDKSP-YKP  269



>ref|NP_001104839.1| squalene synthase1 [Zea mays]
 dbj|BAA22558.1| squalene synthase [Zea mays]
 gb|ACN34757.1| unknown [Zea mays]
 gb|AFW67298.1| Squalene synthase isoform 1 [Zea mays]
 gb|AFW67299.1| Squalene synthase isoform 2 [Zea mays]
Length=401

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEENS  AVQCLN+MVTDAL H E+CL YMSAL+DP+IFRF
Sbjct  222  MFWPREIWSKYADKLEDFKYEENSKKAVQCLNNMVTDALIHAEECLQYMSALKDPAIFRF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK
Sbjct  282  CAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMTDVYTAFYEFSSLIESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D +DP A+ T +R++ I +TC+ SG L K++ Y L   P Y P
Sbjct  342  IDDSDPNAALTQRRVDSIKQTCKSSG-LVKQRGYHLEKSP-YRP  383



>ref|XP_003559279.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=403

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKY+ENS  AVQCLNDMVT+AL H +DCL YMSAL+D ++FR 
Sbjct  222  MFWPREIWSKYVEKLEDLKYKENSEKAVQCLNDMVTNALIHAKDCLQYMSALKDDTVFRL  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMA+G  A+CYNN+ VFRG+VKMR GLTA+VID T++M DVY  F++FS +L+SK
Sbjct  282  CAIPQIMAMGNFAICYNNVNVFRGLVKMRHGLTARVIDETKSMSDVYTAFYEFSSLLESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP+A+ T KR++ I KTC+ SG L KR+ Y L  +P Y P
Sbjct  342  IDDNDPSAALTRKRVDAIKKTCKSSGLL-KRRGYDLE-KPKYMP  383



>dbj|BAJ87710.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H  DCL YMSAL+D S FRF
Sbjct  222  MFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAHDCLQYMSALKDNSNFRF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T+++ DVY  F++FS +L+SK
Sbjct  282  CAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARIIDETKSISDVYSAFYEFSSLLESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            +D NDP A+ T KR++ I KTC+ SG L KR+ Y L       P LI++  ++ AI+LG 
Sbjct  342  IDDNDPNAALTRKRVDAIKKTCKSSGLL-KRRGYDLEKSKYRMPMLIMIVLLLAAIILGV  400

Query  124  LSG  116
            L G
Sbjct  401  LYG  403



>ref|XP_006651930.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=403

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEENS  AVQCLND+VT+AL H EDCL YMSAL+D +IFRF
Sbjct  222  MFWPREIWSKYANKLEDFKYEENSEKAVQCLNDLVTNALYHAEDCLKYMSALKDHAIFRF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T +M DVY  F++FS +++SK
Sbjct  282  CAIPQIMAIGTCAVCYNNVNVFRGVVKMRRGLTARVIDETNSMSDVYTAFYEFSSLIESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            +D+NDP AS T KR++ I +TC  S +L +R   + +++ N T
Sbjct  342  IDNNDPNASLTRKRVDAIKRTCMSSCSLKRRGYDLEKSKYNTT  384



>gb|AGI56082.1| squalene synthase [Dendrobium catenatum]
Length=410

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  661  FWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFC  482
            FWP QIW+KY  KLE+LKYEENSV AVQCLNDMVT+AL H EDCL Y+S L+  SIFRFC
Sbjct  227  FWPWQIWNKYANKLEDLKYEENSVKAVQCLNDMVTNALVHAEDCLKYLSNLKTHSIFRFC  286

Query  481  AIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKV  302
            AIPQIMAIGTLA+CY N  VFRGVVKMRRGLTA++ D+TR+M DVYG F+DFS +L++K+
Sbjct  287  AIPQIMAIGTLALCYGNEEVFRGVVKMRRGLTARISDQTRSMADVYGAFYDFSSLLETKI  346

