BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004N20

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591334.1|  PREDICTED: probable phytol kinase 3, chlorop...    323   1e-106   Nicotiana tomentosiformis
ref|XP_009790459.1|  PREDICTED: probable phytol kinase 3, chlorop...    317   2e-104   Nicotiana sylvestris
ref|XP_011098894.1|  PREDICTED: probable phytol kinase 3, chlorop...    315   7e-104   Sesamum indicum [beniseed]
gb|EYU45412.1|  hypothetical protein MIMGU_mgv1a010789mg                310   7e-102   Erythranthe guttata [common monkey flower]
gb|ADZ24711.1|  phytol kinase                                           309   2e-101   Solanum pennellii
ref|XP_004246260.1|  PREDICTED: probable phytol kinase 3, chlorop...    308   4e-101   Solanum lycopersicum
ref|XP_006354090.1|  PREDICTED: probable phytol kinase 3, chlorop...    303   3e-99    Solanum tuberosum [potatoes]
ref|XP_010069238.1|  PREDICTED: probable phytol kinase 3, chlorop...    299   3e-98    Eucalyptus grandis [rose gum]
ref|XP_007205802.1|  hypothetical protein PRUPE_ppa010668mg             299   4e-98    
ref|XP_008384758.1|  PREDICTED: probable phytol kinase 2, chlorop...    298   9e-97    
ref|XP_008221407.1|  PREDICTED: probable phytol kinase 3, chlorop...    298   1e-96    Prunus mume [ume]
ref|XP_004294311.1|  PREDICTED: probable phytol kinase 2, chlorop...    298   1e-96    Fragaria vesca subsp. vesca
emb|CDP09225.1|  unnamed protein product                                294   3e-96    Coffea canephora [robusta coffee]
ref|XP_002516647.1|  Phytol kinase 1, chloroplast precursor, puta...    294   2e-95    Ricinus communis
ref|XP_009369583.1|  PREDICTED: probable phytol kinase 2, chlorop...    295   2e-95    Pyrus x bretschneideri [bai li]
gb|KHG05203.1|  putative phytol kinase 3, chloroplastic                 294   3e-95    Gossypium arboreum [tree cotton]
ref|XP_007016939.1|  Phosphatidate cytidylyltransferase family pr...    293   7e-95    
ref|XP_002313239.2|  hypothetical protein POPTR_0009s07860g             290   7e-95    
ref|XP_010028019.1|  PREDICTED: probable phytol kinase 3, chlorop...    290   8e-95    
ref|XP_002313238.2|  hypothetical protein POPTR_0009s07860g             293   9e-95    
ref|XP_007016937.1|  Phosphatidate cytidylyltransferase family pr...    293   2e-94    
gb|KEH34361.1|  phytol kinase                                           291   3e-94    Medicago truncatula
gb|KJB83902.1|  hypothetical protein B456_013G270100                    290   6e-94    Gossypium raimondii
gb|KDP45737.1|  hypothetical protein JCGZ_17344                         290   9e-94    Jatropha curcas
emb|CDM84848.1|  unnamed protein product                                288   5e-93    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011003760.1|  PREDICTED: probable phytol kinase 2, chlorop...    285   8e-93    Populus euphratica
ref|XP_011003752.1|  PREDICTED: probable phytol kinase 2, chlorop...    288   1e-92    Populus euphratica
ref|XP_002278580.2|  PREDICTED: probable phytol kinase 2, chlorop...    286   2e-92    Vitis vinifera
ref|XP_007146804.1|  hypothetical protein PHAVU_006G071000g             286   3e-92    Phaseolus vulgaris [French bean]
ref|XP_011025082.1|  PREDICTED: probable phytol kinase 3, chlorop...    286   3e-92    Populus euphratica
ref|XP_010028020.1|  PREDICTED: probable phytol kinase 3, chlorop...    283   5e-92    
emb|CDY66208.1|  BnaCnng49970D                                          285   6e-92    Brassica napus [oilseed rape]
ref|XP_004970454.1|  PREDICTED: probable phytol kinase 2, chlorop...    286   6e-92    Setaria italica
ref|XP_002299996.2|  hypothetical protein POPTR_0001s28680g             282   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010520194.1|  PREDICTED: probable phytol kinase 2, chlorop...    284   2e-91    Tarenaya hassleriana [spider flower]
ref|XP_008356261.1|  PREDICTED: probable phytol kinase 3, chlorop...    282   3e-91    
gb|KHN02090.1|  Putative phytol kinase 3, chloroplastic                 284   3e-91    Glycine soja [wild soybean]
ref|NP_001130181.1|  uncharacterized protein LOC100191275               284   3e-91    Zea mays [maize]
emb|CBI15917.3|  unnamed protein product                                281   6e-91    Vitis vinifera
gb|ACU24460.1|  unknown                                                 283   1e-90    Glycine max [soybeans]
ref|XP_002458716.1|  hypothetical protein SORBIDRAFT_03g038850          283   1e-90    
ref|NP_001044703.2|  Os01g0832000                                       280   1e-90    
ref|XP_008457339.1|  PREDICTED: probable phytol kinase 2, chlorop...    282   2e-90    Cucumis melo [Oriental melon]
gb|AFK48670.1|  unknown                                                 281   3e-90    Lotus japonicus
gb|KHG27084.1|  putative phytol kinase 3, chloroplastic                 278   4e-90    Gossypium arboreum [tree cotton]
ref|XP_003564535.1|  PREDICTED: probable phytol kinase 2, chlorop...    280   6e-90    Brachypodium distachyon [annual false brome]
gb|KJB20420.1|  hypothetical protein B456_003G147500                    278   7e-90    Gossypium raimondii
gb|AAM65097.1|  unknown                                                 280   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644954.1|  PREDICTED: probable phytol kinase 2, chlorop...    277   1e-89    
sp|Q5N9J9.3|PHYK2_ORYSJ  RecName: Full=Probable phytol kinase 2, ...    279   2e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009603395.1|  PREDICTED: LOW QUALITY PROTEIN: probable phy...    275   3e-89    
ref|NP_001242263.1|  probable phytol kinase 3, chloroplastic            279   3e-89    
dbj|BAD43853.1|  unknown protein                                        278   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120370.1|  PREDICTED: probable phytol kinase 2, chlorop...    277   7e-89    Brassica rapa
ref|XP_004145246.1|  PREDICTED: probable phytol kinase 2, chlorop...    278   8e-89    
ref|NP_200664.1|  farnesol kinase                                       277   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264775.1|  PREDICTED: probable phytol kinase 2, chlorop...    276   9e-89    Nelumbo nucifera [Indian lotus]
emb|CDY67806.1|  BnaA10g29300D                                          277   1e-88    Brassica napus [oilseed rape]
ref|XP_010089521.1|  putative phytol kinase 3                           280   4e-88    
ref|XP_006425114.1|  hypothetical protein CICLE_v10028969mg             275   5e-88    Citrus clementina [clementine]
gb|KDO66965.1|  hypothetical protein CISIN_1g022935mg                   275   7e-88    Citrus sinensis [apfelsine]
ref|XP_006488562.1|  PREDICTED: probable phytol kinase 3, chlorop...    274   9e-88    Citrus sinensis [apfelsine]
ref|XP_004500292.1|  PREDICTED: probable phytol kinase 3, chlorop...    275   1e-87    Cicer arietinum [garbanzo]
ref|XP_004500293.1|  PREDICTED: probable phytol kinase 3, chlorop...    274   2e-87    Cicer arietinum [garbanzo]
ref|XP_002278563.2|  PREDICTED: probable phytol kinase 2, chlorop...    271   2e-87    
ref|XP_010520844.1|  PREDICTED: probable phytol kinase 2, chlorop...    271   7e-87    
ref|XP_010443595.1|  PREDICTED: probable phytol kinase 2, chlorop...    272   9e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010503534.1|  PREDICTED: probable phytol kinase 2, chlorop...    270   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010453909.1|  PREDICTED: probable phytol kinase 2, chlorop...    272   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006401067.1|  hypothetical protein EUTSA_v10014180mg             272   1e-86    Eutrema salsugineum [saltwater cress]
ref|XP_010483456.1|  PREDICTED: probable phytol kinase 2, chlorop...    271   2e-86    Camelina sativa [gold-of-pleasure]
gb|KEH28892.1|  phytol kinase                                           268   4e-86    Medicago truncatula
ref|XP_006847435.1|  hypothetical protein AMTR_s00153p00083300          268   4e-86    
ref|XP_010689412.1|  PREDICTED: probable phytol kinase 2, chlorop...    270   7e-86    Beta vulgaris subsp. vulgaris [field beet]
gb|KEH28894.1|  phytol kinase                                           266   2e-85    Medicago truncatula
ref|XP_006280848.1|  hypothetical protein CARUB_v10026834mg             269   2e-85    Capsella rubella
gb|KCW54677.1|  hypothetical protein EUGRSUZ_I00620                     265   3e-85    Eucalyptus grandis [rose gum]
ref|XP_009132278.1|  PREDICTED: LOW QUALITY PROTEIN: probable phy...    265   1e-84    
emb|CBI15916.3|  unnamed protein product                                267   2e-84    Vitis vinifera
ref|XP_009420002.1|  PREDICTED: probable phytol kinase 2, chlorop...    266   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132038.1|  PREDICTED: probable phytol kinase 2, chlorop...    266   4e-84    Brassica rapa
emb|CDY70799.1|  BnaAnng35070D                                          265   7e-84    Brassica napus [oilseed rape]
gb|KFK27385.1|  hypothetical protein AALP_AA8G375800                    264   1e-83    Arabis alpina [alpine rockcress]
gb|EPS57827.1|  hypothetical protein M569_16990                         259   1e-82    Genlisea aurea
ref|XP_010412644.1|  PREDICTED: probable phytol kinase 2, chlorop...    260   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_006425113.1|  hypothetical protein CICLE_v10028969mg             260   2e-82    
ref|XP_010650879.1|  PREDICTED: probable phytol kinase 2, chlorop...    258   3e-82    Vitis vinifera
ref|XP_008811675.1|  PREDICTED: probable phytol kinase 2, chlorop...    259   5e-82    Phoenix dactylifera
gb|KCW57521.1|  hypothetical protein EUGRSUZ_H00292                     254   2e-81    Eucalyptus grandis [rose gum]
ref|XP_010910062.1|  PREDICTED: probable phytol kinase 2, chlorop...    257   6e-81    Elaeis guineensis
ref|XP_010426391.1|  PREDICTED: probable phytol kinase 2, chlorop...    254   9e-81    Camelina sativa [gold-of-pleasure]
emb|CDY65783.1|  BnaA03g56270D                                          256   2e-80    Brassica napus [oilseed rape]
emb|CDY65781.1|  BnaA03g56250D                                          251   5e-79    Brassica napus [oilseed rape]
gb|AFW84692.1|  hypothetical protein ZEAMMB73_467064                    243   8e-77    
gb|KCW54683.1|  hypothetical protein EUGRSUZ_I00622                     238   4e-75    Eucalyptus grandis [rose gum]
ref|XP_002442649.1|  hypothetical protein SORBIDRAFT_08g000500          236   4e-73    Sorghum bicolor [broomcorn]
ref|XP_002864581.1|  hypothetical protein ARALYDRAFT_332145             243   4e-73    
ref|XP_004977649.1|  PREDICTED: probable phytol kinase 2, chlorop...    236   5e-73    
gb|EMT05708.1|  Putative phytol kinase 2, chloroplastic                 235   5e-73    
ref|XP_004977648.1|  PREDICTED: probable phytol kinase 2, chlorop...    236   8e-73    Setaria italica
ref|NP_001065534.2|  Os11g0105800                                       235   1e-72    
gb|AFW84693.1|  hypothetical protein ZEAMMB73_467064                    231   1e-72    
ref|XP_004978591.1|  PREDICTED: probable phytol kinase 2, chlorop...    234   2e-72    Setaria italica
gb|KJB20421.1|  hypothetical protein B456_003G147500                    228   2e-71    Gossypium raimondii
ref|XP_008676758.1|  PREDICTED: uncharacterized protein LOC100272...    231   4e-71    Zea mays [maize]
ref|XP_002450098.1|  hypothetical protein SORBIDRAFT_05g000470          231   4e-71    Sorghum bicolor [broomcorn]
gb|ABA95607.1|  phosphatidate cytidylyltransferase family protein...    230   7e-71    Oryza sativa Japonica Group [Japonica rice]
gb|EAY81967.1|  hypothetical protein OsI_37144                          230   8e-71    Oryza sativa Indica Group [Indian rice]
ref|NP_001065932.1|  Os12g0105500                                       230   1e-70    
gb|ACG40052.1|  phytol kinase 2                                         228   5e-70    Zea mays [maize]
gb|KCW57523.1|  hypothetical protein EUGRSUZ_H00292                     224   5e-70    Eucalyptus grandis [rose gum]
dbj|BAA97326.1|  unnamed protein product                                235   7e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662647.1|  PREDICTED: probable phytol kinase 2, chlorop...    227   1e-69    
ref|XP_003579056.1|  PREDICTED: probable phytol kinase 2, chlorop...    226   2e-69    Brachypodium distachyon [annual false brome]
gb|ADE76360.1|  unknown                                                 226   1e-67    Picea sitchensis
ref|XP_007016938.1|  Phosphatidate cytidylyltransferase family pr...    216   1e-65    
gb|KJB83901.1|  hypothetical protein B456_013G270100                    216   1e-65    Gossypium raimondii
gb|KDO66964.1|  hypothetical protein CISIN_1g022935mg                   212   6e-64    Citrus sinensis [apfelsine]
ref|XP_008805007.1|  PREDICTED: probable phytol kinase 2, chlorop...    209   1e-63    
ref|XP_006387376.1|  hypothetical protein POPTR_1135s00210g             206   3e-63    
gb|EYU45411.1|  hypothetical protein MIMGU_mgv1a012281mg                206   9e-62    Erythranthe guttata [common monkey flower]
ref|XP_004977650.1|  PREDICTED: probable phytol kinase 2, chlorop...    201   5e-60    
ref|XP_006387375.1|  hypothetical protein POPTR_1135s00200g             197   2e-59    
ref|XP_006292344.1|  hypothetical protein CARUB_v10018556mg             196   2e-58    
gb|KCW54682.1|  hypothetical protein EUGRSUZ_I00621                     195   2e-58    Eucalyptus grandis [rose gum]
ref|NP_001140612.1|  uncharacterized protein LOC100272684               195   4e-58    Zea mays [maize]
ref|XP_001766222.1|  predicted protein                                  196   6e-58    
gb|AFW64554.1|  hypothetical protein ZEAMMB73_110888                    193   3e-56    
emb|CDY65782.1|  BnaA03g56260D                                          186   8e-55    Brassica napus [oilseed rape]
gb|EMT05709.1|  Putative phytol kinase 2, chloroplastic                 186   6e-54    
ref|XP_002966017.1|  hypothetical protein SELMODRAFT_230719             184   3e-53    
ref|XP_011098893.1|  PREDICTED: probable phytol kinase 3, chlorop...    182   1e-52    Sesamum indicum [beniseed]
ref|XP_001780576.1|  predicted protein                                  181   5e-52    
ref|XP_004496158.1|  PREDICTED: probable phytol kinase 1, chlorop...    179   1e-50    Cicer arietinum [garbanzo]
ref|XP_007144301.1|  hypothetical protein PHAVU_007G144700g             178   2e-50    Phaseolus vulgaris [French bean]
gb|KEH43364.1|  phytol kinase                                           178   2e-50    Medicago truncatula
ref|NP_001239775.1|  probable phytol kinase 1, chloroplastic            177   6e-50    Glycine max [soybeans]
ref|XP_009783010.1|  PREDICTED: probable phytol kinase 1, chlorop...    177   7e-50    Nicotiana sylvestris
ref|XP_003556292.1|  PREDICTED: probable phytol kinase 1, chlorop...    176   1e-49    Glycine max [soybeans]
ref|XP_009591844.1|  PREDICTED: probable phytol kinase 1, chlorop...    176   3e-49    Nicotiana tomentosiformis
ref|XP_010067215.1|  PREDICTED: probable phytol kinase 1, chlorop...    175   4e-49    Eucalyptus grandis [rose gum]
ref|XP_006436584.1|  hypothetical protein CICLE_v10032240mg             174   7e-49    Citrus clementina [clementine]
emb|CBI40186.3|  unnamed protein product                                174   7e-49    Vitis vinifera
ref|XP_008456566.1|  PREDICTED: probable phytol kinase 1, chlorop...    174   7e-49    Cucumis melo [Oriental melon]
ref|XP_010067173.1|  PREDICTED: probable phytol kinase 1, chlorop...    174   7e-49    Eucalyptus grandis [rose gum]
ref|XP_001764046.1|  predicted protein                                  172   9e-49    
ref|XP_004234914.1|  PREDICTED: probable phytol kinase 1, chlorop...    174   9e-49    
ref|XP_002269950.1|  PREDICTED: probable phytol kinase 1, chlorop...    174   1e-48    Vitis vinifera
ref|XP_006398907.1|  hypothetical protein EUTSA_v10014196mg             174   1e-48    Eutrema salsugineum [saltwater cress]
ref|XP_006838740.1|  hypothetical protein AMTR_s00002p00254420          172   1e-48    
ref|XP_006588439.1|  PREDICTED: probable phytol kinase 1, chlorop...    172   2e-48    Glycine max [soybeans]
ref|XP_008218940.1|  PREDICTED: probable phytol kinase 1, chlorop...    173   3e-48    Prunus mume [ume]
ref|XP_006364440.1|  PREDICTED: probable phytol kinase 1, chlorop...    173   3e-48    Solanum tuberosum [potatoes]
ref|XP_002315347.2|  hypothetical protein POPTR_0010s23890g             174   4e-48    
ref|XP_011024295.1|  PREDICTED: probable phytol kinase 1, chlorop...    172   5e-48    Populus euphratica
ref|XP_009361416.1|  PREDICTED: probable phytol kinase 1, chlorop...    172   8e-48    Pyrus x bretschneideri [bai li]
ref|XP_010490961.1|  PREDICTED: phytol kinase 1, chloroplastic          172   8e-48    Camelina sativa [gold-of-pleasure]
ref|XP_008375637.1|  PREDICTED: probable phytol kinase 1, chlorop...    171   1e-47    
emb|CDY44860.1|  BnaC09g50600D                                          171   1e-47    Brassica napus [oilseed rape]
gb|KGN63038.1|  hypothetical protein Csa_2G385070                       171   1e-47    
gb|KJB83903.1|  hypothetical protein B456_013G270100                    169   1e-47    Gossypium raimondii
ref|XP_010423571.1|  PREDICTED: phytol kinase 1, chloroplastic-like     171   1e-47    Camelina sativa [gold-of-pleasure]
ref|XP_009122590.1|  PREDICTED: phytol kinase 1, chloroplastic-like     171   1e-47    Brassica rapa
ref|NP_196069.1|  phytol kinase 1                                       171   2e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028018.1|  PREDICTED: probable phytol kinase 3, chlorop...    166   2e-47    
gb|AAO42044.1|  unknown protein                                         171   2e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094481.1|  PREDICTED: probable phytol kinase 1, chlorop...    171   2e-47    Sesamum indicum [beniseed]
gb|KHN00934.1|  Putative phytol kinase 1, chloroplastic                 168   3e-47    Glycine soja [wild soybean]
ref|XP_006288296.1|  hypothetical protein CARUB_v10001540mg             170   3e-47    Capsella rubella
ref|XP_010906567.1|  PREDICTED: probable phytol kinase 1, chlorop...    168   4e-47    
ref|XP_006364441.1|  PREDICTED: probable phytol kinase 1, chlorop...    170   5e-47    
ref|XP_007218720.1|  hypothetical protein PRUPE_ppa009034mg             170   5e-47    Prunus persica
ref|XP_004138682.1|  PREDICTED: probable phytol kinase 1, chlorop...    169   5e-47    
ref|XP_010452347.1|  PREDICTED: phytol kinase 1, chloroplastic-like     169   5e-47    Camelina sativa [gold-of-pleasure]
gb|AAM61593.1|  unknown                                                 169   5e-47    Arabidopsis thaliana [mouse-ear cress]
emb|CDO99832.1|  unnamed protein product                                170   6e-47    Coffea canephora [robusta coffee]
ref|XP_009130827.1|  PREDICTED: phytol kinase 1, chloroplastic-like     169   7e-47    Brassica rapa
ref|XP_002871097.1|  hypothetical protein ARALYDRAFT_325092             169   9e-47    Arabidopsis lyrata subsp. lyrata
gb|EPS60714.1|  phytol kinase                                           167   1e-46    Genlisea aurea
ref|XP_004307151.1|  PREDICTED: phytol kinase 1, chloroplastic          169   1e-46    Fragaria vesca subsp. vesca
ref|XP_010906565.1|  PREDICTED: probable phytol kinase, chloropla...    169   1e-46    Elaeis guineensis
gb|KHG03995.1|  putative phytol kinase 1, chloroplastic                 169   1e-46    Gossypium arboreum [tree cotton]
emb|CDY69673.1|  BnaCnng64700D                                          168   2e-46    Brassica napus [oilseed rape]
ref|XP_009396489.1|  PREDICTED: probable phytol kinase, chloropla...    169   2e-46    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB60478.1|  hypothetical protein B456_009G307400                    167   2e-46    Gossypium raimondii
ref|XP_007010114.1|  Vitamin E pathway gene 5 isoform 1                 169   4e-46    
gb|KDP45055.1|  hypothetical protein JCGZ_01555                         167   4e-46    Jatropha curcas
ref|XP_010552940.1|  PREDICTED: phytol kinase 1, chloroplastic          166   1e-45    Tarenaya hassleriana [spider flower]
gb|KFK24895.1|  hypothetical protein AALP_AA8G038700                    166   1e-45    Arabis alpina [alpine rockcress]
gb|ACP43458.1|  phytol kinase                                           166   2e-45    Lactuca sativa [cultivated lettuce]
ref|XP_010665627.1|  PREDICTED: probable phytol kinase 1, chlorop...    164   8e-45    Beta vulgaris subsp. vulgaris [field beet]
gb|ACF84080.1|  unknown                                                 159   2e-44    Zea mays [maize]