Query  301  DHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  176
            D  DP A  T KR++ I K C  +G LNKR  Y++R    Y+
Sbjct  347  DEKDPNAILTRKRVDAIKKACVSTGLLNKRGLYVVRKRAMYS  388



>ref|XP_008795798.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=373

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -1

Query  598  NSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVF  419
            NS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRFC IPQIMAIGTLA+CYNN+ VF
Sbjct  213  NSTKAVQCLNDMVTNALVHAEDCLQYMSALKDLAIFRFCVIPQIMAIGTLALCYNNVEVF  272

Query  418  RGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKRLEIILKTC  239
            RGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK+D NDP AS T  R+E I K C
Sbjct  273  RGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSKIDDNDPNASLTRHRVEAIHKAC  332

Query  238  RDSGTLNKRKSYILRAE  188
              SG LNKR  ++  ++
Sbjct  333  ISSGLLNKRGRHMYESK  349



>emb|CDX72494.1| BnaC07g45160D [Brassica napus]
Length=395

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 126/156 (81%), Gaps = 1/156 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+LK E+ S  AVQCLNDM+T+AL HVEDCL  M+ALRDP+I   
Sbjct  228  MFWPREIWGKYVDKLEDLKDEDKSTKAVQCLNDMITNALIHVEDCLKSMAALRDPAILHS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            C+IP I+AIGTLA+CYNNI VFRG +K+RRGL AKV DRT+TM+DV G F+DFSCML++K
Sbjct  288  CSIPLIVAIGTLALCYNNIQVFRGSLKLRRGLIAKVFDRTKTMDDVCGAFYDFSCMLETK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRD-SGTLNKRKSYI  200
            VD  DP A KTL RLE I K CR+  G +++RKSY+
Sbjct  348  VDKKDPNAMKTLNRLETIKKVCREYGGDIHQRKSYV  383



>gb|AIW04729.1| squalene synthase [Dryopteris fragrans]
Length=412

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR IW KY  KLE+ K EENS  AV+CLND++T+ALSH  DCLTYM+AL+D ++FRF
Sbjct  227  MFWPRDIWGKYASKLEDFKEEENSEAAVECLNDLITNALSHALDCLTYMAALKDHAVFRF  286

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAK++D+T TM DVYG F+DF  ML  K
Sbjct  287  CAIPQIMAIGTLAVCYNNVHVFRGVVKIRRGLTAKIMDQTHTMADVYGAFYDFCSMLSVK  346

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  203
            ++  DP++ +TL  +E I   CR SGTL+KR+ +
Sbjct  347  INKKDPSSQRTLNCVEAIQHACRSSGTLSKRRVF  380



>gb|EMT03383.1| Squalene synthetase [Aegilops tauschii]
Length=450

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H +DCL YMSAL+D S FRF
Sbjct  268  MFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAQDCLQYMSALKDNSNFRF  327

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T+++ DVY  F++FS +L+SK
Sbjct  328  CAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARVIDETKSISDVYSAFYEFSSLLESK  387

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGY  125
            +D NDP A+ T +R++ I KTC+ SG L KR+ Y L       P LI++  +++AI+LG 
Sbjct  388  IDDNDPNAALTRRRVDAIKKTCKSSGLL-KRRGYDLEKSMYRMPMLIMIALLLVAIILGV  446

Query  124  LSG  116
            L G
Sbjct  447  LYG  449



>ref|XP_006351382.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=400

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 127/163 (78%), Gaps = 11/163 (7%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+ KYEENSV AVQCLN          EDCL YMS LRDPSIF+F
Sbjct  226  MFWPRQIWSKYVNKLEDFKYEENSVKAVQCLN----------EDCLVYMSNLRDPSIFQF  275

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIP ++ +G L M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG FFDF C+++SK
Sbjct  276  CAIPLVINMGNLMMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAFFDFCCIMESK  335

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNY  179
            VD +DP A+ TLKRLE I K CR+SGTL N+RKSY    +PNY
Sbjct  336  VDRDDPNATSTLKRLEEISKNCRNSGTLINQRKSYTFSHQPNY  378



>gb|ACN33457.1| unknown [Zea mays]
Length=275

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IFRF
Sbjct  108  MFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFRF  167

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK
Sbjct  168  CAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESK  227

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  228  IDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  269



>ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
Length=305

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMSALRDP+IFRF
Sbjct  184  MFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMSALRDPAIFRF  243

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKVIDRT TM DVYG F+DFSCMLK++
Sbjct  244  CAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAFYDFSCMLKAR  303



>gb|AFS28708.1| putative squalene synthase, partial [Olea europaea]
Length=171

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMSALRDP+IFRF
Sbjct  55   MFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVEDCLKYMSALRDPAIFRF  114

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCML  314
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F+DFS ML
Sbjct  115  CAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGDFYDFSRML  171



>ref|XP_002466259.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
 gb|EER93257.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
Length=403

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEENS  AVQCLND+VT+AL H E+CL YMSAL+  +IFRF
Sbjct  222  MFWPREIWSKYADKLEDFKYEENSEKAVQCLNDLVTNALIHAEECLQYMSALKGHAIFRF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK
Sbjct  282  CAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMADVYTSFYEFSSLIESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP A+ T +R++ I +TC+ SG L KR+ Y L   P Y P
Sbjct  342  IDDNDPNAALTRRRVDSIKQTCKSSG-LVKRRGYHLDKSP-YRP  383



>tpg|DAA52015.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=261

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IF F
Sbjct  80   MFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFHF  139

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK
Sbjct  140  CAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESK  199

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  200  IDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  241



>ref|XP_003564211.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=402

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  +LE+LKYEENS  AVQCLNDMVT+AL H EDCL YMSAL+D + FRF
Sbjct  222  MFWPREIWSKYADELEDLKYEENSERAVQCLNDMVTNALIHAEDCLQYMSALKDNANFRF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A CYNN+ VFR VVKMRRGLTA+++D T++M DVY  F++FS +L+SK
Sbjct  282  CAIPQIMAIGTCAQCYNNVQVFRRVVKMRRGLTARIMDETKSMSDVYTAFYEFSSLLESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP+A+ T +R++ I K CR SG L KR+ Y L+ +  Y P
Sbjct  342  IDDNDPSAAITRERVDAIKKRCRSSGLL-KRRGYDLQ-KSQYRP  383



>gb|AHI96421.1| squalene synthase [Pinus massoniana]
Length=409

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW+KYV +LE+LK EE S  AVQCLN+MVT+AL H  DCL Y+SALRDP+IFRF
Sbjct  226  MFWPREIWAKYVSRLEDLKEEERSKEAVQCLNEMVTNALKHANDCLKYLSALRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTL  CYNNI VF+GVVK+RRGLTAK+++RT TM DVYG FFDFS  L SK
Sbjct  286  CAIPQIMAIGTLERCYNNIEVFKGVVKIRRGLTAKIMERTNTMADVYGAFFDFSRSLASK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  203
            V  +DP A +TL  ++ I +TC+ SG L +R+++
Sbjct  346  VPKDDPNARETLNCIDDIQRTCKASGLLARRRTF  379



>gb|EYU37849.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=346

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPRQIWSKYV KLE+LK+EENSV AVQCLNDMVT+AL H+EDCL YMS LRDP+IFRF
Sbjct  226  MFWPRQIWSKYVNKLEDLKHEENSVKAVQCLNDMVTNALIHIEDCLKYMSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F+DFS MLK K
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAFYDFSRMLKYK  345

Query  304  V  302
            V
Sbjct  346  V  346



>ref|NP_001130502.1| uncharacterized protein LOC100191601 [Zea mays]
 gb|ACF78747.1| unknown [Zea mays]
Length=403

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IFRF
Sbjct  222  MFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFRF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CA+PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK
Sbjct  282  CAVPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  342  IDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  383