gb|KDO66966.1|  hypothetical protein CISIN_1g022935mg                   160   6e-44    Citrus sinensis [apfelsine]
emb|CDP05574.1|  unnamed protein product                                157   7e-44    Coffea canephora [robusta coffee]
ref|XP_002447301.1|  hypothetical protein SORBIDRAFT_06g032370          161   1e-43    Sorghum bicolor [broomcorn]
ref|XP_001418836.1|  predicted protein                                  159   2e-43    Ostreococcus lucimarinus CCE9901
ref|XP_003580789.1|  PREDICTED: probable phytol kinase, chloropla...    160   2e-43    Brachypodium distachyon [annual false brome]
ref|NP_001105847.1|  probable phytol kinase, chloroplastic precursor    160   2e-43    Zea mays [maize]
ref|XP_005643081.1|  hypothetical protein COCSUDRAFT_49246              159   5e-43    Coccomyxa subellipsoidea C-169
gb|ABA42672.1|  phytol kinase                                           158   5e-43    Zea mays [maize]
gb|AIE88275.1|  hypothetical protein OG_BBa0063K01.6                    159   9e-43    Oryza glaberrima
sp|Q7XR51.1|PHYK1_ORYSJ  RecName: Full=Probable phytol kinase 1, ...    159   9e-43    Oryza sativa Japonica Group [Japonica rice]
gb|EEE61880.1|  hypothetical protein OsJ_16572                          159   1e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007010115.1|  Vitamin E pathway gene 5 isoform 2                 159   1e-42    
ref|XP_010278283.1|  PREDICTED: probable phytol kinase, chloropla...    158   2e-42    Nelumbo nucifera [Indian lotus]
ref|XP_009396497.1|  PREDICTED: probable phytol kinase, chloropla...    157   4e-42    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW65249.1|  hypothetical protein EUGRSUZ_G02725                     152   1e-41    Eucalyptus grandis [rose gum]
ref|XP_010658680.1|  PREDICTED: phytol kinase 1, chloroplastic is...    154   3e-41    Vitis vinifera
ref|XP_008795886.1|  PREDICTED: probable phytol kinase, chloropla...    152   2e-40    Phoenix dactylifera
ref|XP_002500009.1|  predicted protein                                  150   3e-40    Micromonas commoda
ref|XP_002968111.1|  hypothetical protein SELMODRAFT_440293             149   3e-40    
gb|KCW65250.1|  hypothetical protein EUGRSUZ_G02725                     147   8e-40    Eucalyptus grandis [rose gum]
ref|XP_004960241.1|  PREDICTED: probable phytol kinase 2, chlorop...    148   7e-39    Setaria italica
emb|CDP04896.1|  unnamed protein product                                142   3e-38    Coffea canephora [robusta coffee]
ref|XP_003080172.1|  Predicted ER membrane protein (ISS)                146   3e-38    Ostreococcus tauri
sp|Q2N2K3.1|PHYK_WHEAT  RecName: Full=Probable phytol kinase, chl...    145   7e-38    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011094482.1|  PREDICTED: probable phytol kinase 1, chlorop...    143   7e-38    
gb|EYU39693.1|  hypothetical protein MIMGU_mgv1a014475mg                142   1e-37    Erythranthe guttata [common monkey flower]
sp|Q2N2K2.1|PHYK2_SOYBN  RecName: Full=Probable phytol kinase 2, ...    144   3e-37    Glycine max [soybeans]
ref|XP_008795887.1|  PREDICTED: probable phytol kinase, chloropla...    142   7e-37    Phoenix dactylifera
ref|XP_010556037.1|  PREDICTED: probable phytol kinase 2, chlorop...    136   1e-36    Tarenaya hassleriana [spider flower]
ref|XP_006436583.1|  hypothetical protein CICLE_v10032240mg             141   1e-36    Citrus clementina [clementine]
ref|XP_002955247.1|  hypothetical protein VOLCADRAFT_45651              139   2e-36    Volvox carteri f. nagariensis
ref|XP_002532923.1|  Phytol kinase 1, chloroplast precursor, puta...    140   3e-36    
ref|XP_001694607.1|  phytol kinase-related protein                      140   7e-36    Chlamydomonas reinhardtii
ref|XP_010665628.1|  PREDICTED: probable phytol kinase 1, chlorop...    137   6e-35    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004344106.1|  phytol kinase 2, putative                          135   9e-35    Acanthamoeba castellanii str. Neff
gb|ACG23902.1|  hypothetical protein                                    134   4e-34    Zea mays [maize]
ref|XP_003057921.1|  predicted protein                                  134   4e-34    Micromonas pusilla CCMP1545
ref|XP_008668661.1|  PREDICTED: probable phytol kinase, chloropla...    134   5e-34    Zea mays [maize]
ref|WP_012164598.1|  phosphatidate cytidylyltransferase                 133   8e-34    Acaryochloris marina
ref|WP_010480729.1|  phosphatidate cytidylyltransferase                 131   4e-33    Acaryochloris sp. CCMEE 5410
gb|AFW64553.1|  hypothetical protein ZEAMMB73_110888                    130   6e-33    
ref|XP_004960242.1|  PREDICTED: probable phytol kinase 2, chlorop...    132   7e-33    
ref|WP_013560255.1|  phosphatidate cytidylyltransferase                 130   1e-32    Anaerolinea thermophila
ref|WP_040625197.1|  phosphatidate cytidylyltransferase                 129   4e-32    
ref|XP_005645987.1|  hypothetical protein COCSUDRAFT_53992              127   2e-31    Coccomyxa subellipsoidea C-169
ref|XP_008795889.1|  PREDICTED: probable phytol kinase 2, chlorop...    124   2e-30    
ref|XP_007514499.1|  predicted protein                                  124   1e-29    Bathycoccus prasinos
ref|XP_008218941.1|  PREDICTED: probable phytol kinase 1, chlorop...    120   9e-29    Prunus mume [ume]
ref|XP_006653001.1|  PREDICTED: probable phytol kinase 1, chlorop...    115   2e-27    
dbj|GAM20177.1|  hypothetical protein SAMD00019534_033520               115   2e-27    Acytostelium subglobosum LB1
gb|EWM28810.1|  Phosphatidate cytidylyltransferase                      116   8e-27    Nannochloropsis gaditana
ref|XP_005854647.1|  hypothetical protein NGA_2086500                   116   9e-27    Nannochloropsis gaditana CCMP526
ref|XP_008795888.1|  PREDICTED: probable phytol kinase, chloropla...    114   2e-26    
gb|KCW54678.1|  hypothetical protein EUGRSUZ_I00620                   97.8    3e-26    Eucalyptus grandis [rose gum]
ref|XP_005706670.1|  phosphatidate cytidylyltransferase/ phytol k...    113   1e-25    Galdieria sulphuraria
ref|XP_005850569.1|  hypothetical protein CHLNCDRAFT_140477             107   6e-24    Chlorella variabilis
gb|EMS55542.1|  putative phytol kinase, chloroplastic                   106   8e-24    Triticum urartu
ref|XP_004351203.1|  hypothetical protein DFA_10953                     106   9e-24    Cavenderia fasciculata
emb|CBJ48773.1|  Probable phytol kinase, chloroplast precursor, c...    107   1e-23    Ectocarpus siliculosus
ref|XP_002668969.1|  predicted protein                                  106   2e-23    Naegleria gruberi strain NEG-M
ref|XP_005773265.1|  hypothetical protein EMIHUDRAFT_369009             105   3e-23    Emiliania huxleyi CCMP1516
ref|XP_005770298.1|  hypothetical protein EMIHUDRAFT_436338             104   3e-23    Emiliania huxleyi CCMP1516
ref|XP_002946158.1|  hypothetical protein VOLCADRAFT_55632              104   4e-23    Volvox carteri f. nagariensis
ref|XP_011400679.1|  putative phytol kinase 3, chloroplastic            104   4e-23    Auxenochlorella protothecoides
ref|XP_004996012.1|  hypothetical protein PTSG_03426                    104   5e-23    Salpingoeca rosetta
gb|EFA81634.1|  hypothetical protein PPL_05626                          102   1e-22    Heterostelium album PN500
ref|XP_005777419.1|  hypothetical protein EMIHUDRAFT_469241             103   3e-22    Emiliania huxleyi CCMP1516
gb|KCW54679.1|  hypothetical protein EUGRSUZ_I00620                   97.4    1e-21    Eucalyptus grandis [rose gum]
ref|XP_005818786.1|  hypothetical protein GUITHDRAFT_149059             101   1e-21    Guillardia theta CCMP2712
gb|KHN37861.1|  Putative phytol kinase 1, chloroplastic               96.3    3e-21    Glycine soja [wild soybean]
gb|KCW54680.1|  hypothetical protein EUGRSUZ_I00620                   97.1    3e-21    Eucalyptus grandis [rose gum]
ref|XP_003289382.1|  hypothetical protein DICPUDRAFT_88483            99.0    4e-21    Dictyostelium purpureum
ref|XP_005781745.1|  hypothetical protein EMIHUDRAFT_99736            97.4    3e-20    Emiliania huxleyi CCMP1516
ref|XP_008349551.1|  PREDICTED: probable phytol kinase 2, chlorop...  94.7    6e-20    
ref|XP_002178808.1|  predicted protein                                95.5    1e-19    Phaeodactylum tricornutum CCAP 1055/1
gb|AFW84638.1|  hypothetical protein ZEAMMB73_788794                  91.7    1e-19    
ref|XP_645174.1|  hypothetical protein DDB_G0272380                   92.8    5e-19    Dictyostelium discoideum AX4
gb|EWM22868.1|  phosphatidate cytidylyltransferase                    94.0    5e-19    Nannochloropsis gaditana
dbj|BAG88541.1|  unnamed protein product                              89.7    6e-19    Oryza sativa Japonica Group [Japonica rice]
gb|AEV40976.1|  putative phosphatidate cytidylyltransferase           89.7    7e-19    Oryza punctata
gb|AEV41120.1|  putative phosphatidate cytidylyltransferase           89.0    1e-18    Oryza officinalis
gb|AEV41074.1|  putative phosphatidate cytidylyltransferase           88.6    2e-18    Oryza minuta
ref|WP_017309557.1|  phosphatidate cytidylyltransferase               91.3    2e-18    Fischerella sp. PCC 9339
ref|XP_005538511.1|  hypothetical protein, conserved                  93.2    3e-18    Cyanidioschyzon merolae strain 10D
ref|WP_016859908.1|  phosphatidate cytidylyltransferase               90.5    4e-18    Fischerella muscicola
ref|XP_010906566.1|  PREDICTED: probable phytol kinase, chloropla...  90.1    9e-18    Elaeis guineensis
ref|NP_001054214.1|  Os04g0670700                                     85.1    2e-17    
ref|WP_026723041.1|  phosphatidate cytidylyltransferase               88.2    3e-17    
ref|XP_650979.1|  hypothetical protein                                85.9    1e-16    
ref|XP_001735047.1|  hypothetical protein                             85.1    3e-16    
ref|XP_001735667.1|  hypothetical protein                             85.1    3e-16    
ref|XP_001696576.1|  predicted protein                                89.0    3e-16    
gb|KJB60479.1|  hypothetical protein B456_009G307400                  84.7    3e-16    
ref|XP_002970593.1|  hypothetical protein SELMODRAFT_411298           82.4    4e-16    
ref|WP_009455416.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  83.6    8e-16    
ref|XP_004183825.1|  hypothetical protein EIN_168840                  83.6    9e-16    
ref|XP_008860791.1|  phosphatidate cytidylyltransferase               83.6    9e-16    
dbj|BAN41720.1|  hypothetical protein, conserved                      83.6    1e-15    
gb|EMS14287.1|  phosphatidate cytidylyltransferase, putative          83.2    1e-15    
ref|XP_002289701.1|  predicted protein                                85.1    1e-15    
ref|XP_008857866.1|  phosphatidate cytidylyltransferase               83.2    1e-15    
ref|XP_011398499.1|  putative phytol kinase 1, chloroplastic          82.8    1e-15    
ref|WP_016865492.1|  phosphatidate cytidylyltransferase               83.2    1e-15    
ref|WP_017748439.1|  hypothetical protein                             82.8    2e-15    
dbj|BAN42092.1|  hypothetical protein, conserved                      82.4    2e-15    
gb|EMD43429.1|  phosphatidate cytidylyltransferase, putative          82.0    3e-15    
ref|XP_647969.1|  hypothetical protein                                82.0    3e-15    
dbj|BAN41395.1|  hypothetical protein, conserved                      81.6    4e-15    
ref|WP_008085193.1|  phosphatidate cytidylyltransferase               82.0    5e-15    
ref|WP_017318032.1|  phosphatidate cytidylyltransferase               81.3    5e-15    
ref|WP_008082386.1|  phosphatidate cytidylyltransferase               81.6    6e-15    
ref|XP_004184212.1|  hypothetical protein EIN_284420                  80.5    9e-15    
ref|WP_012507193.1|  phosphatidate cytidylyltransferase               80.1    1e-14    
ref|WP_016874337.1|  phosphatidate cytidylyltransferase               80.1    1e-14    
ref|WP_041041323.1|  phosphatidate cytidylyltransferase               80.1    2e-14    
gb|KIY99927.1|  Phytol kinase 1                                       79.0    2e-14    
ref|XP_001735373.1|  hypothetical protein                             77.8    9e-14    
ref|WP_015283132.1|  dolichol kinase                                  77.8    1e-13    
ref|WP_041467762.1|  phosphatidate cytidylyltransferase               77.4    1e-13    
gb|ABL66347.1|  phosphatidate cytidylyltransferase                    77.4    1e-13    
ref|XP_004255447.1|  hypothetical protein EIN_192850                  75.5    5e-13    
ref|XP_004260841.1|  hypothetical protein EIN_183870                  75.9    5e-13    
gb|AFW64552.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  72.8    2e-12    
ref|WP_027841469.1|  phosphatidate cytidylyltransferase               73.2    4e-12    
ref|WP_015118115.1|  dolichol kinase                                  72.8    5e-12    
ref|WP_011357002.1|  phosphatidate cytidylyltransferase               72.4    5e-12    
ref|XP_004183951.1|  hypothetical protein EIN_172200                  72.4    5e-12    
ref|WP_040433468.1|  phosphatidate cytidylyltransferase               72.4    6e-12    
ref|WP_012501506.1|  phosphatidate cytidylyltransferase               72.4    6e-12    
gb|EAT58783.1|  Phosphatidate cytidylyltransferase                    72.4    7e-12    
dbj|BAN42014.1|  hypothetical protein, conserved                      72.0    7e-12    
ref|WP_041466046.1|  phosphatidate cytidylyltransferase               72.0    8e-12    
gb|ACD91195.1|  phosphatidate cytidylyltransferase                    72.0    9e-12    
gb|KIE09019.1|  phosphatidate cytidylyltransferase                    71.6    1e-11    
ref|XP_008857211.1|  hypothetical protein ENU1_090200                 71.6    1e-11    
ref|WP_026735418.1|  phosphatidate cytidylyltransferase               71.2    1e-11    
ref|WP_010933646.1|  phosphatidate cytidylyltransferase               71.2    2e-11    
emb|CDP14245.1|  unnamed protein product                              68.9    4e-11    
emb|CBK19603.2|  unnamed protein product                              69.3    5e-11    
ref|WP_041471667.1|  phosphatidate cytidylyltransferase               69.3    6e-11    
gb|ACE05130.1|  phosphatidate cytidylyltransferase                    69.3    8e-11    
ref|XP_648836.1|  hypothetical protein                                68.9    9e-11    
ref|XP_004259054.1|  hypothetical protein EIN_119570                  69.3    1e-10    
ref|XP_010095178.1|  hypothetical protein L484_005212                 66.2    2e-09    
ref|WP_026102604.1|  phosphatidate cytidylyltransferase               63.9    6e-09    
ref|WP_011824669.1|  dolichol kinase                                  63.9    6e-09    
ref|WP_038654837.1|  dolichol kinase                                  63.5    7e-09    
ref|XP_009804931.1|  PREDICTED: probable phytol kinase 2, chlorop...  60.1    3e-08    
ref|WP_010306053.1|  dolichol kinase                                  62.0    4e-08    
emb|CBK25124.2|  unnamed protein product                              60.1    4e-08    
ref|WP_035402200.1|  phosphatidate cytidylyltransferase               61.6    5e-08    
ref|WP_011295650.1|  dolichol kinase                                  60.8    8e-08    
ref|WP_006512393.1|  dolichol kinase                                  60.5    1e-07    
ref|WP_011889556.1|  phosphatidate cytidylyltransferase               58.9    4e-07    
ref|WP_013643755.1|  phosphatidate cytidylyltransferase               57.4    9e-07    
dbj|BAM70495.1|  putative cytidylyltransferase                        56.2    2e-06    
ref|WP_022344140.1|  integral membrane protein                        56.6    2e-06    
ref|WP_004029428.1|  phosphatidate cytidylyltransferase               56.2    3e-06    
ref|XP_004257868.1|  phosphatidate cytidylyltransferase, putative     54.7    3e-06    
gb|ABM79726.1|  Dolichol kinase                                       55.8    4e-06    
ref|XP_002970346.1|  hypothetical protein SELMODRAFT_411288           54.7    4e-06    
ref|WP_010876985.1|  phosphatidate cytidylyltransferase               55.1    5e-06    
ref|WP_041374995.1|  dolichol kinase                                  55.8    5e-06    
ref|WP_011131611.1|  dolichol kinase                                  55.5    7e-06    
ref|WP_021788544.1|  cytidylyltransferase family protein              55.5    7e-06    
ref|WP_013296538.1|  phosphatidate cytidylyltransferase               54.7    8e-06    
ref|WP_036900951.1|  dolichol kinase                                  54.7    1e-05    
ref|WP_007099399.1|  dolichol kinase                                  54.7    1e-05    
ref|WP_012196383.1|  dolichol kinase                                  54.7    1e-05    
gb|KGG10597.1|  phytol kinase                                         54.3    1e-05    
ref|WP_021786189.1|  cytidylyltransferase family protein              55.5    1e-05    
ref|WP_011126013.1|  MULTISPECIES: dolichol kinase                    54.3    2e-05    
ref|WP_039725000.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  54.3    2e-05    
ref|WP_017298107.1|  hypothetical protein                             54.3    2e-05    
ref|WP_012538167.1|  membrane protein                                 53.5    2e-05    
ref|WP_015168761.1|  dolichol kinase                                  53.9    2e-05    
ref|WP_015191507.1|  phosphatidate cytidylyltransferase               54.3    2e-05    
dbj|GAN33990.1|  membrane protein                                     54.7    3e-05    
ref|WP_036914894.1|  MULTISPECIES: dolichol kinase                    53.5    3e-05    
ref|WP_013325056.1|  phosphatidate cytidylyltransferase               53.5    4e-05    
ref|WP_036919648.1|  MULTISPECIES: dolichol kinase                    53.1    5e-05    
ref|WP_014696273.1|  membrane protein                                 52.4    5e-05    
gb|AHF65041.1|  hypothetical protein Syncc8109_2735                   52.8    5e-05    
ref|WP_044281169.1|  hypothetical protein                             53.1    6e-05    
gb|EHO41581.1|  phosphatidate cytidylyltransferase                    52.8    6e-05    
ref|WP_026824512.1|  phosphatidate cytidylyltransferase               52.8    6e-05    
ref|WP_008514072.1|  dolichol kinase                                  52.0    7e-05    
emb|CEA13580.1|  phosphatidate cytidylyltransferase                   52.0    8e-05    
ref|WP_036482643.1|  phosphatidate cytidylyltransferase               52.0    1e-04    
ref|WP_013275289.1|  hypothetical protein                             53.1    1e-04    
ref|WP_012538883.1|  membrane protein                                 51.6    1e-04    
ref|WP_013826837.1|  phosphatidate cytidylyltransferase               51.2    1e-04    
ref|WP_010900735.1|  dolichol kinase                                  52.4    1e-04    
ref|XP_004258684.1|  hypothetical protein EIN_398830                  51.6    2e-04    
ref|WP_015880508.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  51.2    2e-04    
gb|KCZ73106.1|  dolichol kinase                                       50.8    2e-04    
ref|WP_011178183.1|  cytidylyltransferase family protein              51.6    2e-04    
gb|ETZ18513.1|  putative membrane spanning protein                    48.9    3e-04    
ref|WP_024655404.1|  membrane protein                                 50.1    3e-04    
ref|WP_004162270.1|  phosphatidate cytidylyltransferase               50.8    4e-04    
ref|WP_028459871.1|  phosphatidate cytidylyltransferase               50.8    4e-04    
ref|WP_009627750.1|  phosphatidate cytidylyltransferase               50.4    4e-04    
ref|WP_009788583.1|  dolichol kinase                                  50.1    4e-04    
ref|WP_021794460.1|  dolichol kinase                                  50.4    6e-04    
ref|WP_043402075.1|  hypothetical protein                             50.8    6e-04    
ref|WP_028105465.1|  phosphatidate cytidylyltransferase               49.7    6e-04    
ref|WP_040236322.1|  membrane protein                                 48.9    7e-04    
ref|WP_010313810.1|  dolichol kinase                                  49.7    7e-04    
gb|KJE48545.1|  hypothetical protein TZ01_08955                       50.1    8e-04    
ref|WP_021068135.1|  phosphatidate cytidylyltransferase               49.3    8e-04    
ref|WP_011361028.1|  dolichol kinase                                  49.3    9e-04    
ref|WP_011242817.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  49.3    9e-04    
gb|KGG13734.1|  phytol kinase                                         48.5    9e-04    
ref|WP_031458639.1|  phosphatidate cytidylyltransferase               49.7    0.001    