>gb|ABK24732.1| unknown [Picea sitchensis]
Length=409

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW+KYV KLE+LK EE S  AVQCLN+MVT+AL H  DCL Y+S LRDP+IFRF
Sbjct  226  MFWPREIWAKYVSKLEDLKEEEWSKEAVQCLNEMVTNALKHANDCLKYLSDLRDPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTL  CYNNI VFRGVVK+RRGLTAK+++RT TM DVYG FFDFS  L SK
Sbjct  286  CAIPQIMAIGTLERCYNNIEVFRGVVKIRRGLTAKIMERTNTMADVYGAFFDFSRSLASK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  203
            V  +DP A +TL  ++ I +TC+ SG L +R ++
Sbjct  346  VPEDDPNAKETLNCIDEIQRTCKASGLLARRTTF  379



>ref|XP_011047507.1| PREDICTED: squalene synthase isoform X2 [Populus euphratica]
Length=346

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSV AVQCLN+MVT++L HV+DCL YMSAL +P+IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSVEAVQCLNEMVTNSLIHVDDCLKYMSALPEPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA+VI RT+TM DVYG FFDFSCMLKSK
Sbjct  286  CAIPQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQVIHRTKTMADVYGAFFDFSCMLKSK  345

Query  304  V  302
            V
Sbjct  346  V  346



>tpg|DAA52014.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=403

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMSAL++ +IF F
Sbjct  222  MFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFHF  281

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F++FS +++SK
Sbjct  282  CAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESK  341

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            +D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  342  IDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  383



>ref|XP_006658375.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=363

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENSVNAV+CLN+MVT+ L H EDCL YMSAL+D +I RF
Sbjct  181  MFWPREIWSKYVDKLEDLKYEENSVNAVKCLNEMVTNGLIHTEDCLRYMSALKDIAILRF  240

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MA+ T A+CYNN+ VFRGVVKMRRGLTA++I+ T +M DVY  F++FS +L+ K
Sbjct  241  CAIPQVMALATYALCYNNVNVFRGVVKMRRGLTARIINETNSMSDVYTAFYEFSSLLEEK  300

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPN  182
            +D NDP AS T K +  I ++C+ SG L KR   + R + N
Sbjct  301  IDENDPNASLTWKYVNAIKESCKSSGMLKKRGYDLDRPKRN  341



>ref|XP_006285747.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
 gb|EOA18645.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
Length=413

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IW KYV KLE+ K EE S  AVQCLN+MVT+AL HVEDC+  +++LRDP+IF+ 
Sbjct  228  MFWPREIWGKYVDKLEDFKNEETSTKAVQCLNEMVTNALIHVEDCMKSLASLRDPAIFQS  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AKVIDRT+TM+DVYG F+DFSCML++K
Sbjct  288  CAIPQIVAIGTLALCYNNVQVFRGVVRVRRGLIAKVIDRTKTMDDVYGVFYDFSCMLQTK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            VD ND  A KT  RLE I K CR++G L KRKSY+
Sbjct  348  VDKNDANAMKTFNRLETIKKVCRENGVLEKRKSYV  382



>gb|EMS67019.1| Squalene synthase [Triticum urartu]
Length=384

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 127/168 (76%), Gaps = 17/168 (10%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL H +DCL YMSAL+D S FRF
Sbjct  185  MFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAQDCLQYMSALKDNSNFRF  244

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T+++ DVY  F++FS +L+SK
Sbjct  245  CAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARVIDETKSISDVYSAFYEFSSLLESK  304

Query  304  -----------------VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  212
                             +D NDP A+ T +R++ I KTC+ SG L +R
Sbjct  305  LFSSCDFIHNMFGRHAQIDDNDPNAALTRRRVDAIKKTCKSSGLLKRR  352



>gb|ABI14439.1| squalene synthase [Taxus cuspidata]
Length=409

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP +IWSKYV  LE+LK EE S  AVQCLN+M+T+AL H  DCL YM+AL++P+IFRF
Sbjct  226  MFWPHEIWSKYVPNLEDLKEEECSKEAVQCLNEMITNALKHANDCLKYMAALKNPAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMA+ TL +CYNN+ VFR VVK+RRGLTAK++DRT++M DVY  FFDFS  L SK
Sbjct  286  CAIPQIMALATLEICYNNLQVFRRVVKIRRGLTAKIMDRTKSMADVYEAFFDFSGSLASK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            V  +DP A+ TLK ++ I +TC  SG + KR+S+ + ++  +
Sbjct  346  VPKDDPNATVTLKYIDEIQRTCNASGLMAKRRSFTIDSKKGH  387



>ref|NP_001059129.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAC84212.1| putative squalene synthase [Oryza sativa Japonica Group]
 dbj|BAF21043.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAG88654.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66758.1| hypothetical protein OsJ_23470 [Oryza sativa Japonica Group]
Length=410

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYE NSV AV+CLN+MVT+ L H EDCL YMSAL+D +I RF
Sbjct  228  MFWPREIWSKYVDKLEDLKYENNSVKAVKCLNEMVTNGLIHTEDCLRYMSALKDITILRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MA+ T A+CYNN+ VFRGVVK+RRGLTA++I+ T +M DVY  F++FS +L  K
Sbjct  288  CAIPQVMALATYALCYNNVNVFRGVVKLRRGLTARIINETNSMADVYTAFYEFSSLLAEK  347

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  212
            +D NDP AS T KR+  I +TC+ SG L  R
Sbjct  348  IDDNDPNASLTRKRVNAIKETCKSSGLLKIR  378



>gb|AEX58673.1| squalene synthase [Huperzia serrata]
Length=420

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP +IW KY  +L + K E+ S  ++ CLNDM+T+AL H  D L YMSALRD +IFRF
Sbjct  226  MFWPHEIWGKYSARLADFKEEKKSDVSLACLNDMITNALEHAIDSLQYMSALRDGAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAI TLA CYNNI VFRGVVK+RRGL AK++  T +M+DVY  F+DFS ML +K
Sbjct  286  CAIPQIMAIATLAACYNNIQVFRGVVKIRRGLAAKIVLETSSMKDVYSTFYDFSNMLTAK  345

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  203
            +D  DP++S T+K +E IL TCR SG  + R  +
Sbjct  346  IDKQDPSSSTTMKHVENILSTCRASGIPHNRSLF  379



>ref|XP_002971951.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
 gb|EFJ26868.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
Length=392

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelky--eENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIF  491
            MFWPR+IW KY        +  E N   AV+CLNDM+TD L H  +CL YMS L++PS+F
Sbjct  240  MFWPREIWGKYAPTSLLSDFRDESNEKEAVECLNDMITDCLRHAPECLFYMSKLKNPSVF  299

Query  490  RFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLK  311
            RFCA+PQ+MAI T A+CYNN  VFRGVVK+RRG TAK+I  T  M DV G F+DF+ +L 
Sbjct  300  RFCAVPQVMAIATAAVCYNNPQVFRGVVKIRRGTTAKIIVTTNNMADVCGAFYDFASILA  359

Query  310  SKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  212
            SK++ NDP+A    +R+E I K CR  G  + R
Sbjct  360  SKINKNDPSALIAAERVENIFKACRQYGLSSSR  392



>ref|XP_001775898.1| predicted protein [Physcomitrella patens]
 gb|EDQ59263.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP ++W KY  KLE+ K+E+NS NA++CLN ++T+AL+H  DCL YM  +      RF
Sbjct  226  MFWPHEVWGKYATKLEDFKHEDNSQNALRCLNALITNALAHATDCLKYMEDINQEDNLRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAI TLA CYNNI VFRGVVK+RRG+TAK++ +TRTM DVYG FFDFS  + +K
Sbjct  286  CAIPQIMAIATLAECYNNINVFRGVVKIRRGITAKIM-QTRTMGDVYGTFFDFSKKIAAK  344

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  200
            +D ND +AS T K +E I + C +S  L   KSYI
Sbjct  345  IDDNDDSASVTRKHIEDIQEYC-ESHLLEPEKSYI  378