>ref|XP_009591334.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
tomentosiformis]
Length=294

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSGRQGA++AALIPGLNI K+LLLGLG
Sbjct  82   EETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGRQGAILAALIPGLNIIKMLLLGLG  141

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KDD TVKSMSRFGD+RELLKGPLYYA TITLACAVYWR SPIAI L+CNLCAGDG+AD
Sbjct  142  LWKDDATVKSMSRFGDHRELLKGPLYYAFTITLACAVYWRYSPIAIGLICNLCAGDGIAD  201

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKSFAGSIAMAA GFLASIG++HYFS FG ++++ HMV GFL VS
Sbjct  202  IVGRRFGKQKLPYNKNKSFAGSIAMAAAGFLASIGYLHYFSLFGYIQESSHMVFGFLFVS  261

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LAAALVESHP+STELDDNLTVPL SVL GS + 
Sbjct  262  LAAALVESHPISTELDDNLTVPLTSVLVGSLVL  294



>ref|XP_009790459.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
sylvestris]
Length=298

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSGRQGA++A+LIPGLNI K+LLLGLG
Sbjct  86   EETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGRQGAILASLIPGLNIIKMLLLGLG  145

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KDD TVKSMSRFGD+RELLKGPLYYA TITLACAVYWR SPIAI L+CNLCAGDG+AD
Sbjct  146  LWKDDATVKSMSRFGDHRELLKGPLYYAFTITLACAVYWRYSPIAIGLICNLCAGDGIAD  205

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKSFAGSIAMA+ GFLASIG++HYFS FG ++++ H V GFL VS
Sbjct  206  IVGRRFGKQKLPYNKNKSFAGSIAMASAGFLASIGYLHYFSLFGYIQESSHTVFGFLFVS  265

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LAAALVESHP+STELDDNLTVPL S+L GS + 
Sbjct  266  LAAALVESHPISTELDDNLTVPLTSMLVGSLVL  298



>ref|XP_011098894.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum]
Length=292

 Score =   315 bits (808),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E+ AKRG FDQ LNRKLVHV++G+ FMLCWPMFSSGRQGA++AALIPG+NI K+LLLGLG
Sbjct  80   EQTAKRGVFDQKLNRKLVHVTVGLAFMLCWPMFSSGRQGAILAALIPGINIIKMLLLGLG  139

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KDD TVKSMSRFGDYRELLKGPLYYA TITLA A+YWR+SPIAIA VCNLCAGDGMAD
Sbjct  140  IWKDDATVKSMSRFGDYRELLKGPLYYASTITLASAIYWRTSPIAIAAVCNLCAGDGMAD  199

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  S KLP+N+NKS  GSI MA  GFLAS+G+M YFSSFG ++++ +MVLGFL+VS
Sbjct  200  IVGRRFGSQKLPYNQNKSVVGSITMACAGFLASVGYMFYFSSFGYIQESTNMVLGFLIVS  259

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +AAALVESHPLSTELDDNLTVPLA+VL GS + 
Sbjct  260  IAAALVESHPLSTELDDNLTVPLAAVLVGSLVL  292



>gb|EYU45412.1| hypothetical protein MIMGU_mgv1a010789mg [Erythranthe guttata]
Length=301

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRK+VHV++G+ FMLCWPMFSSGRQGA+VAALIPG+NI K+LLLGLG
Sbjct  89   EETAKRGVFDQKLNRKIVHVTVGLAFMLCWPMFSSGRQGAIVAALIPGINIVKMLLLGLG  148

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSRFG+++ELLKGPLYYA TITLA A+YWR+SPIAIA VCNLCAGDGMAD
Sbjct  149  IWKDEATVKSMSRFGNHKELLKGPLYYAATITLAGAIYWRTSPIAIAAVCNLCAGDGMAD  208

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  + KLP+N+NKS  GSIAMA  GFLASIG+M YFSSFG +E++P MV+GFL+ S
Sbjct  209  IVGRRFGTQKLPYNQNKSAVGSIAMACAGFLASIGYMLYFSSFGFIEESPKMVMGFLITS  268

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +AAALVESHP+STELDDNLTVPL +VL GS +F
Sbjct  269  VAAALVESHPISTELDDNLTVPLTAVLVGSLVF  301



>gb|ADZ24711.1| phytol kinase [Solanum pennellii]
Length=293

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSG+QGA++AA IPGLNI K+ LLGLG
Sbjct  81   EETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAFIPGLNIIKMFLLGLG  140

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KDD TVKSMSRFGD+RELLKGPLYYA++IT ACA+YWR SPI+I L+CNLCAGDG+AD
Sbjct  141  IWKDDATVKSMSRFGDHRELLKGPLYYALSITCACAIYWRYSPISIGLICNLCAGDGIAD  200

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKSFAGSIAMAA G LASIGF+HYFS FG ++     VLGFL +S
Sbjct  201  IVGRRFGKQKLPYNKNKSFAGSIAMAAAGLLASIGFLHYFSLFGYIQVNSKTVLGFLFIS  260

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            LAAALVESHPLS+ELDDNLTVPL SVL GS +
Sbjct  261  LAAALVESHPLSSELDDNLTVPLTSVLVGSLV  292



>ref|XP_004246260.1| PREDICTED: probable phytol kinase 3, chloroplastic [Solanum lycopersicum]
Length=293

 Score =   308 bits (789),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSG+QGA++AA IPGLNI K+ LLGLG
Sbjct  81   EETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAFIPGLNIIKMFLLGLG  140

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KDD TVKSMSRFGD+RELLKGPLYYA++IT ACA+YWR SPI+I L+CNLCAGDG+AD
Sbjct  141  IWKDDATVKSMSRFGDHRELLKGPLYYALSITCACAIYWRYSPISIGLICNLCAGDGIAD  200

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKSFAGSIAMAA G LASIGF+HYFS FG ++     VLGFL +S
Sbjct  201  IVGRRFGKQKLPYNKNKSFAGSIAMAAAGLLASIGFLHYFSLFGYIQVNSKTVLGFLFMS  260

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            LAAALVESHPLS+ELDDNLTVPL SVL GS +
Sbjct  261  LAAALVESHPLSSELDDNLTVPLTSVLVGSLV  292



>ref|XP_006354090.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Solanum 
tuberosum]
Length=293

 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSG+QGA++AA IPGLNI K+LLLGLG
Sbjct  81   EETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAFIPGLNIIKMLLLGLG  140

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KDD TVKSMSRFGD+RELLKGPLYYA +IT ACA+YWR SPI+I L+CNLCAGDG+AD
Sbjct  141  IWKDDATVKSMSRFGDHRELLKGPLYYAFSITYACAIYWRYSPISIGLICNLCAGDGIAD  200

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKSFAGSIAMAA GFLAS+GF+ YFS  G ++ +   VLGFL +S
Sbjct  201  IVGRRFGKQKLPYNKNKSFAGSIAMAAAGFLASLGFLFYFSLLGYIQVSSKTVLGFLFMS  260

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            LAAALVESHPLS+ELDDNLTVPL SVL GS +
Sbjct  261  LAAALVESHPLSSELDDNLTVPLTSVLVGSLV  292



>ref|XP_010069238.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57520.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=241

 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRKLVHVS+G++FMLCWP+FSSG + AL+AA +PGLNI ++LL+G G
Sbjct  29   EETAKRGLFDQKLNRKLVHVSIGIIFMLCWPLFSSGHRSALLAATVPGLNIIRVLLVGSG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+  VKSMSRFGD+RELLKGPLYYA TIT ACA YW++SPIAIA +CNLCAGDG AD
Sbjct  89   IWKDEAIVKSMSRFGDHRELLKGPLYYASTITFACAYYWKTSPIAIAAICNLCAGDGFAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            IIGRR    KLP+N NKSFAGSIAMA+ GFLAS+GFM YFSSFG ++ +  MV GFL+VS
Sbjct  149  IIGRRFGHHKLPYNSNKSFAGSIAMASAGFLASLGFMSYFSSFGYIQGSWEMVSGFLMVS  208

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVESHPLS+ELDDNLTVPL S+L GS +F
Sbjct  209  LASALVESHPLSSELDDNLTVPLTSMLVGSLVF  241



>ref|XP_007205802.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
 gb|EMJ07001.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
Length=241

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG+FDQ LNRK VHVS+G+VFMLCWP+FSSG QGA +A+L PG+NIF++LLLGLG
Sbjct  29   EETAKRGFFDQKLNRKFVHVSIGLVFMLCWPLFSSGLQGAFLASLTPGINIFRMLLLGLG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKS+SR GDYRELLKGPLYYA TITLAC +YWR+SPIAIAL+CNLCAGDG+AD
Sbjct  89   IWKDEATVKSISRSGDYRELLKGPLYYATTITLACIIYWRTSPIAIALICNLCAGDGLAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  + K+P+N+NKS  GS+AMA+ GFL SIG+MHYFS FG ++++  MVLGFLVVS
Sbjct  149  IVGRRFGTRKIPYNRNKSIVGSVAMASAGFLTSIGYMHYFSRFGFVQESWDMVLGFLVVS  208

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+ST++DDNLTVPL S+L G  +F
Sbjct  209  LASALVESLPISTDVDDNLTVPLTSILVGGLVF  241



>ref|XP_008384758.1| PREDICTED: probable phytol kinase 2, chloroplastic [Malus domestica]
Length=325

 Score =   298 bits (764),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 185/213 (87%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRK VHVS+G+VFMLCWP+FSSG QGA  A+L PGLNIF++LLLGLG
Sbjct  113  QETAKRGIFDQKLNRKFVHVSIGLVFMLCWPLFSSGLQGAFFASLTPGLNIFRMLLLGLG  172

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSR+GD+RELLKGPLYYA TITLAC VYWR+SPIAIAL+CNLCAGDG+AD
Sbjct  173  IWKDEATVKSMSRYGDHRELLKGPLYYATTITLACLVYWRTSPIAIALICNLCAGDGLAD  232

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  + KLP+N+NKS AGS+AMA+ GFL SIG+M+YFSSFG ++++  M LGFLVVS
Sbjct  233  IVGRRFGTQKLPYNRNKSIAGSVAMASAGFLTSIGYMYYFSSFGYVQESWGMALGFLVVS  292

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+STELDDNLTV L S L GS +F
Sbjct  293  LASALVESLPISTELDDNLTVSLTSALIGSLVF  325



>ref|XP_008221407.1| PREDICTED: probable phytol kinase 3, chloroplastic [Prunus mume]
Length=325

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRK VHVS+G+VFMLCWP+FSSG +GA +A+L PG+NIF++LLLGLG
Sbjct  113  EETAKRGVFDQKLNRKCVHVSIGLVFMLCWPLFSSGLRGAFLASLTPGINIFRMLLLGLG  172

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKS+SR+GDYRELLKGPLYYA TITLAC +YWR+SPIAIAL+CNLCAGDG+AD
Sbjct  173  IWKDEATVKSISRYGDYRELLKGPLYYATTITLACIIYWRTSPIAIALICNLCAGDGLAD  232

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  + K+P+N+NKS  GS+AMA+ GFL SIG+MHYFS FG ++++  MVLGFLVVS
Sbjct  233  IVGRRFGTRKIPYNRNKSVVGSVAMASAGFLTSIGYMHYFSRFGFVQESWGMVLGFLVVS  292

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+ST LDDNLTVPLAS+L GS +F
Sbjct  293  LASALVESLPISTNLDDNLTVPLASILVGSLVF  325



>ref|XP_004294311.1| PREDICTED: probable phytol kinase 2, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=316

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E+ AKRG FDQ LNRKLVH+S+G+VFMLCWP+FSSG QGAL+A+LIPGLNI ++LLLGLG
Sbjct  104  EQTAKRGVFDQKLNRKLVHISIGLVFMLCWPLFSSGYQGALLASLIPGLNIIRMLLLGLG  163

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+KD+ TVKSMSR+ DYRELLKGPLYYA  IT AC VY+R+SP+AIAL+CNLCAGDG+AD
Sbjct  164  IMKDEATVKSMSRYNDYRELLKGPLYYATAITWACVVYYRTSPVAIALICNLCAGDGLAD  223

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR  + K+P+N+NKS AGS+AMA+ GFL+SIG+M+YFS FG ++K+  MVLGFLVVS
Sbjct  224  VVGRRFGTQKIPYNRNKSIAGSVAMASAGFLSSIGYMYYFSKFGFVDKSWDMVLGFLVVS  283

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+STELDDNLTVPL S+L GS IF
Sbjct  284  LASALVESLPISTELDDNLTVPLTSILVGSFIF  316



>emb|CDP09225.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EIAK G  DQ LNRKLVHVS+G+VFMLCWPMFSSG +GA++AALIPG+NI K+LLLGLG+
Sbjct  30   EIAKMGVLDQKLNRKLVHVSIGLVFMLCWPMFSSGNRGAVLAALIPGVNIIKVLLLGLGV  89

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             +D+ TVKSMSRFGD+RELLKGPLYYA TITLACA+ WR+SPIAIA +CNLCAGDG+ADI
Sbjct  90   YEDEATVKSMSRFGDHRELLKGPLYYATTITLACALCWRTSPIAIAAICNLCAGDGLADI  149

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  S KLP+NKNKS  G+ +M   GFLASIG+MHYFS+FG +E++  M   F VVSL
Sbjct  150  MGRRFGSKKLPYNKNKSIVGTFSMVVAGFLASIGYMHYFSTFGYVEESWQMAYRFFVVSL  209

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             AALVESHP+STELDDNLTVPL SVL GS +F
Sbjct  210  VAALVESHPISTELDDNLTVPLTSVLVGSFVF  241



>ref|XP_002516647.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
 gb|EEF45742.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
Length=304

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E A RG FDQ LNRKLVH+S+G+VFMLCWP+FSSG QGA++AAL PG+NIF++LLLGLG
Sbjct  92   KETAIRGIFDQKLNRKLVHISIGLVFMLCWPLFSSGHQGAILAALTPGVNIFRMLLLGLG  151

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSRFGD+RELLKGPLYYA+TITLACA+YWR+SPIAIA +CNLCAGDG+AD
Sbjct  152  IWKDEATVKSMSRFGDHRELLKGPLYYALTITLACAIYWRTSPIAIAAICNLCAGDGIAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    K+P+N++KS AGSIAMA  GF+AS+ FM+YF+SFG L K+  M+LGFLVVS
Sbjct  212  IVGRRFGRQKIPYNRDKSIAGSIAMALAGFIASVMFMYYFASFGYLRKSYEMILGFLVVS  271

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ LVES P+STELDDNLTV + S+L G+ +F
Sbjct  272  LASTLVESLPISTELDDNLTVTVTSILLGTLVF  304



>ref|XP_009369583.1| PREDICTED: probable phytol kinase 2, chloroplastic [Pyrus x bretschneideri]
Length=326

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRKLVHVS+G+VFMLCWP+FSSG QGA  A+L PGLNIF++LLLGLG
Sbjct  114  QETAKRGIFDQKLNRKLVHVSIGLVFMLCWPLFSSGLQGAFFASLTPGLNIFRMLLLGLG  173

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSR+GD+RELLKGPLYYA TITLAC VYWR+SPIAIAL+CNLCAGDG+AD
Sbjct  174  IWKDEATVKSMSRYGDHRELLKGPLYYATTITLACLVYWRTSPIAIALICNLCAGDGLAD  233

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GR+  + KLP+N+NKS AGS+AMA+ GFL SIG+M+YFSSFG ++++  M LGFLVVS
Sbjct  234  IVGRQFGTLKLPYNRNKSIAGSVAMASAGFLTSIGYMYYFSSFGYVQESWGMALGFLVVS  293

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+ST+LDDNLTV L S L GS +F
Sbjct  294  LASALVESLPISTKLDDNLTVSLTSALIGSLVF  326



>gb|KHG05203.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=306

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G G
Sbjct  94   QETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIMRMILIGSG  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA YWR+SPIAIA +CNLCAGDG AD
Sbjct  154  LWKDEATVKSMSRYGDYRELLKGPLYYATTITLACAFYWRTSPIAIAAICNLCAGDGFAD  213

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GR+    KLP+NKNKS AGS+AMA  GF  S+G+M+YFS FG ++++  +V GFL+VS
Sbjct  214  IVGRQFGGQKLPYNKNKSIAGSVAMAIAGFFTSVGYMYYFSYFGYIKESTEIVFGFLIVS  273

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  274  LASALVESLPVSTELDDNLTVTLTSILVGSLVF  306



>ref|XP_007016939.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY34558.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=307

 Score =   293 bits (750),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR   DQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AA+ PG+NI ++LL+G G
Sbjct  95   QETAKRRLCDQKLNRKLVHISIGLVFMLCWPLFSSGYRGAILAAITPGVNIIRMLLIGSG  154

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA+YWR+SPIA+A +CNLCAGDG+AD
Sbjct  155  LWKDEATVKSMSRYGDYRELLKGPLYYATTITLACALYWRTSPIAVAAICNLCAGDGIAD  214

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR    KLP+N NKS AGS+AMA  GFLAS+GFM+YF+ FG ++++  +VLGFLVVS
Sbjct  215  VVGRRFGRQKLPYNSNKSIAGSVAMATAGFLASVGFMYYFAYFGYIQESWEIVLGFLVVS  274

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  275  LASALVESLPISTELDDNLTVTLTSILVGSLVF  307



>ref|XP_002313239.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87194.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=237

 Score =   290 bits (743),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 182/213 (85%), Gaps = 1/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AK G  DQ LNRKLVH+S+G+VFMLCWP+FSSGR+GAL AA  PG+NI ++LL+G G
Sbjct  26   KETAKHG-LDQKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAFTPGVNIIQILLIGSG  84

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMAD
Sbjct  85   MWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMAD  144

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVVS
Sbjct  145  IVGRRFGRQKIPYNKNKSIAGSVAMALSGFVASVGFMYYFASFGYVQKSWEMLLGFLVVS  204

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+A VES P+STELDDNLTV L S+L G+ +F
Sbjct  205  LASAFVESLPISTELDDNLTVTLTSILLGNLVF  237



>ref|XP_010028019.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW54676.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=241

 Score =   290 bits (743),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALIPG+NI ++LLLG G
Sbjct  29   EETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALIPGVNIIRMLLLGSG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA +CNLCAGDG AD
Sbjct  89   IWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAAICNLCAGDGFAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            IIGRR+   K+P+N+NKS AGSIAM   GFLAS+GFM YFSSFG +  +  M  GFLVVS
Sbjct  149  IIGRRLGQHKIPYNRNKSLAGSIAMGCAGFLASLGFMSYFSSFGYIRGSWEMASGFLVVS  208

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVESHPLS+ LDDNLTVPL   L GS +F
Sbjct  209  LASALVESHPLSSRLDDNLTVPLTCALVGSLVF  241



>ref|XP_002313238.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87193.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=313

 Score =   293 bits (750),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E  KR  FDQ LNRKLVH+S+G+VFMLCWP+FSSGR+GAL AA  PG+NI ++LL+G G+
Sbjct  102  ETTKRHVFDQKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAFTPGVNIIQILLIGSGM  161

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMADI
Sbjct  162  WKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMADI  221

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVVSL
Sbjct  222  VGRRFGRQKIPYNKNKSIAGSVAMALSGFVASVGFMYYFASFGYVQKSWEMLLGFLVVSL  281

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+A VES P+STELDDNLTV L S+L G+ +F
Sbjct  282  ASAFVESLPISTELDDNLTVTLTSILLGNLVF  313



>ref|XP_007016937.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34556.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=352

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 184/213 (86%), Gaps = 1/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG  DQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AA+ PG+NI ++LL+G G
Sbjct  141  QETAKRG-LDQKLNRKLVHISIGLVFMLCWPLFSSGYRGAILAAITPGVNIIRMLLIGSG  199

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA+YWR+SPIA+A +CNLCAGDG+AD
Sbjct  200  LWKDEATVKSMSRYGDYRELLKGPLYYATTITLACALYWRTSPIAVAAICNLCAGDGIAD  259

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR    KLP+N NKS AGS+AMA  GFLAS+GFM+YF+ FG ++++  +VLGFLVVS
Sbjct  260  VVGRRFGRQKLPYNSNKSIAGSVAMATAGFLASVGFMYYFAYFGYIQESWEIVLGFLVVS  319

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  320  LASALVESLPISTELDDNLTVTLTSILVGSLVF  352



>gb|KEH34361.1| phytol kinase [Medicago truncatula]
Length=301

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRKLVH+++G+VFMLCWP+F +GR     AA IPG+NI ++ ++G G
Sbjct  89   KETAKRGLFDQKLNRKLVHITIGLVFMLCWPLFGNGRWAPFYAAFIPGVNILRMFVIGSG  148

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ILKD+ TVKSMSRFGDYRELL+GPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMAD
Sbjct  149  ILKDEATVKSMSRFGDYRELLRGPLYYAATITLASMIYWRTSPISIAAICNLCAGDGMAD  208

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  S KLP+NKNKS+AGSIAMA+ GFLASIG+M YFSSFG +E     V+GFLVVS
Sbjct  209  IVGRRFGSEKLPYNKNKSYAGSIAMASAGFLASIGYMWYFSSFGYMEGGWSKVIGFLVVS  268

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +  A+VESHP+ST+LDDNLTVPL S+L GS +F
Sbjct  269  VITAVVESHPISTDLDDNLTVPLTSILVGSMVF  301



>gb|KJB83902.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=306

 Score =   290 bits (743),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G G
Sbjct  94   QETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIIRMILIGSG  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVK+MSR+GDYRELLKGP+YYA TITLACA YWR+SPIAIA +CNLCAGDG AD
Sbjct  154  LWKDEATVKAMSRYGDYRELLKGPVYYATTITLACAFYWRTSPIAIAAICNLCAGDGFAD  213

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GR+    KLP+NKNKS AGS+AMA  GFL S+G+M+YFS FG ++++  +V GFL+VS
Sbjct  214  IVGRQFGGQKLPYNKNKSIAGSVAMAIAGFLTSVGYMYYFSYFGYIKESTEIVFGFLIVS  273

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  274  IASALVESLPVSTELDDNLTVTLTSILVGSLVF  306



>gb|KDP45737.1| hypothetical protein JCGZ_17344 [Jatropha curcas]
Length=297

 Score =   290 bits (742),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 184/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR  FDQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AAL PG+NIF++L+LGLG
Sbjct  85   QETAKRRLFDQKLNRKLVHISIGLVFMLCWPLFSSGHRGAILAALTPGINIFRMLILGLG  144

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSRFGD+RELLKGPLYYA+TITL CA+YWR+SPI IA +CNLCAGDGMAD
Sbjct  145  IWKDEATVKSMSRFGDHRELLKGPLYYALTITLTCAIYWRTSPITIAAICNLCAGDGMAD  204

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  + KLP+N NKS AGS+AMA  GFLASI +MHYF+SFG + ++  M +GFLVVS
Sbjct  205  IVGRRFGNHKLPYNTNKSIAGSVAMALAGFLASITYMHYFASFGYVRESWEMTMGFLVVS  264

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+A+VES P+ST+LDDNLTV L SVL G+ +F
Sbjct  265  IASAIVESLPISTQLDDNLTVSLTSVLLGTLVF  297



>emb|CDM84848.1| unnamed protein product [Triticum aestivum]
Length=312

 Score =   288 bits (738),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG  DQ LNRKLVH+++GMVF+L WP+FSSGR     AAL PG+NI ++LLLGLG
Sbjct  100  EELAKRGVCDQKLNRKLVHITIGMVFLLFWPLFSSGRYAPFFAALAPGINIIRMLLLGLG  159

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+K++  VKSMSR GD+RELLKGPLYYA TITLA +V WR+SPIAIALVCNLCAGDG+AD
Sbjct  160  IMKNEAMVKSMSRSGDHRELLKGPLYYATTITLATSVLWRTSPIAIALVCNLCAGDGIAD  219

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR+   KLP+N NKS+AGSIAMA  GFLASIG+MHYF SFG +EK+ +M LGFLVVS
Sbjct  220  VVGRRLGKEKLPYNPNKSYAGSIAMAVAGFLASIGYMHYFHSFGLMEKSWYMTLGFLVVS  279

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +AAALVESHP+STELDDNLTVPL S L GS I 
Sbjct  280  VAAALVESHPISTELDDNLTVPLTSFLVGSLIL  312



>ref|XP_011003760.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
 ref|XP_011003768.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
Length=241

 Score =   285 bits (730),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AK G  DQ LNRKLVH+S+G+VFML WP+FSSG +GAL+AAL PG+NI ++LL+G G
Sbjct  30   KETAKHG-LDQKLNRKLVHISIGLVFMLWWPIFSSGHRGALLAALTPGVNIIRMLLIGSG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
              KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMAD
Sbjct  89   TWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVVS
Sbjct  149  IVGRRFGRQKIPYNKNKSIAGSVAMALAGFVASVGFMYYFASFGYVQKSREMLLGFLVVS  208

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+A VES P+STELDDNLTV L S+L G  +F
Sbjct  209  LASAFVESLPISTELDDNLTVTLTSILLGHLVF  241



>ref|XP_011003752.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Populus euphratica]
Length=310

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E  KR  FDQ LNRKLVH+S+G+VFML WP+FSSG +GAL+AAL PG+NI ++LL+G G 
Sbjct  99   ETTKRHVFDQKLNRKLVHISIGLVFMLWWPIFSSGHRGALLAALTPGVNIIRMLLIGSGT  158

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMADI
Sbjct  159  WKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMADI  218

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVVSL
Sbjct  219  VGRRFGRQKIPYNKNKSIAGSVAMALAGFVASVGFMYYFASFGYVQKSREMLLGFLVVSL  278

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+A VES P+STELDDNLTV L S+L G  +F
Sbjct  279  ASAFVESLPISTELDDNLTVTLTSILLGHLVF  310



>ref|XP_002278580.2| PREDICTED: probable phytol kinase 2, chloroplastic [Vitis vinifera]
Length=309

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EIAKRG+FDQ + RKLVH+S+G+VFML WP+FSSGRQGA++AALIPG+NI ++LLLGLGI
Sbjct  98   EIAKRGFFDQTVGRKLVHISVGLVFMLFWPLFSSGRQGAVLAALIPGVNIIRMLLLGLGI  157

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             KD+  VKSMSR GD+RELLKGPLYYA  ITLACA+YWR+SPIAIA +CNLCAGDG+AD+
Sbjct  158  WKDEAIVKSMSRHGDHRELLKGPLYYASAITLACAIYWRTSPIAIAAICNLCAGDGLADL  217

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVVSL
Sbjct  218  VGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVVSL  277

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             + LVES P+S+ELDDNLT+P+ S+L G+ +F
Sbjct  278  GSTLVESLPISSELDDNLTIPVTSLLLGTLVF  309



>ref|XP_007146804.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
 gb|ESW18798.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
Length=311

 Score =   286 bits (732),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRKLVH+S+G++FMLCWP+FS+G   A  AALIPG+NI ++++ GLG
Sbjct  99   QETAKRGIFDQKLNRKLVHLSIGLMFMLCWPLFSTGNMAAFFAALIPGVNIIRMIVTGLG  158

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++KD+ TVKSMSRFGD+RELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMAD
Sbjct  159  LVKDEATVKSMSRFGDHRELLKGPLYYATTITLASIIYWRTSPISIAAICNLCAGDGMAD  218

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    K+P+NK+KS+AGSIAMA+ GFLASIG+M YFSSFG +E +  +VL FL+VS
Sbjct  219  IVGRRFGGEKIPYNKDKSYAGSIAMASAGFLASIGYMWYFSSFGYIEGSWKLVLSFLLVS  278

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +  A VES P+STELDDNLTVPL S+L G+ IF
Sbjct  279  IGTAFVESLPISTELDDNLTVPLTSILLGTVIF  311



>ref|XP_011025082.1| PREDICTED: probable phytol kinase 3, chloroplastic [Populus euphratica]
Length=294

 Score =   286 bits (731),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 185/213 (87%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKR  FDQ LNRKL+H+S+G+VFMLCWPMFSSG QGAL+AA IPGLNI ++LL+G G
Sbjct  82   EETAKRRIFDQKLNRKLLHISIGLVFMLCWPMFSSGHQGALLAACIPGLNIIRMLLIGSG  141

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+  VKSMSRFGD RELLKGPLYYA+TIT+ACA+YWR+SP+AIA +CNLCAGDG+AD
Sbjct  142  MWKDEAMVKSMSRFGDRRELLKGPLYYALTITVACAIYWRTSPVAIAAICNLCAGDGIAD  201

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+ S K+P+N+NKS AGS+AMA  GFLAS+GFMHYFS+FG ++K+  M LGFL+VS
Sbjct  202  IVGRRLGSQKIPYNRNKSIAGSVAMALAGFLASLGFMHYFSAFGYVQKSWEMTLGFLIVS  261

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA++ VES P+STELDDNLTV L S+L G+ +F
Sbjct  262  LASSFVESLPISTELDDNLTVTLTSLLLGNLVF  294



>ref|XP_010028020.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=244

 Score =   283 bits (725),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRKLVHVS+G+VFMLCWP+FSS  +GAL+AA IPG NI ++LL+G G
Sbjct  32   EETAKRGLFDQKLNRKLVHVSVGLVFMLCWPLFSSEHRGALLAATIPGFNIIRMLLVGSG  91

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSRFGD RELL+GPLYY + IT ACA YWR+SP+AIA +CNLCAGDG AD
Sbjct  92   IWKDEATVKSMSRFGDRRELLEGPLYYVLMITFACAYYWRTSPVAIAAICNLCAGDGFAD  151

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            IIGR+    K+P+N NKS AGSIAM + GFLAS+GF+ YFSSFG ++ +  MV GFL+VS
Sbjct  152  IIGRQFGQHKIPYNPNKSVAGSIAMTSAGFLASLGFLSYFSSFGYIQGSWEMVGGFLMVS  211

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             A+ALVESHPLS+++DDNLTVPLA  L GS +F
Sbjct  212  FASALVESHPLSSQIDDNLTVPLACALVGSLVF  244