>ref|XP_001773253.1| predicted protein [Physcomitrella patens]
 gb|EDQ61943.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWP +IW K+  +LE+ K EENS NAV+CLN M+T+AL+H  DCL Y+ A +D S  RF
Sbjct  173  MFWPHEIWGKFGTRLEDFKLEENSENAVRCLNAMITNALTHATDCLKYIEANKDESNLRF  232

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMAIGTLA CYNNI VFRGVVK+RRG+TAKV+ +T+T+ DVYG FFDFS  +  K
Sbjct  233  CAIPQIMAIGTLAECYNNINVFRGVVKIRRGITAKVM-QTKTISDVYGTFFDFSRKIAEK  291

Query  304  VDHNDPTASKTLKRLEIILKTCR  236
            +  ND +AS T K +E I + C 
Sbjct  292  IGENDDSASATRKHIEDIQEYCE  314



>ref|XP_009138586.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=270

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+ W KYV KLE+LK E+ S  AVQCLNDM+T+AL HVEDCL  M+AL DP+I + 
Sbjct  137  MFWPRETWGKYVDKLEDLKDEDKSTKAVQCLNDMITNALIHVEDCLKSMAALHDPAILQS  196

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            C+IP I+AIGTLA+CYNN+ VFRG +K+RRGL AKV DRT+TM+DV G F+DFSCML++K
Sbjct  197  CSIPLIVAIGTLALCYNNVQVFRGSLKLRRGLIAKVFDRTKTMDDVCGAFYDFSCMLETK  256

Query  304  V  302
            V
Sbjct  257  V  257



>ref|XP_008796682.1| PREDICTED: squalene synthase-like isoform X3 [Phoenix dactylifera]
Length=378

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 105/162 (65%), Gaps = 31/162 (19%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKY  KLE+LKYEENS  AVQCLNDM                          
Sbjct  226  MFWPREIWSKYASKLEDLKYEENSTKAVQCLNDM--------------------------  259

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
                 IMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK
Sbjct  260  -----IMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSK  314

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  179
            +D NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  315  IDDNDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  356



>emb|CEF97547.1| Squalene/phytoene synthase, partial [Ostreococcus tauri]
Length=397

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 111/165 (67%), Gaps = 1/165 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR +WSKY  +L+EL++EEN   AVQC+N+++T+ALSH  DCL YM  +++PSIFRF
Sbjct  228  MFWPRSVWSKYAKELDELQHEENHEKAVQCMNELITNALSHTTDCLKYMGRIKEPSIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAI TLA CY N+ VF+GVVK+RRGL+A+++     M +   GF  F+  L  K
Sbjct  288  CAIPQVMAIATLAECYGNVNVFKGVVKIRRGLSARIMLNCNNMYEFAKGFKHFASELVHK  347

Query  304  VD-HNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  173
            VD  NDP   +T++R+E + + C         +  + R E +  P
Sbjct  348  VDPRNDPNGEETMQRIEALEEACDKIIAEESERMQLSRIEDDTIP  392



>ref|XP_001756673.1| predicted protein [Physcomitrella patens]
 gb|EDQ78627.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -1

Query  658  WPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCA  479
            WP+++WSKY  K E    E N    + CLN+MVTDALSH  DCL YM+AL+D    RFCA
Sbjct  228  WPKEVWSKYADKPEAFMDETNYKQGLHCLNEMVTDALSHGLDCLHYMAALQDQPNLRFCA  287

Query  478  IPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVD  299
              QI A+GTLAMCYNN+ VFRG V+MRRGLTAK++D  + M DVYG F+DF+ ++ +K+D
Sbjct  288  TFQITALGTLAMCYNNVEVFRGSVRMRRGLTAKILD-VKNMVDVYGAFYDFTRLIAAKID  346

Query  298  HNDPTASKTLKRLEIILKTCR  236
              DP+A  T K ++ I   CR
Sbjct  347  KTDPSAVTTHKFVDDIRSICR  367



>gb|KDO43895.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=340

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMSALRD +IFRF
Sbjct  226  MFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMSALRDHAIFRF  285

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGL  389
            CAIPQIMAIGTLA+CYNNI VFRGVVKMRRG+
Sbjct  286  CAIPQIMAIGTLALCYNNIEVFRGVVKMRRGM  317



>gb|KIZ04121.1| farnesyl-diphosphatefarnesyltransferase [Monoraphidium neglectum]
Length=493

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR++W +Y   L+E K   N   A+ CLND+VTDAL HV  C+ ++  LRDP +FRF
Sbjct  237  MFWPREVWGRYASSLDEFKDPANRTAAIHCLNDLVTDALRHVPHCVAFLQQLRDPDVFRF  296

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMA GTL++CYNN GVF G VK+RRG TA+V D  RTM DV+  F  +  +L+ K
Sbjct  297  CAIPQIMAAGTLSLCYNNGGVFEGAVKLRRGETARVFDELRTMADVHAWFGRYLRLLRRK  356

Query  304  ---VDHNDPTASKTLKRLEIILKTCRDSGT  224
               V  +DPTA +    ++  LK   D G+
Sbjct  357  ALSVASHDPTAKEARAAVDSCLKIV-DEGS  385



>ref|XP_001417488.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95781.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 106/145 (73%), Gaps = 1/145 (1%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR +WSKY  +L++L++EEN   AVQC+N+++T+ALSH  DCL YMS +++ SIFRF
Sbjct  228  MFWPRSVWSKYAEELDDLQHEENREKAVQCMNELITNALSHSLDCLKYMSRVKEISIFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ+MAI TLA CY N  VF+GVVK+RRGL+A+++ +   M ++  GF  F+  L  K
Sbjct  288  CAIPQVMAIATLAECYGNENVFKGVVKIRRGLSARIMLKCNNMLELASGFKHFANELVHK  347

Query  304  VD-HNDPTASKTLKRLEIILKTCRD  233
            VD  +DP   +T+ R+E + + C +
Sbjct  348  VDPKSDPNGEETMARIEALEEACDE  372



>ref|XP_001703447.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06129.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
Length=378

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 90/142 (63%), Gaps = 0/142 (0%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR IW KY   L + K   N   AV+CLNDM+TDAL H+  CL YM  LR   +FRF
Sbjct  228  MFWPRDIWGKYAPALADFKEPANRGAAVRCLNDMITDALRHLPYCLAYMEQLRHVMVFRF  287

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQIMA GTLA CYNN  VF GVVKMRRG TA++ +    + D+Y  F  F   +++K
Sbjct  288  CAIPQIMAAGTLAACYNNGRVFEGVVKMRRGETARIFETCNDLGDLYTWFLQFLAAMEAK  347

Query  304  VDHNDPTASKTLKRLEIILKTC  239
            VD  DP+   T +R+    K C
Sbjct  348  VDPTDPSLPLTRQRIAEARKAC  369



>gb|EEC81691.1| hypothetical protein OsI_25282 [Oryza sativa Indica Group]
Length=273

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 100/151 (66%), Gaps = 19/151 (13%)
 Frame = -1

Query  664  MFWPRQIWSkyvxkleelkyeENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRF  485
            MFWPR+IWSKYV KLE+LKYE NSV AV+CLN+MVT+ L H EDCL YMSAL+D +I RF
Sbjct  110  MFWPREIWSKYVDKLEDLKYENNSVKAVKCLNEMVTNGLIHTEDCLRYMSALKDITILRF  169

Query  484  CAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSK  305
            CAIPQ     TL                  GLTA++I+ T +M DVY  F++FS +L  K
Sbjct  170  CAIPQHSC--TLI-----------------GLTARIINETNSMADVYTAFYEFSSLLAEK  210

Query  304  VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  212
            +D NDP AS T KR+  I +TC+ SG L  R
Sbjct  211  IDDNDPNASLTRKRVNAIKETCKSSGLLKIR  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140