>emb|CDY66208.1| BnaCnng49970D [Brassica napus]
Length=302

 Score =   285 bits (730),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 186/213 (87%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG+FDQ L RKLVH+++G+VFMLCWP+FSSGRQGAL+A+L+PGLNI ++LLLGLG+
Sbjct  90   EIGKRGFFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGALLASLVPGLNIVRMLLLGLGV  149

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPIAIA++CNLCAGDGMADI
Sbjct  150  YQDEGTIKSMSRHGDRRELLKGPLYYALSITSACFFYWKTSPIAIAVICNLCAGDGMADI  209

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVS  229
            +GRR+ + KLP+N+NKS AGSI MA  GFLAS+G+M+YFSSFG +E T   M+L FLV+S
Sbjct  210  VGRRLGTEKLPYNRNKSLAGSIGMAIAGFLASVGYMYYFSSFGYMESTGWDMILRFLVIS  269

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+AL+ES P+ST++DDNLT+PL S L G+ +F
Sbjct  270  IASALIESLPISTDIDDNLTIPLTSALVGTLLF  302



>ref|XP_004970454.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=314

 Score =   286 bits (731),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F++ L+RKLVH+S+G+VF+L WP+FSSG     +AAL PG+NI ++ LLG+G
Sbjct  102  EELAKRGVFEEKLSRKLVHISVGLVFLLFWPLFSSGTYAPFLAALAPGVNIIRMFLLGIG  161

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K++  VKSMSR GDYRELLKGPLYYA TIT A +V WRSSPIAIALVCNLCAGDG+AD
Sbjct  162  LMKNEAMVKSMSRSGDYRELLKGPLYYATTITFATSVLWRSSPIAIALVCNLCAGDGIAD  221

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GR +   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M LGFLVVS
Sbjct  222  VVGRHLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALGFLVVS  281

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +AAALVESHP+STELDDNLTVPL S L GS IF
Sbjct  282  IAAALVESHPISTELDDNLTVPLTSFLVGSLIF  314



>ref|XP_002299996.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
 gb|EEE84801.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
Length=241

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKR  FDQ LNRKL+H+S+G+VFMLCWPMFSSG +GAL+AA IPGLNI ++LL+G G
Sbjct  29   EETAKRHIFDQKLNRKLMHISIGLVFMLCWPMFSSGLRGALLAACIPGLNIIRMLLIGSG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSRFGD RELLKGPLYYA+TIT+ACA+YWR+SP+AIA +CNLCAGDG+AD
Sbjct  89   MWKDEATVKSMSRFGDRRELLKGPLYYALTITVACAIYWRTSPVAIAAICNLCAGDGIAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+ S K+P+N+NKS AGS+AMA  GFLAS+GFM YFS+FG ++K+  M+LGFL+VS
Sbjct  149  IVGRRLGSQKIPYNRNKSIAGSVAMALAGFLASLGFMVYFSAFGYVQKSWEMILGFLIVS  208

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA++ VES P+STELDDNLTV L S+L G+ +F
Sbjct  209  LASSFVESLPISTELDDNLTVTLTSLLLGNLVF  241



>ref|XP_010520194.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=309

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E  KRG FDQ L RKLVHVS+G VFMLCWP+FSSG +GA++A+L+PG NI + LLLGLG+
Sbjct  98   EFGKRGIFDQKLVRKLVHVSVGPVFMLCWPLFSSGLRGAVLASLVPGGNIIRTLLLGLGV  157

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR+GD RELLKGPLYYA+ ITL+CA YWR+SPIAIA++CNLCAGDGMADI
Sbjct  158  YHDEGTIKSMSRYGDRRELLKGPLYYALAITLSCAFYWRTSPIAIAVICNLCAGDGMADI  217

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR+ + KLP+N+NKS AGSIAMAA GFLAS+G+M+YF+SFG +E +  M+L FL+VS 
Sbjct  218  VGRRLGTEKLPYNRNKSVAGSIAMAAAGFLASVGYMYYFASFGYIEDSGGMILRFLIVST  277

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             AALVES P+S+E+DDNLTVPL S L G+ +F
Sbjct  278  VAALVESIPISSEIDDNLTVPLTSALVGTLVF  309



>ref|XP_008356261.1| PREDICTED: probable phytol kinase 3, chloroplastic [Malus domestica]
Length=266

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  735  NLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSM  556
             LNRKLVHVS+G+VFMLCWP+FSSG +GA +A L PGLNIF++LLLGLGI KD+ TVKSM
Sbjct  65   KLNRKLVHVSIGLVFMLCWPLFSSGLRGAFLACLTPGLNIFRMLLLGLGIWKDEATVKSM  124

Query  555  SRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKL  376
            SR+GDYRELLKGPLYYA TITLAC +YWR+SPIAIAL+CNLCAGDG+ADI+GRR  + K+
Sbjct  125  SRYGDYRELLKGPLYYATTITLACLIYWRTSPIAIALICNLCAGDGLADIVGRRFGTXKI  184

Query  375  PHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPL  196
            P+N++KS AGS+AMA+ GFL SIG+MHYFSSFG ++++  MVLGFLVVSLA+ALVES P+
Sbjct  185  PYNRSKSIAGSVAMASAGFLTSIGYMHYFSSFGFVQESWGMVLGFLVVSLASALVESLPI  244

Query  195  STELDDNLTVPLASVLAGSCIF  130
            STELDDNLTV L SVL GS +F
Sbjct  245  STELDDNLTVSLTSVLVGSLVF  266



>gb|KHN02090.1| Putative phytol kinase 3, chloroplastic [Glycine soja]
Length=322

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR  FDQ LNRKLVH+S+G++FMLCWP+FS+    +  AALIPG+NIF++L++GLG
Sbjct  110  QETAKRDLFDQKLNRKLVHISIGLIFMLCWPLFSTETWASFFAALIPGINIFRMLVIGLG  169

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ILKD+ TVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMAD
Sbjct  170  ILKDEATVKSMSRFGDYRELLKGPLYYAATITLAAIIYWRTSPISIAAICNLCAGDGMAD  229

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   K+P+NKNKSFAGSIAMA  GFL SIG+M YFSSFG +E +  +VLGFL+VS
Sbjct  230  IVGRRLGGEKIPYNKNKSFAGSIAMATAGFLTSIGYMWYFSSFGFIEGSWKLVLGFLLVS  289

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            +  A VES P+STELDDNLTVPL S+L GS I
Sbjct  290  IVTAFVESLPISTELDDNLTVPLTSILVGSII  321



>ref|NP_001130181.1| uncharacterized protein LOC100191275 [Zea mays]
 ref|XP_008657098.1| PREDICTED: probable phytol kinase 2, chloroplastic [Zea mays]
 gb|ACF78326.1| unknown [Zea mays]
 gb|ACF84542.1| unknown [Zea mays]
Length=312

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q L+RKLVH+S+G+VFML WP+FSSG     +AAL PG+NI ++LLLGLG
Sbjct  100  EELAKRGVFEQKLSRKLVHISVGLVFMLFWPLFSSGWYTPFLAALAPGVNIIRMLLLGLG  159

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K++  VKSMSR GDYRELLKGPLYYA TIT A ++ WR+SP+AIAL+CNLCAGDG+AD
Sbjct  160  LMKNEAMVKSMSRSGDYRELLKGPLYYAATITFATSLLWRTSPVAIALICNLCAGDGIAD  219

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR+   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M L FLVVS
Sbjct  220  VVGRRLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALSFLVVS  279

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +AAALVESHP+STELDDNLTVPL S L GS IF
Sbjct  280  VAAALVESHPISTELDDNLTVPLTSFLVGSLIF  312



>emb|CBI15917.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   281 bits (719),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EIAKRG+FDQ + RKLVH+S+G+VFML WP+FSSGRQGA++AALIPG+NI ++LLLGLGI
Sbjct  30   EIAKRGFFDQTVGRKLVHISVGLVFMLFWPLFSSGRQGAVLAALIPGVNIIRMLLLGLGI  89

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             KD+  VKSMSR GD+RELLKGPLYYA  ITLACA+YWR+SPIAIA +CNLCAGDG+AD+
Sbjct  90   WKDEAIVKSMSRHGDHRELLKGPLYYASAITLACAIYWRTSPIAIAAICNLCAGDGLADL  149

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVVSL
Sbjct  150  VGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVVSL  209

Query  225  AAALVESHPLSTELDDNLTVPLASVL  148
             + LVES P+S+ELDDNLT+P+ S+L
Sbjct  210  GSTLVESLPISSELDDNLTIPVTSLL  235



>gb|ACU24460.1| unknown [Glycine max]
Length=318

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR  FDQ LNRKLVH+S+G++FMLCWP+FS+    +  AALIPG+NIF++L++GLG
Sbjct  106  QETAKRDLFDQKLNRKLVHISIGLIFMLCWPLFSTETWASFFAALIPGINIFRMLVIGLG  165

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ILKD+ TVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMAD
Sbjct  166  ILKDEATVKSMSRFGDYRELLKGPLYYAATITLAAIIYWRTSPISIAAICNLCAGDGMAD  225

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   K+P+NKNKSFAGSIAMA  GFL SIG+M YFSSFG +E +  + LGFL+VS
Sbjct  226  IVGRRLGGEKIPYNKNKSFAGSIAMATAGFLTSIGYMWYFSSFGFIEGSWKLALGFLLVS  285

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            +  A VES P+STELDDNLTVPL S+L GS I
Sbjct  286  IVTAFVESLPISTELDDNLTVPLTSILVGSII  317



>ref|XP_002458716.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
 gb|EES03836.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
Length=341

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EEIAKRG F+Q L+RKLVH+S+G+VF+L WP+FSSG     +AAL PG+N+ ++LLLGLG
Sbjct  129  EEIAKRGVFEQKLSRKLVHISVGLVFLLFWPLFSSGWYAPFLAALAPGVNVIRMLLLGLG  188

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K++  VKS+SR GDYRELLKGPLYYA TIT A +V WR+SP+AIAL+CNLCAGDG+AD
Sbjct  189  LMKNEAMVKSISRSGDYRELLKGPLYYATTITFATSVLWRTSPVAIALICNLCAGDGIAD  248

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR+   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M LGFLVVS
Sbjct  249  VVGRRLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALGFLVVS  308

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +AA LVESHP+STELDDNLTVPL S L GS IF
Sbjct  309  VAATLVESHPISTELDDNLTVPLTSFLVGSLIF  341



>ref|NP_001044703.2| Os01g0832000 [Oryza sativa Japonica Group]
 dbj|BAD81857.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC71742.1| hypothetical protein OsI_04308 [Oryza sativa Indica Group]
 gb|EEE55624.1| hypothetical protein OsJ_03964 [Oryza sativa Japonica Group]
 dbj|BAF06617.2| Os01g0832000 [Oryza sativa Japonica Group]
Length=246

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSG     +AA+ PG+NI ++LLLGLG
Sbjct  34   EELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGSYAPFLAAVAPGINIIRMLLLGLG  93

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K++  VKSMSR GD RELLKGPLYYA TIT A +++WR+SPIAIAL+CNLCAGDG+AD
Sbjct  94   VMKNEAMVKSMSRSGDPRELLKGPLYYATTITFATSIFWRTSPIAIALICNLCAGDGIAD  153

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   KLP+N NKS+AGSIAMA  GF+ASIG+MHYF SFG +E++  +  GFLVVS
Sbjct  154  IVGRRLGQEKLPYNPNKSYAGSIAMALAGFMASIGYMHYFQSFGFIEESWSLAFGFLVVS  213

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + AALVESHP+ST LDDNLTVPL S L GS +F
Sbjct  214  VTAALVESHPISTHLDDNLTVPLTSFLVGSLVF  246



>ref|XP_008457339.1| PREDICTED: probable phytol kinase 2, chloroplastic [Cucumis melo]
Length=322

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E AKRG  DQ LNRKLVH+S+G+ FMLCWPMFSSG QGA+ A+LIPG N+ ++L+LG GI
Sbjct  112  ETAKRG-LDQKLNRKLVHISIGLAFMLCWPMFSSGYQGAIFASLIPGANVIRMLVLGFGI  170

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
            LKD+ T+KSMSR+GDYRELLKGPLYY  TITL C  YWR+SPI+IAL+CNLCAGDG ADI
Sbjct  171  LKDEATLKSMSRYGDYRELLKGPLYYVATITLVCIFYWRTSPISIALICNLCAGDGFADI  230

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  S K+ +N+NKS AGS+AMA  GFLASIG+M+YFSSFG +E +  M L FL+VSL
Sbjct  231  VGRRFGSEKIFYNENKSLAGSVAMATAGFLASIGYMYYFSSFGYVEASIGMALRFLIVSL  290

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+STELDDNLTVPL S+L GS +F
Sbjct  291  ASALVESLPISTELDDNLTVPLTSLLVGSLVF  322



>gb|AFK48670.1| unknown [Lotus japonicus]
Length=315

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE A RG FDQ LNRKLVHVS+G+ F+ CWP++S  +  +L AALIPG+NI ++L +GLG
Sbjct  103  EETATRGLFDQKLNRKLVHVSIGLAFIFCWPLYSDDKWASLFAALIPGVNILRMLFIGLG  162

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ILKD+GTVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPIAIA +CNLCAGDGMAD
Sbjct  163  ILKDEGTVKSMSRFGDYRELLKGPLYYAATITLAAVLYWRTSPIAIAAICNLCAGDGMAD  222

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    K+P+N+NKS+AGS+AMA+ GFLAS+G+M YFSSFG +E +  + L FL+VS
Sbjct  223  IVGRRFGGKKIPYNRNKSYAGSVAMASAGFLASVGYMWYFSSFGFMEGSWELALRFLIVS  282

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +  A+VES P+STELDDNLTVPL S+L GS +F
Sbjct  283  VVTAVVESLPISTELDDNLTVPLTSILVGSIVF  315



>gb|KHG27084.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=240

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  741  DQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVK  562
            DQ LNRKLVH+S+G+VFMLCWP+FS+G +GA++AA+ PG+NI ++LL+G GI KD+ TVK
Sbjct  37   DQKLNRKLVHISIGLVFMLCWPLFSAGYRGAILAAITPGVNIIRMLLIGSGIWKDEATVK  96

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            SMSR+G+YRELLKGPLYYAIT+TLAC VYWR+SPI IA +CNLCAGDG+AD++GRR+   
Sbjct  97   SMSRYGNYRELLKGPLYYAITVTLACVVYWRTSPIGIAALCNLCAGDGLADVVGRRLGRK  156

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESH  202
            KLP+N+NKS AGS+AMA  GFL+S+G+M+YFS FG +++   M+L FLVVSLA+ALVES 
Sbjct  157  KLPYNRNKSVAGSVAMATAGFLSSVGYMYYFSYFGYIQEGWGMILRFLVVSLASALVESL  216

Query  201  PLSTELDDNLTVPLASVLAGSCIF  130
            P+STELDDNLTV L S+  GS IF
Sbjct  217  PISTELDDNLTVSLTSIFIGSLIF  240



>ref|XP_003564535.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=310

 Score =   280 bits (717),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSGR    +AAL PG+NI ++LLLGLG
Sbjct  98   EELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGRYAPFLAALAPGINIVRMLLLGLG  157

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+K++  VKSMSR GD+RELLKGPLYYA TIT A +V WR+SPIAIAL+CNLCAGDG+AD
Sbjct  158  IMKNEAMVKSMSRSGDHRELLKGPLYYATTITFATSVLWRTSPIAIALICNLCAGDGIAD  217

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   KLP+N NKS+AGSIAMA  GFLASIG+MHY  +FG +E++ +M  GFLVVS
Sbjct  218  IVGRRLGKDKLPYNPNKSYAGSIAMAVAGFLASIGYMHYLHTFGFIEESWNMAFGFLVVS  277

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +AA LVESHP+STELDDNLTVPL S L GS + 
Sbjct  278  VAATLVESHPISTELDDNLTVPLTSFLVGSLLL  310



>gb|KJB20420.1| hypothetical protein B456_003G147500 [Gossypium raimondii]
Length=240

 Score =   278 bits (710),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  741  DQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVK  562
            DQ LNRKLVH+S+G+VFMLCWP+FS+G +GA++AA+ PG+NI ++LL+G GI KD+ TVK
Sbjct  37   DQKLNRKLVHISIGLVFMLCWPLFSAGYRGAILAAITPGVNIIRMLLIGSGIWKDEATVK  96

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            SMSR+G+YRELLKGPLYYAIT+TLAC VYWR+SPI IA +CNLCAGDG+AD++GRR+   
Sbjct  97   SMSRYGNYRELLKGPLYYAITVTLACVVYWRTSPIGIAALCNLCAGDGLADVVGRRLGRK  156

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESH  202
            KLP+N+NKS AGS+AMA  GFL+S+G+M+YFS FG ++    M+L FLVVSLA+ALVES 
Sbjct  157  KLPYNRNKSIAGSVAMATAGFLSSVGYMYYFSYFGYIQDGWGMILRFLVVSLASALVESL  216

Query  201  PLSTELDDNLTVPLASVLAGSCIF  130
            P+STELDDNLTV L S+  GS IF
Sbjct  217  PISTELDDNLTVSLTSIFIGSLIF  240



>gb|AAM65097.1| unknown [Arabidopsis thaliana]
Length=307

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  96   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMADI
Sbjct  156  YHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACIYYWKSSPIAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  + KLP+NKNKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L FLV+S+
Sbjct  216  VGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVGYMYYFASFGYIEDSGGMILRFLVISI  275

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLT+ L S LAG  +F
Sbjct  276  ASALVESLPISTDIDDNLTISLTSALAGFLLF  307



>ref|XP_006644954.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=248

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q LNRKLVH+++G+VF+L WP+FS G     +AA+ PG+NI ++LLLGLG
Sbjct  36   EELAKRGVFEQKLNRKLVHITIGLVFLLFWPLFSPGSYAPFLAAVAPGINIIRMLLLGLG  95

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K++  VKSMSR GD+RELLKGPLYYA TIT A +V+WR+SPIAIAL+CNLCAGDG+AD
Sbjct  96   VMKNEAMVKSMSRSGDHRELLKGPLYYATTITFATSVFWRTSPIAIALICNLCAGDGIAD  155

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   KLP+N NKS+AGSIAM   GFLASIG+MHYF +FG +E++  +  GFLVVS
Sbjct  156  IVGRRLGQEKLPYNPNKSYAGSIAMVLAGFLASIGYMHYFQTFGFIEESWSLAFGFLVVS  215

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + AALVESHP+ST LDDNLTVPL S L GS +F
Sbjct  216  VTAALVESHPISTHLDDNLTVPLTSFLVGSLVF  248



>sp|Q5N9J9.3|PHYK2_ORYSJ RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
Length=304

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSG     +AA+ PG+NI ++LLLGLG
Sbjct  92   EELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGSYAPFLAAVAPGINIIRMLLLGLG  151

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K++  VKSMSR GD RELLKGPLYYA TIT A +++WR+SPIAIAL+CNLCAGDG+AD
Sbjct  152  VMKNEAMVKSMSRSGDPRELLKGPLYYATTITFATSIFWRTSPIAIALICNLCAGDGIAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   KLP+N NKS+AGSIAMA  GF+ASIG+MHYF SFG +E++  +  GFLVVS
Sbjct  212  IVGRRLGQEKLPYNPNKSYAGSIAMALAGFMASIGYMHYFQSFGFIEESWSLAFGFLVVS  271

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + AALVESHP+ST LDDNLTVPL S L GS +F
Sbjct  272  VTAALVESHPISTHLDDNLTVPLTSFLVGSLVF  304



>ref|XP_009603395.1| PREDICTED: LOW QUALITY PROTEIN: probable phytol kinase 2, chloroplastic, 
partial [Nicotiana tomentosiformis]
Length=218

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = -2

Query  723  KLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFG  544
            +LVH+S+G VFM CWPMFSSGRQGA++AALI GLNI K+LLLGLG+ KDD TVKSMSRFG
Sbjct  20   QLVHISIGPVFMPCWPMFSSGRQGAILAALISGLNIIKMLLLGLGLWKDDATVKSMSRFG  79

Query  543  DYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNK  364
            D+RELLKGPLYYA TITLACAVYWR SPIAI L+CNL AGDG+ADI+GRR     LP+NK
Sbjct  80   DHRELLKGPLYYAFTITLACAVYWRYSPIAIGLICNLYAGDGIADIVGRRFGKQXLPYNK  139

Query  363  NKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAA-LVESHPLSTE  187
            NKSFAGSIAMAA GFLASIG++H+FS FG ++++ H V GFL VSLAAA LVESHP+STE
Sbjct  140  NKSFAGSIAMAAAGFLASIGYLHHFSLFGYIQESSHTVFGFLFVSLAAALLVESHPISTE  199

Query  186  LDDNLTVPLASVLAGSCIF  130
            LDDNLTVPL SVL GS + 
Sbjct  200  LDDNLTVPLTSVLVGSLVL  218



>ref|NP_001242263.1| probable phytol kinase 3, chloroplastic [Glycine max]
 sp|Q2N2K0.1|PHYK3_SOYBN RecName: Full=Probable phytol kinase 3, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42677.1| phytol kinase [Glycine max]
Length=319

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR  FDQ LNRKLVH+S+G++FMLC P+FS+    +  AALIPG+NIF++L++GLG
Sbjct  107  QETAKRDLFDQKLNRKLVHISIGLIFMLCXPLFSTETWASFFAALIPGINIFRMLVIGLG  166

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ILKD+ TVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMAD
Sbjct  167  ILKDEATVKSMSRFGDYRELLKGPLYYAATITLAAIIYWRTSPISIAAICNLCAGDGMAD  226

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   K+P+NKNKSFAGSIAMA  GFL SIG+M YFSSFG +E +  +VLGFL+VS
Sbjct  227  IVGRRLGGEKIPYNKNKSFAGSIAMATAGFLTSIGYMWYFSSFGFIEGSWKLVLGFLLVS  286

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            +  A VES P+STELDDNLTVPL S+L GS I
Sbjct  287  IVTAFVESLPISTELDDNLTVPLTSILVGSII  318



>dbj|BAD43853.1| unknown protein [Arabidopsis thaliana]
Length=307

 Score =   278 bits (710),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  96   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMADI
Sbjct  156  YHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACVYYWKSSPIAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG +E +  M+L FLV+S+
Sbjct  216  VGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVAYMYYFASFGYIEDSGGMILRFLVISI  275

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLT+ L S LAG  +F
Sbjct  276  ASALVESLPISTDIDDNLTISLTSALAGFLLF  307



>ref|XP_009120370.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=302

 Score =   277 bits (709),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 183/213 (86%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSGRQGAL+A+L+PGLNI ++LLLGLG+
Sbjct  90   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGALLASLVPGLNIVRMLLLGLGV  149

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPI+IA++CNLCAGDGMADI
Sbjct  150  YQDEGTIKSMSRHGDRRELLKGPLYYALSITSACFFYWKTSPISIAVICNLCAGDGMADI  209

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVS  229
            +GRR  + KLP+N+NKS AGSI MA  GFLAS+G+M+YF+SFG +E     M+L FL++S
Sbjct  210  VGRRFGTEKLPYNRNKSLAGSIGMAIAGFLASVGYMYYFASFGYMESIGWDMILRFLIIS  269

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P+ST++DDNLT+PL S L G+ +F
Sbjct  270  VASALVESLPISTDIDDNLTIPLTSALVGTLLF  302



>ref|XP_004145246.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004153718.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172407.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65833.1| hypothetical protein Csa_1G533400 [Cucumis sativus]
Length=322

 Score =   278 bits (711),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E AKRG  DQ LNRKLVH+S+G+ FMLCWPMFSSG QGA++A+LIPG N+ ++LLLG GI
Sbjct  112  ETAKRG-LDQKLNRKLVHISIGLAFMLCWPMFSSGYQGAILASLIPGANVMRMLLLGFGI  170

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
            LKD+ T+KSMSR+GDYRELLKGPLYY  TIT  C  YWR+SPI+IAL+CNLCAGDG+ADI
Sbjct  171  LKDEATLKSMSRYGDYRELLKGPLYYVATITFVCIFYWRTSPISIALICNLCAGDGLADI  230

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  S K+ +NKNKS AGS+AMA  GFLASIG+M+YFS FG +E +  M + FL+VSL
Sbjct  231  VGRRFGSEKIFYNKNKSLAGSVAMATAGFLASIGYMYYFSLFGYVEASVGMAMRFLIVSL  290

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+STE+DDNLTVPL S L GS +F
Sbjct  291  ASALVESLPISTEIDDNLTVPLTSFLVGSLVF  322



>ref|NP_200664.1| farnesol kinase [Arabidopsis thaliana]
 sp|Q67ZM7.2|PHYK2_ARATH RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAD43980.1| unknown protein [Arabidopsis thaliana]
 gb|AED97069.1| farnesol kinase [Arabidopsis thaliana]
Length=307

 Score =   277 bits (709),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  96   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMADI
Sbjct  156  YHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACIYYWKSSPIAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG +E +  M+L FLV+S+
Sbjct  216  VGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVAYMYYFASFGYIEDSGGMILRFLVISI  275

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLT+ L S LAG  +F
Sbjct  276  ASALVESLPISTDIDDNLTISLTSALAGFLLF  307



>ref|XP_010264775.1| PREDICTED: probable phytol kinase 2, chloroplastic, partial [Nelumbo 
nucifera]
Length=271

 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EIAKRG  ++ +NRKLVH+S+G+VF+L WP+FSSG QGA +AAL+PG+NI ++LL+GLGI
Sbjct  60   EIAKRGLLEKTMNRKLVHISIGLVFLLFWPLFSSGPQGAYLAALVPGVNIIRMLLIGLGI  119

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             KD+ TVKSMSR GDYRELLKGPLYYA TITLA  VYWRSSPIAIA +CNLCAGDG+ADI
Sbjct  120  WKDEATVKSMSRSGDYRELLKGPLYYASTITLASVVYWRSSPIAIAAICNLCAGDGVADI  179

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR    KLP+N++KSFAGSIAMA+ GF+ SIG+MHYFS FG L+++  M  GFL+VS 
Sbjct  180  VGRRFGRQKLPYNRDKSFAGSIAMASAGFITSIGYMHYFSLFGLLQESWGMTFGFLIVSS  239

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
               +VES P+S+ELDDNLTVPL S+L GS +F
Sbjct  240  LTXIVESLPISSELDDNLTVPLTSLLVGSLVF  271



>emb|CDY67806.1| BnaA10g29300D [Brassica napus]
Length=303

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 183/213 (86%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSGRQGAL+A+L+PGLNI ++LLLGLG+
Sbjct  91   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGALLASLVPGLNIVRMLLLGLGV  150

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPI+IA++CNLCAGDGMADI
Sbjct  151  YQDEGTIKSMSRHGDRRELLKGPLYYALSITSACFFYWKTSPISIAVICNLCAGDGMADI  210

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVS  229
            +GRR  + KLP+N+NKS AGSI MA  GFLAS+G+M+YF+SFG +E     M+L FL++S
Sbjct  211  VGRRFGTEKLPYNRNKSVAGSIGMAIAGFLASVGYMYYFASFGYMEGIGWDMILRFLIIS  270

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P+ST++DDNLT+PL S L G+ +F
Sbjct  271  VASALVESLPISTDIDDNLTIPLTSALVGTLLF  303



>ref|XP_010089521.1| putative phytol kinase 3 [Morus notabilis]
 gb|EXB37960.1| putative phytol kinase 3 [Morus notabilis]
Length=454

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E AKRG FDQ LNRKLVH+S+G+VFMLCWP+FS G +GA +AA +PG+NI ++LLLGLGI
Sbjct  114  ETAKRGLFDQKLNRKLVHISVGLVFMLCWPLFSPGSRGAFLAASVPGVNIIRMLLLGLGI  173

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             KD+ TVKSMSRFGDYRELLKGPLYYA TITLAC +YWR+S I+IA +CNLCAGDG ADI
Sbjct  174  WKDEATVKSMSRFGDYRELLKGPLYYATTITLACIIYWRTSLISIAAICNLCAGDGSADI  233

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            IGRR  + KLP+N++KS AGSIAMA+ GFLAS+G+M+YFSSFG +E +   VLGF +VSL
Sbjct  234  IGRRFGNRKLPYNRSKSIAGSIAMASGGFLASVGYMYYFSSFGFVEVSWEKVLGFFIVSL  293

Query  225  AAALVESHPLSTELDDNLTVPLASVL  148
            A  LVES P+STELDDNLTVP++S+L
Sbjct  294  ATTLVESLPISTELDDNLTVPVSSIL  319



>ref|XP_006425114.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38354.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=290

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE A+R  FDQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++A+L PG+NI ++LL+G G
Sbjct  78   EETARRDLFDQKLNRKLVHISIGLVFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSG  137

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG AD
Sbjct  138  MWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFAD  197

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVVS
Sbjct  198  VVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVVS  257

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  258  LASALVESLPISTKLDDNLTITITSMAVGSLVF  290



>gb|KDO66965.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=290

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G G
Sbjct  78   EETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSG  137

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG AD
Sbjct  138  MWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFAD  197

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVVS
Sbjct  198  VVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVVS  257

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  258  LASALVESLPISTKLDDNLTLTITSIAVGSLVF  290



>ref|XP_006488562.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Citrus 
sinensis]
Length=293

 Score =   274 bits (701),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G G
Sbjct  81   EETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSG  140

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG AD
Sbjct  141  MWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFAD  200

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            ++GRR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVVS
Sbjct  201  VVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVVS  260

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  261  LASALVESLPISTKLDDNLTLTITSIAVGSLVF  293



>ref|XP_004500292.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR  FDQ LNRKLVH+++G++F+ CWP+FS+ + G+  AA IP +N+ +LL++GLG
Sbjct  91   QETAKRRLFDQKLNRKLVHITIGLLFIFCWPLFSTDKWGSYFAAFIPAVNVLRLLVIGLG  150

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KDD  VKSMSRFGD+RELLKGPLYYA T+T A  +YWR+SPI+IA +CN+CAGDGMAD
Sbjct  151  IWKDDAEVKSMSRFGDHRELLKGPLYYAATLTFASIIYWRTSPISIAAICNMCAGDGMAD  210

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  S K+ +NKNKS+AGSIAMA+ GFLASIGFM YFSSFG +E +   V+GFLVVS
Sbjct  211  IVGRRFGSKKISYNKNKSYAGSIAMASSGFLASIGFMWYFSSFGYMEGSWKHVIGFLVVS  270

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            + A +VES P+ST+LDDNLTVPL S+L GS +
Sbjct  271  IVATVVESLPISTDLDDNLTVPLTSILVGSLV  302



>ref|XP_004500293.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR  FDQ LNRKLVH+++G++F+LCWP+FS+ + G+  AA IP +N+ ++L++GLG
Sbjct  91   QETAKRRLFDQKLNRKLVHITIGLLFILCWPLFSTDKWGSYFAAFIPAVNVLRMLVIGLG  150

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KDD TVKSMSRFGD+RELLKGPLYYA TIT A  +YWR+SPI+IA +CN+CAGDGMAD
Sbjct  151  IWKDDATVKSMSRFGDHRELLKGPLYYAATITFASIIYWRTSPISIAAICNMCAGDGMAD  210

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  S K+ +NKNKS+AGSIAMA+ GFLASIG M YFSSFG +E +   V+GFLVVS
Sbjct  211  IVGRRFGSKKISYNKNKSYAGSIAMASSGFLASIGCMWYFSSFGYMEGSWKHVIGFLVVS  270

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            +   +VES P+ST+LDDNLTVPL S+L GS +
Sbjct  271  IVTTVVESLPISTDLDDNLTVPLTSILVGSLV  302



>ref|XP_002278563.2| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Vitis vinifera]
Length=241

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            IAKRG+  Q ++RK VH+S+G+VFML WP+FSSG +GAL+AALIPG+NI ++LLLGLGI 
Sbjct  31   IAKRGFTGQTVSRKFVHISVGLVFMLFWPLFSSGCRGALLAALIPGVNIIRMLLLGLGIW  90

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KD+  VKSMSR+GD+RELLKGPL YA+ ITLACA+YWR+SPIAIA +CNLCAGDG+AD++
Sbjct  91   KDEAVVKSMSRYGDHRELLKGPLCYALAITLACAIYWRTSPIAIAAICNLCAGDGLADLV  150

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVVSL 
Sbjct  151  GRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVVSLG  210

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + LVES P+S E+DDNLT+P+ S+L G+ +F
Sbjct  211  STLVESLPISNEIDDNLTIPVTSLLLGTLVF  241



>ref|XP_010520844.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=268

 Score =   271 bits (693),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E+ KRG  DQ L RKLVH+++G+VFMLCWP+FS G QGA++A+L+PG+NI ++LLLGLG+
Sbjct  57   EVGKRGILDQTLIRKLVHINIGLVFMLCWPLFSPGLQGAVLASLVPGVNIIRMLLLGLGV  116

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYYA +ITLAC  YWR+SPIAIA++CNLCAGDGMADI
Sbjct  117  YHDEGTIKSMSRHGDRRELLKGPLYYASSITLACVFYWRTSPIAIAVICNLCAGDGMADI  176

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR+ + KLP+N++KS AGSIAMA  GF AS+ +M YF+SFG +E++  M+L FLVVS+
Sbjct  177  VGRRLGTEKLPYNRSKSIAGSIAMATSGFTASVVYMRYFASFGYMEESWGMILRFLVVSI  236

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+A+VES P+ST++DDNLTV L SVL G+ IF
Sbjct  237  ASAVVESLPISTDIDDNLTVSLTSVLLGTFIF  268



>ref|XP_010443595.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=303

 Score =   272 bits (695),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG+FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  92   EIGKRGFFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRVLLLGLGV  151

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP+AIA++CNLCAGDGMADI
Sbjct  152  YHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPVAIAVICNLCAGDGMADI  211

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG ++ +  M+L F V+S+
Sbjct  212  VGRRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIKDSVGMILRFAVISI  271

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  272  ASALVESLPISTDIDDNLTISLTSALVGVLLF  303



>ref|XP_010503534.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=242

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 179/213 (84%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRG-YFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EI KRG  FDQ L RK VH+++G+VF+LCWP+FSSG QGAL A+++ GLNI ++LLLGLG
Sbjct  30   EIGKRGGIFDQKLIRKFVHINIGLVFLLCWPLFSSGIQGALFASIVTGLNIIRMLLLGLG  89

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+GT+KSMSR GD RELLKGPLYYA++ITLAC V+W++SPI+IA++CNLCAGDGMAD
Sbjct  90   VYHDEGTIKSMSRHGDRRELLKGPLYYALSITLACIVFWKTSPISIAVICNLCAGDGMAD  149

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+ + +LP+N+NKSFAGSI M   GFLAS+G+M+YF+SFG +E +  M+L F V+S
Sbjct  150  IVGRRLGTVRLPYNRNKSFAGSIGMVTAGFLASVGYMYYFASFGYIEVSVGMILRFAVIS  209

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  210  IASALVESLPISTQIDDNLTISLTSALVGILLF  242



>ref|XP_010453909.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=307

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG+FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  96   EIGKRGFFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRVLLLGLGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP+AIA++CNLCAGDGMADI
Sbjct  156  YHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPVAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG ++ +  M+L F V+S+
Sbjct  216  VGRRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIKDSVGMILRFAVISI  275

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  276  ASALVESLPISTDIDDNLTISLTSALVGVLLF  307



>ref|XP_006401067.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
 gb|ESQ42520.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
Length=308

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  96   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGLQGALFASLVPGLNIIRMLLLGLGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             KD+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPIAIA++CNLCAGDGMADI
Sbjct  156  YKDEGTIKSMSRHGDRRELLKGPLYYALSITSACIFYWKTSPIAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLVVS  229
            +GRR+ + KLP+N+NKS AGSI MA  GFLAS+G+M+YF+SFG +E +   M+L F ++S
Sbjct  216  VGRRLGTEKLPYNRNKSVAGSIGMAIAGFLASVGYMYYFASFGYIENSGGAMILRFFIIS  275

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ +VES P+ST++DDNLT+ L S L G+ +F
Sbjct  276  IASTIVESLPISTDIDDNLTISLTSALVGTILF  308



>ref|XP_010483456.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=304

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KR +FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  93   EIGKRRFFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRMLLLGLGV  152

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP+AIA++CNLCAGDGMADI
Sbjct  153  YHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPVAIAVICNLCAGDGMADI  212

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L F V+S+
Sbjct  213  VGRRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIEDSVGMILRFAVISI  272

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  273  ASALVESLPISTDIDDNLTISLTSALVGVLLF  304



>gb|KEH28892.1| phytol kinase [Medicago truncatula]
Length=239

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
             E +KRG FDQ L+RKLVH+S G++FMLCWP+FS+ R  +  AAL PG+ + ++L+  LG
Sbjct  27   RETSKRGLFDQKLHRKLVHISFGLLFMLCWPLFSNDRWASCYAALAPGVYMCRILVTKLG  86

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+  VKS+SR GDYR+LL+G LYY  TI  A  +YWR+SP++IA +CNLCAGDGMAD
Sbjct  87   IYKDEAIVKSLSRIGDYRQLLRGSLYYVATIVFASIIYWRTSPVSIAAICNLCAGDGMAD  146

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKS+AGSIAMA+ GFLASIG+M YFS FG +E+    V+GFLVVS
Sbjct  147  IVGRRFGGKKLPYNKNKSYAGSIAMASAGFLASIGYMWYFSLFGYMEEGWSKVIGFLVVS  206

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +  A+VESHP+ST+LDDNLTVPL S+L GS +F
Sbjct  207  VITAVVESHPISTDLDDNLTVPLTSILVGSMVF  239



>ref|XP_006847435.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
 gb|ERN09016.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
Length=241

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+AKRG FDQ LNRKLVH+S+G+VFML WP+FSSG + A +AAL PG+NI +++LLGLG
Sbjct  29   DEMAKRGVFDQKLNRKLVHISVGLVFMLFWPLFSSGHEAAYLAALAPGINIIRMILLGLG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+K++  VKSMSR+GD+RELLKGPLYYA TITLA AV+WR+SPIA+A +CNLC+GDG AD
Sbjct  89   IMKNENMVKSMSRYGDHRELLKGPLYYACTITLATAVFWRTSPIAVAAICNLCSGDGFAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  + KLP+N NKSF GSI MA  GF+ASIG+M+YFS FG    +  +V GF +VS
Sbjct  149  IVGRRFGTLKLPYNMNKSFMGSITMAVAGFMASIGYMYYFSLFGFYNASWDLVTGFFLVS  208

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LAA++VES P+ST+LDDNLTVPL S++ G  IF
Sbjct  209  LAASIVESLPISTKLDDNLTVPLTSLIVGWLIF  241



>ref|XP_010689412.1| PREDICTED: probable phytol kinase 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score =   270 bits (690),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E  AK G FD  LNRKLVH S+G+VFMLCWP+FSSG +GAL+A+LIPG+NI ++LL+G G
Sbjct  96   EVTAKYGVFDSKLNRKLVHTSIGIVFMLCWPLFSSGYRGALLASLIPGVNIIRMLLIGSG  155

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSR+GDYRELLKGPLYY ++IT AC V+WR+SPI IA + NLCAGDG+AD
Sbjct  156  IYKDEATVKSMSRYGDYRELLKGPLYYVLSITFACIVFWRTSPIGIAAISNLCAGDGLAD  215

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+   KLP+NK KS+AG+I+MA  GF+AS+ +MHYFS FG ++++  +VL FL VS
Sbjct  216  IVGRRLGKHKLPYNKTKSYAGTISMATAGFVASVAYMHYFSLFGFMQQSWDLVLRFLFVS  275

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + ++LVES P+ST+LDDNLTVPLAS L G  +F
Sbjct  276  IISSLVESLPISTQLDDNLTVPLASFLVGGLVF  308



>gb|KEH28894.1| phytol kinase [Medicago truncatula]
Length=239

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG  D  L RKLVH S G+ FMLCWP+FS+ R  +  A L+PG+ +F++L+  LG
Sbjct  27   QETAKRGLIDHKLQRKLVHTSFGLAFMLCWPLFSNDRWASFFAVLVPGVYMFRILVTELG  86

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+  VKS+SRFGDYR LL G LYYA TIT A  +YWR+SP++IA +CNLCAGDGMAD
Sbjct  87   IYKDEAIVKSLSRFGDYRVLLMGSLYYAATITFASIIYWRTSPVSIAAICNLCAGDGMAD  146

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKS+AGSIAMA+ GFLASIG+M YFS FG +E     V+GFLVVS
Sbjct  147  IVGRRFGGKKLPYNKNKSYAGSIAMASAGFLASIGYMWYFSLFGYMEGGWSKVIGFLVVS  206

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + +A+VESHP+ST+LDDNLTVPL S+L GS +F
Sbjct  207  VISAVVESHPISTDLDDNLTVPLTSILVGSTVF  239



>ref|XP_006280848.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
 gb|EOA13746.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
Length=307

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  96   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRMLLLGLGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP AIA++CNLCAGDGMADI
Sbjct  156  YHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPTAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR+ + KLP+N+NKSFAGSI MA  GF+AS+G+M+YF+SFG +E +  M+L F ++S+
Sbjct  216  MGRRLGTEKLPYNRNKSFAGSIGMATAGFIASVGYMYYFASFGYIEDSGGMILRFAIISI  275

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  276  ASALVESLPISTDIDDNLTISLTSALVGILLF  307



>gb|KCW54677.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=227

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 168/213 (79%), Gaps = 14/213 (7%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALIPG+NI ++LLLG G
Sbjct  29   EETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALIPGVNIIRMLLLGSG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA +CNLCAGDG AD
Sbjct  89   IWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAAICNLCAGDGFAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            IIGRR+   K+P+N+NKS AGSIAM   GFLAS+G+               M  GFLVVS
Sbjct  149  IIGRRLGQHKIPYNRNKSLAGSIAMGCAGFLASLGW--------------EMASGFLVVS  194

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVESHPLS+ LDDNLTVPL   L GS +F
Sbjct  195  LASALVESHPLSSRLDDNLTVPLTCALVGSLVF  227



>ref|XP_009132278.1| PREDICTED: LOW QUALITY PROTEIN: probable phytol kinase 2, chloroplastic 
[Brassica rapa]
Length=269

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 176/213 (83%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VF LCWP+FSSG QGAL A+LI G+NI ++LLLGLG+
Sbjct  57   EIGKRGIFDQKLIRKLVHINIGLVFTLCWPLFSSGLQGALFASLIIGVNIIRMLLLGLGV  116

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             +D+GT+KSMSR GD RELLKGPLYYAI +TLAC  YW++SPIAIA+VCNLCAGDGMADI
Sbjct  117  YQDEGTIKSMSRHGDRRELLKGPLYYAIAVTLACIFYWKTSPIAIAVVCNLCAGDGMADI  176

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVS  229
            +GRR+ + KLP+N+NK+ AGSI MA  GFLAS+ +M+YF+SFG ++ +   M+  F ++S
Sbjct  177  VGRRLGTKKLPYNRNKTIAGSIGMAIAGFLASVAYMYYFASFGYIKNSGWDMMPRFFIIS  236

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P+ST +DDNLTV L S L G+ +F
Sbjct  237  IASALVESLPISTAIDDNLTVSLTSALLGTLLF  269



>emb|CBI15916.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            IAKRG+  Q ++RK VH+S+G+VFML WP+FSSG +GAL+AALIPG+NI ++LLLGLGI 
Sbjct  83   IAKRGFTGQTVSRKFVHISVGLVFMLFWPLFSSGCRGALLAALIPGVNIIRMLLLGLGIW  142

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KD+  VKSMSR+GD+RELLKGPL YA+ ITLACA+YWR+SPIAIA +CNLCAGDG+AD++
Sbjct  143  KDEAVVKSMSRYGDHRELLKGPLCYALAITLACAIYWRTSPIAIAAICNLCAGDGLADLV  202

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVVSL 
Sbjct  203  GRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVVSLG  262

Query  222  AALVESHPLSTELDDNLTVPLASVL  148
            + LVES P+S E+DDNLT+P+ S+L
Sbjct  263  STLVESLPISNEIDDNLTIPVTSLL  287



>ref|XP_009420002.1| PREDICTED: probable phytol kinase 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q LNRKLVH+S+G+VF+L WP+FSSG Q  L+AAL PG+NI ++LLLG G
Sbjct  86   EELAKRGVFEQKLNRKLVHISIGLVFLLFWPLFSSGSQAPLLAALAPGINIIRMLLLGSG  145

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I K+D  VKS+SR GDYRELLKGPLYYA TIT A  ++WR+SPIAIA +CNLCAGDGMAD
Sbjct  146  IWKNDAMVKSISRHGDYRELLKGPLYYACTITFATWLFWRTSPIAIAAICNLCAGDGMAD  205

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KL +N NKSFAGS+ M   GFLAS+G+MHY+ +FG +E++  M++ F VVS
Sbjct  206  IVGRRFGRKKLFYNHNKSFAGSVTMTLAGFLASVGYMHYYHTFGFIEESWGMIIRFFVVS  265

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+STE+DDNLTVP+ S+L G  +F
Sbjct  266  LASALVESLPISTEVDDNLTVPVTSLLVGGLVF  298



>ref|XP_009132038.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=309

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 179/213 (84%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VF+LCWP+FSSG QGAL A+LIPGLNI ++LLLGLG+
Sbjct  97   EIGKRGIFDQKLIRKLVHINIGLVFILCWPLFSSGLQGALFASLIPGLNIIRMLLLGLGV  156

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             +D+GT+KSMSR GD RELLKGP YYA++IT AC  YW++SPIAIA+VCNLCAGDGMADI
Sbjct  157  YQDEGTIKSMSRHGDRRELLKGPFYYALSITSACIFYWKTSPIAIAVVCNLCAGDGMADI  216

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVS  229
            +GRR+ + KLP+N+NKS AGS+ MA  GFLAS+ +M+YF+SFG ++ +   M+L F ++S
Sbjct  217  VGRRLGTKKLPYNRNKSVAGSVGMAISGFLASVAYMYYFASFGYIKNSGWDMILRFFIIS  276

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P+ST++DDNLTV L S L G+ +F
Sbjct  277  IASALVESLPISTDIDDNLTVSLTSALVGTLLF  309



>emb|CDY70799.1| BnaAnng35070D [Brassica napus]
Length=309

 Score =   265 bits (677),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VF+LCWP+FSSG QGA  A+LIPGLNI ++LLLGLG+
Sbjct  97   EIGKRGIFDQKLIRKLVHINIGLVFILCWPLFSSGLQGAFFASLIPGLNIIRMLLLGLGV  156

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
             +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPIAIA+VCNLCAGDGMADI
Sbjct  157  YQDEGTIKSMSRHGDRRELLKGPLYYALSITSACIFYWKTSPIAIAVVCNLCAGDGMADI  216

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPH-MVLGFLVVS  229
            +GRR+ + KLP+N+NK+ AGSI MA  GFLAS+ +M YF+SFG +E +   M+L F ++S
Sbjct  217  VGRRLGTKKLPYNRNKTIAGSIGMAISGFLASVAYMFYFASFGYIESSGWGMILRFFIIS  276

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P+ST++DDNLTV L S L G+ +F
Sbjct  277  VASALVESLPISTDIDDNLTVSLTSALVGTLLF  309



>gb|KFK27385.1| hypothetical protein AALP_AA8G375800 [Arabis alpina]
Length=308

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 176/213 (83%), Gaps = 1/213 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLG G+
Sbjct  96   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGLQGALFASLVPGLNIIRMLLLGFGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELL GPLYYA++IT AC  YW++SPIAIA++CNLCAGDGMADI
Sbjct  156  YHDEGTIKSMSRHGDRRELLTGPLYYALSITSACIFYWKTSPIAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLVVS  229
            +GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG ++ +   M+L F ++S
Sbjct  216  VGRRFGTEKLPYNKNKSFAGSIGMAIAGFLASVLYMYYFASFGYIKDSGADMILRFFIIS  275

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + +ALVES P+ST++DDNLT+ L S L G+ +F
Sbjct  276  IISALVESLPISTDIDDNLTISLTSALVGTLLF  308



>gb|EPS57827.1| hypothetical protein M569_16990, partial [Genlisea aurea]
Length=253

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E+ AK G  DQ LNRKLVH+++G  FMLCWPMFS G QGAL AALIP  ++ K+ L+GLG
Sbjct  50   EKTAKMG-VDQKLNRKLVHITVGSTFMLCWPMFSVGNQGALFAALIPIASMIKVGLIGLG  108

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+ TVKSMSR+GD+RELLKGPLYY  TI L+  +YW+  PIAIA +CNLCAGDGMAD
Sbjct  109  IWKDEATVKSMSRYGDHRELLKGPLYYGATIALSGIIYWKKLPIAIAAICNLCAGDGMAD  168

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+N+NKS  GS+AMA+ GFLASIG+M YFS  G  E +  M  GFL+VS
Sbjct  169  IVGRRFGRTKLPYNENKSLVGSLAMASAGFLASIGYMWYFSMMGYFEGSREMGFGFLMVS  228

Query  228  LAAALVESHPLSTELDDNLTVPLAS  154
            +AAALVESHP+ST LDDNLTVPL S
Sbjct  229  IAAALVESHPVSTMLDDNLTVPLTS  253



>ref|XP_010412644.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=265

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = -2

Query  765  EIAKRG-YFDQNLNRKLVHVSMGMVFMLCW-PMFSSGRQGALVAAlipglnifkllllgl  592
            EI KRG  FDQ L RKLVH+++G+VF+LCW P+FSSG QGAL A+++PGLNI ++LLLGL
Sbjct  52   EIGKRGGIFDQKLIRKLVHINIGLVFLLCWRPLFSSGIQGALFASIVPGLNILRMLLLGL  111

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYYA++ITLAC  +W++SPI+IA++CNLCAGDGMA
Sbjct  112  GVYHDEGTIKSMSRHGDRRELLKGPLYYALSITLACIFFWKTSPISIAVICNLCAGDGMA  171

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + +LP+N+NKSFAGSI M   GFLAS+G+M+YF+SFG +E +  M+L F V+
Sbjct  172  DIVGRRFGTERLPYNRNKSFAGSIGMVTAGFLASVGYMYYFASFGYIEVSVGMILRFAVI  231

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ LVES P+ST++DDNLT+ L S   G  +F
Sbjct  232  SIASTLVESLPISTQIDDNLTISLTSAFVGILLF  265



>ref|XP_006425113.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38353.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=284

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 172/213 (81%), Gaps = 6/213 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE A+R  FDQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++A+L PG+NI ++LL+G G
Sbjct  78   EETARRDLFDQKLNRKLVHISIGLVFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSG  137

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG   
Sbjct  138  MWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDG---  194

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
               RR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVVS
Sbjct  195  ---RRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVVS  251

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  252  LASALVESLPISTKLDDNLTITITSMAVGSLVF  284



>ref|XP_010650879.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Vitis vinifera]
Length=229

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -2

Query  732  LNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMS  553
            ++RK VH+S+G+VFML WP+FSSG +GAL+AALIPG+NI ++LLLGLGI KD+  VKSMS
Sbjct  29   VSRKFVHISVGLVFMLFWPLFSSGCRGALLAALIPGVNIIRMLLLGLGIWKDEAVVKSMS  88

Query  552  RFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLP  373
            R+GD+RELLKGPL YA+ ITLACA+YWR+SPIAIA +CNLCAGDG+AD++GRR    K+P
Sbjct  89   RYGDHRELLKGPLCYALAITLACAIYWRTSPIAIAAICNLCAGDGLADLVGRRFGIQKIP  148

Query  372  HNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLS  193
            +N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVVSL + LVES P+S
Sbjct  149  YNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVVSLGSTLVESLPIS  208

Query  192  TELDDNLTVPLASVLAGSCIF  130
             E+DDNLT+P+ S+L G+ +F
Sbjct  209  NEIDDNLTIPVTSLLLGTLVF  229



>ref|XP_008811675.1| PREDICTED: probable phytol kinase 2, chloroplastic [Phoenix dactylifera]
Length=299

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q LNRKLVH+S+G+ FML WP+FSSG Q   +AAL PG+N  ++LL+GLG
Sbjct  87   EELAKRGVFEQKLNRKLVHISIGLAFMLFWPLFSSGSQAPYLAALAPGINAIRMLLMGLG  146

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I ++D  VKS+SR GDYRELLKGPLYYA TITLA +V+WR+SPI IA +CNLCAGDG+AD
Sbjct  147  IWRNDAMVKSISRNGDYRELLKGPLYYACTITLATSVFWRTSPIGIAAICNLCAGDGVAD  206

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+N NKSFAGS+AM   GF+AS+G+MHY+ SFG + ++  M L F  VS
Sbjct  207  IVGRRFGRHKLPYNPNKSFAGSLAMVFAGFIASVGYMHYYHSFGFVNESWDMALRFFFVS  266

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LAAA VES P+S+ELDDNLTVP  S+L    +F
Sbjct  267  LAAAFVESLPISSELDDNLTVPFTSLLFSGLVF  299



>gb|KCW57521.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
 gb|KCW57522.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=187

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            MLCWP+FSSG + AL+AA +PGLNI ++LL+G GI KD+  VKSMSRFGD+RELLKGPLY
Sbjct  1    MLCWPLFSSGHRSALLAATVPGLNIIRVLLVGSGIWKDEAIVKSMSRFGDHRELLKGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA TIT ACA YW++SPIAIA +CNLCAGDG ADIIGRR    KLP+N NKSFAGSIAMA
Sbjct  61   YASTITFACAYYWKTSPIAIAAICNLCAGDGFADIIGRRFGHHKLPYNSNKSFAGSIAMA  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
            + GFLAS+GFM YFSSFG ++ +  MV GFL+VSLA+ALVESHPLS+ELDDNLTVPL S+
Sbjct  121  SAGFLASLGFMSYFSSFGYIQGSWEMVSGFLMVSLASALVESHPLSSELDDNLTVPLTSM  180

Query  150  LAGSCIF  130
            L GS +F
Sbjct  181  LVGSLVF  187



>ref|XP_010910062.1| PREDICTED: probable phytol kinase 2, chloroplastic [Elaeis guineensis]
Length=307

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 168/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE+AKRG F+Q LNRKLVH+S+G+ FML WP+FSSG +   +AA+ PG+N  +++L+GLG
Sbjct  95   EELAKRGVFEQKLNRKLVHISIGLAFMLFWPLFSSGSRAPFLAAVAPGINAIRMVLMGLG  154

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            IL++D  VKSMSR GDYRELLKGP YYA TITLA +++WR+SPI IA +CNLCAGDGMAD
Sbjct  155  ILRNDAMVKSMSRHGDYRELLKGPFYYACTITLATSIFWRTSPIGIAAICNLCAGDGMAD  214

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            IIGRR    KLP+N NKS AGS+AM   GF+AS+G+MHYF SFG + ++  M + F  VS
Sbjct  215  IIGRRFGHHKLPYNPNKSIAGSLAMVFAGFIASVGYMHYFHSFGFVNESWGMAMRFFFVS  274

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LAAA VES P+S++LDDNLTVP  S+L    +F
Sbjct  275  LAAAFVESLPISSQLDDNLTVPFTSLLFAGLVF  307



>ref|XP_010426391.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=240

 Score =   254 bits (650),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 175/213 (82%), Gaps = 3/213 (1%)
 Frame = -2

Query  765  EIAKRG-YFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EI KRG  FDQ L RK VH+++G+VF+LCWP+FS G QGAL A+++PGLNI ++LLLGLG
Sbjct  30   EIGKRGGIFDQKLIRKFVHINIGLVFLLCWPLFSYGIQGALFASIVPGLNILRMLLLGLG  89

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + +D+GT+KSMSR GD RELLKGPLYYA++ITLAC  +W++SPI+IA++CNLCAGDGMAD
Sbjct  90   VYQDEGTIKSMSRHGDRRELLKGPLYYALSITLACIFFWKTSPISIAVICNLCAGDGMAD  149

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR  + +LP+N+NKSFAGSI M   GFLAS+ +M+YF+SFG +E +  M+L F V+S
Sbjct  150  IVGRRFGTERLPYNRNKSFAGSIGMVTVGFLASVVYMYYFASFGYIEVSVGMILRFAVIS  209

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +A+ALVES P  T++DDNLT+ L S L G  +F
Sbjct  210  IASALVESLP--TDIDDNLTISLTSALVGFLLF  240



>emb|CDY65783.1| BnaA03g56270D [Brassica napus]
Length=321

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 179/225 (80%), Gaps = 13/225 (6%)
 Frame = -2

Query  765  EIAKRGYFDQ------------NLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipgl  622
            EI KRG FDQ             L RKLVH+++G+VF+LCWP+FSSG QGAL A+LIPGL
Sbjct  97   EIGKRGIFDQYVLSDLGLKQNIKLIRKLVHINIGLVFILCWPLFSSGLQGALFASLIPGL  156

Query  621  nifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALV  442
            NI ++LLLGLG+ +D+GT+KSMSR GD RELLKGP YYA++IT AC  YW++SPIAIA+V
Sbjct  157  NIIRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPFYYALSITSACIFYWKTSPIAIAVV  216

Query  441  CNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT  262
            CNLCAGDGMADI+GRR+ + KLP+N+NKS AGS+ MA  GFLAS+ +M+YF+SFG ++ +
Sbjct  217  CNLCAGDGMADIVGRRLGTKKLPYNRNKSVAGSVGMAISGFLASVAYMYYFASFGYIKNS  276

Query  261  P-HMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
               M+L F ++S+A+ALVES P+ST++DDNLTV L S L G+ +F
Sbjct  277  GWDMILRFFIISIASALVESLPISTDIDDNLTVSLTSALVGTLLF  321



>emb|CDY65781.1| BnaA03g56250D [Brassica napus]
Length=263

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 168/201 (84%), Gaps = 1/201 (0%)
 Frame = -2

Query  729  NRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSR  550
             RKLVH+++G+VF LCWP+FSSG QGAL A+LI G+NI ++LLLGLG+ +D+GT+KSMSR
Sbjct  63   TRKLVHINIGLVFTLCWPLFSSGLQGALFASLIIGVNIIRMLLLGLGVYQDEGTIKSMSR  122

Query  549  FGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPH  370
             GD RELLKGPLYYAI +TLAC  YW++SPIAIA+VCNLCAGDG+ADI+GRR+ + KLP+
Sbjct  123  HGDRRELLKGPLYYAIAVTLACIFYWKTSPIAIAVVCNLCAGDGVADIVGRRLGTKKLPY  182

Query  369  NKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVSLAAALVESHPLS  193
            N+NK+ AGSI MA  GFLAS+ +M+YF+SFG +E +   M+L F ++S+A+ALVES P+S
Sbjct  183  NRNKTIAGSIGMAIAGFLASVAYMYYFASFGYIESSGWDMILRFFIISIASALVESLPIS  242

Query  192  TELDDNLTVPLASVLAGSCIF  130
            T +DDNLTV L S L G+ +F
Sbjct  243  TAIDDNLTVSLTSALLGTLLF  263



>gb|AFW84692.1| hypothetical protein ZEAMMB73_467064 [Zea mays]
Length=187

 Score =   243 bits (619),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            ML WP+FSSG     +AAL PG+NI ++LLLGLG++K++  VKSMSR GDYRELLKGPLY
Sbjct  1    MLFWPLFSSGWYTPFLAALAPGVNIIRMLLLGLGLMKNEAMVKSMSRSGDYRELLKGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA TIT A ++ WR+SP+AIAL+CNLCAGDG+AD++GRR+   KLP+N NKS+AGSIAMA
Sbjct  61   YAATITFATSLLWRTSPVAIALICNLCAGDGIADVVGRRLGKEKLPYNPNKSYAGSIAMA  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
              GFLAS+G+MHYF +FG +E+T +M L FLVVS+AAALVESHP+STELDDNLTVPL S 
Sbjct  121  VAGFLASVGYMHYFHTFGFIEETWYMALSFLVVSVAAALVESHPISTELDDNLTVPLTSF  180

Query  150  LAGSCIF  130
            L GS IF
Sbjct  181  LVGSLIF  187



>gb|KCW54683.1| hypothetical protein EUGRSUZ_I00622 [Eucalyptus grandis]
Length=187

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            MLCWP+FSS  +GAL+AA IPG NI ++LL+G GI KD+ TVKSMSRFGD RELL+GPLY
Sbjct  1    MLCWPLFSSEHRGALLAATIPGFNIIRMLLVGSGIWKDEATVKSMSRFGDRRELLEGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y + IT ACA YWR+SP+AIA +CNLCAGDG ADIIGR+    K+P+N NKS AGSIAM 
Sbjct  61   YVLMITFACAYYWRTSPVAIAAICNLCAGDGFADIIGRQFGQHKIPYNPNKSVAGSIAMT  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
            + GFLAS+GF+ YFSSFG ++ +  MV GFL+VS A+ALVESHPLS+++DDNLTVPLA  
Sbjct  121  SAGFLASLGFLSYFSSFGYIQGSWEMVGGFLMVSFASALVESHPLSSQIDDNLTVPLACA  180

Query  150  LAGSCIF  130
            L GS +F
Sbjct  181  LVGSLVF  187



>ref|XP_002442649.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
 gb|EES16487.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
Length=274

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+A R   DQ L RKLVH+++G+V+ L WP+FS     A  +A LI  +NI K+ ++GL
Sbjct  29   EEVANRALLDQKLCRKLVHITVGLVYFLMWPLFSPDDVFAPFLAPLIIVINIIKVTVIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++KD+G + SM+R GD+RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GLVKDEGVINSMTRHGDHRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YFS FG +EK+  MV  F V+
Sbjct  149  DIFGRRFGHVKLPHNPEKSYAGSIAMFLAGFVASVMFMCYFSIFGFVEKSWTMVAAFGVI  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL AA+VES P+ST LDDNLTVP+ASVL G+ +F
Sbjct  209  SLVAAVVESLPISTRLDDNLTVPVASVLLGALVF  242



>ref|XP_002864581.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40840.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KR   DQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  91   EIGKRDLLDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRMLLLGLGV  150

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW+SSPIAIA++CNLCAGDGMADI
Sbjct  151  YHDEGTIKSMSRHGDRRELLKGPLYYALSITSACIFYWKSSPIAIAVICNLCAGDGMADI  210

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  + KLP+NKNKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L FL++SL
Sbjct  211  VGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVGYMYYFASFGYIEDSGGMILRFLIISL  270

Query  225  AAALV  211
            A+ALV
Sbjct  271  ASALV  275



>ref|XP_004977649.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=285

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+ ++GL
Sbjct  29   EEVASRALLDQKLCRKLVHITVGLVYFLMWPLFSSDDVYAPFLAPLIFVINIVKVTVIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++KD+G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GVVKDEGVVNSMTRHGDCRELLKGPLYYACAITLTTMVFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLPHN  KS+AGSIA    GF+AS+ FM YF+ FG ++K+  MV  F VV
Sbjct  149  DIVGRRFGQVKLPHNPEKSYAGSIANFMAGFIASVRFMCYFNIFGFVDKSWAMVGAFGVV  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA+VES P+ST LDDNLTVPLASVL G+ +F
Sbjct  209  SLAAAVVESLPISTRLDDNLTVPLASVLVGALVF  242



>gb|EMT05708.1| Putative phytol kinase 2, chloroplastic [Aegilops tauschii]
Length=261

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 145/212 (68%), Gaps = 30/212 (14%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E   +  F + LNRKLVH+++GMVF+L WP+FS                           
Sbjct  80   ESGDQRLFGKKLNRKLVHITIGMVFLLFWPLFSIS-------------------------  114

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
                    + + +   RELLKGPLYYA TITLA +V WR+SPIAIALVCNLCAGDG+AD+
Sbjct  115  -----VFSTNALYSSGRELLKGPLYYATTITLATSVLWRTSPIAIALVCNLCAGDGIADV  169

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR    KLP+N NKS+AGSIAMA  GFLASIG+MHYF SFG +E++ +M LGFLVVS+
Sbjct  170  VGRRFGKEKLPYNPNKSYAGSIAMAVAGFLASIGYMHYFHSFGLMEESWYMTLGFLVVSV  229

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AAALVESHP+ST+LDDNLTVPL S L GS + 
Sbjct  230  AAALVESHPISTDLDDNLTVPLTSFLVGSLVL  261



>ref|XP_004977648.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=285

 Score =   236 bits (601),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+ ++GL
Sbjct  29   EEVASRALLDQKLCRKLVHITVGLVYFLMWPLFSSDDVYAPFLAPLIFVINIVKVTVIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++KD+G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GVVKDEGVVNSMTRHGDCRELLKGPLYYACAITLTTMVFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLPHN  KS+AGSIA    GF+AS+ FM YF+ FG ++K+  MV  F VV
Sbjct  149  DIVGRRFGQVKLPHNPEKSYAGSIANFMAGFIASVLFMCYFNIFGFVDKSWAMVGAFGVV  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA+VES P+ST LDDNLTVPLASVL G+ +F
Sbjct  209  SLAAAVVESLPISTRLDDNLTVPLASVLVGALVF  242



>ref|NP_001065534.2| Os11g0105800 [Oryza sativa Japonica Group]
 gb|ABA91069.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG99032.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68691.1| hypothetical protein OsI_37159 [Oryza sativa Indica Group]
 gb|EEE52600.1| hypothetical protein OsJ_34917 [Oryza sativa Japonica Group]
 dbj|BAF27379.2| Os11g0105800 [Oryza sativa Japonica Group]
Length=274

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+L+   NI K+ L+GL
Sbjct  30   EEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASLVIAFNIIKVTLIGL  89

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+KDDG + SM+R GD RELLKGPLYYA  ITLA  ++WR+SPI+IA++CNLCAGDG+A
Sbjct  90   GIVKDDGVINSMTRNGDRRELLKGPLYYACAITLATVIFWRTSPISIAVICNLCAGDGVA  149

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GRR    KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V 
Sbjct  150  DIAGRRFGHVKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWSMVIAFGVT  209

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA+VES P+ST LDDNLTVPLASVL G  +F
Sbjct  210  SLAAAIVESLPISTRLDDNLTVPLASVLVGVLVF  243



>gb|AFW84693.1| hypothetical protein ZEAMMB73_467064 [Zea mays]
Length=160

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K++  VKSMSR GDYRELLKGPLYYA TIT A ++ WR+SP+AIAL+CNLCAGDG+AD++
Sbjct  10   KNEAMVKSMSRSGDYRELLKGPLYYAATITFATSLLWRTSPVAIALICNLCAGDGIADVV  69

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR+   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M L FLVVS+A
Sbjct  70   GRRLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALSFLVVSVA  129

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AALVESHP+STELDDNLTVPL S L GS IF
Sbjct  130  AALVESHPISTELDDNLTVPLTSFLVGSLIF  160



>ref|XP_004978591.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=276

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+L++GL
Sbjct  29   EEVANRALLDQTLCRKLVHITVGLVYFLMWPLFSSDDVYAPFLAPLIIVVNIIKVLVIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++KDDG V SM+R GD RELLKGPLYYA  ITL    +WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GVVKDDGVVNSMTRHGDCRELLKGPLYYACAITLTTIAFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLPHN  KS+AGSIA    GF+AS+ FM YF+ FG ++K+  MV  F V+
Sbjct  149  DIVGRRFGQVKLPHNPEKSYAGSIANFMAGFIASVLFMCYFNIFGFVDKSWAMVGAFGVI  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA VES P+ST LDDNLTVPLASVL G+ +F
Sbjct  209  SLAAAAVESLPISTRLDDNLTVPLASVLVGALVF  242



>gb|KJB20421.1| hypothetical protein B456_003G147500 [Gossypium raimondii]
Length=160

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KD+ TVKSMSR+G+YRELLKGPLYYAIT+TLAC VYWR+SPI IA +CNLCAGDG+AD++
Sbjct  10   KDEATVKSMSRYGNYRELLKGPLYYAITVTLACVVYWRTSPIGIAALCNLCAGDGLADVV  69

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR+   KLP+N+NKS AGS+AMA  GFL+S+G+M+YFS FG ++    M+L FLVVSLA
Sbjct  70   GRRLGRKKLPYNRNKSIAGSVAMATAGFLSSVGYMYYFSYFGYIQDGWGMILRFLVVSLA  129

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +ALVES P+STELDDNLTV L S+  GS IF
Sbjct  130  SALVESLPISTELDDNLTVSLTSIFIGSLIF  160



>ref|XP_008676758.1| PREDICTED: uncharacterized protein LOC100272684 isoform X1 [Zea 
mays]
 gb|AFW64551.1| phytol kinase 2 [Zea mays]
Length=273

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EEIA R   DQ L RKLVH+++G+VF L WP+FSS    A  +A LI  +NI K+ ++GL
Sbjct  29   EEIANRALLDQKLCRKLVHITVGLVFFLMWPLFSSDDVFAPSLAPLIIIINIMKVTVIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G +K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GFVKAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V+
Sbjct  149  DIAGRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVI  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  209  SLAAAVVESLPISTRLDDNLTVSVASVLVGALVF  242



>ref|XP_002450098.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
 gb|EES09086.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
Length=274

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+ ++GL
Sbjct  29   EEVANRALLDQKLCRKLVHITVGLVYFLMWPLFSSDDAFAPFLAPLILVINIIKVTVIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++KD+G V SM+R GD+RELLKGPLYYA  IT+   V+WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GLVKDEGMVNSMTRHGDHRELLKGPLYYACAITVTTIVFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V+
Sbjct  149  DIFGRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVI  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL AA+VES P+ST LDDNLTVP+ASVL  + +F
Sbjct  209  SLVAAVVESLPISTCLDDNLTVPVASVLFSALVF  242



>gb|ABA95607.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19373.1| hypothetical protein OsJ_34926 [Oryza sativa Japonica Group]
Length=271

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+++   NI K+ L+GL
Sbjct  27   EEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASIVIAFNIIKVTLIGL  86

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+KDDG + SM+R GD RELLKGPLYYA  +TLA  ++WR+SPI+IA++CNLCAGDG+A
Sbjct  87   GIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLATVIFWRTSPISIAVICNLCAGDGVA  146

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GR++   KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V 
Sbjct  147  DIAGRQLGRIKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWTMVIAFGVT  206

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL+AA+VES P+ST LDDNLTVPLASVL G  +F
Sbjct  207  SLSAAIVESLPISTRLDDNLTVPLASVLIGVLVF  240



>gb|EAY81967.1| hypothetical protein OsI_37144 [Oryza sativa Indica Group]
Length=271

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+++   NI K+ L+GL
Sbjct  27   EEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASIVIAFNIIKVTLIGL  86

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+KDDG + SM+R GD RELLKGPLYYA  +TLA  ++WR+SPI+IA++CNLCAGDG+A
Sbjct  87   GIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLATVIFWRTSPISIAVICNLCAGDGVA  146

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GR++   KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V 
Sbjct  147  DIAGRQLGRIKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWTMVIAFGVT  206

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL+AA+VES P+ST LDDNLTVPLASVL G  +F
Sbjct  207  SLSAAIVESLPISTRLDDNLTVPLASVLIGVLVF  240



>ref|NP_001065932.1| Os12g0105500 [Oryza sativa Japonica Group]
 dbj|BAF28951.1| Os12g0105500, partial [Oryza sativa Japonica Group]
Length=280

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+++   NI K+ L+GL
Sbjct  36   EEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASIVIAFNIIKVTLIGL  95

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+KDDG + SM+R GD RELLKGPLYYA  +TLA  ++WR+SPI+IA++CNLCAGDG+A
Sbjct  96   GIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLATVIFWRTSPISIAVICNLCAGDGVA  155

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GR++   KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V 
Sbjct  156  DIAGRQLGRIKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWTMVIAFGVT  215

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL+AA+VES P+ST LDDNLTVPLASVL G  +F
Sbjct  216  SLSAAIVESLPISTRLDDNLTVPLASVLIGVLVF  249



>gb|ACG40052.1| phytol kinase 2 [Zea mays]
Length=273

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 159/214 (74%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EEIA R   DQ L RKLVH+++G+VF L WP+FSS    A  +A LI  +NI K+ ++GL
Sbjct  29   EEIANRALLDQKLCRKLVHITVGLVFFLMWPLFSSDDVFAPSLAPLIIIINIMKVTVIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G +K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GFVKAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GRR    KLPH   KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V+
Sbjct  149  DIAGRRFGHVKLPHXPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVI  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  209  SLAAAVVESLPISTRLDDNLTVSVASVLVGALVF  242



>gb|KCW57523.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=143

 Score =   224 bits (570),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  558  MSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPK  379
            MSRFGD+RELLKGPLYYA TIT ACA YW++SPIAIA +CNLCAGDG ADIIGRR    K
Sbjct  1    MSRFGDHRELLKGPLYYASTITFACAYYWKTSPIAIAAICNLCAGDGFADIIGRRFGHHK  60

Query  378  LPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHP  199
            LP+N NKSFAGSIAMA+ GFLAS+GFM YFSSFG ++ +  MV GFL+VSLA+ALVESHP
Sbjct  61   LPYNSNKSFAGSIAMASAGFLASLGFMSYFSSFGYIQGSWEMVSGFLMVSLASALVESHP  120

Query  198  LSTELDDNLTVPLASVLAGSCIF  130
            LS+ELDDNLTVPL S+L GS +F
Sbjct  121  LSSELDDNLTVPLTSMLVGSLVF  143



>dbj|BAA97326.1| unnamed protein product [Arabidopsis thaliana]
Length=517

 Score =   235 bits (599),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGLG+
Sbjct  96   EIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGLGV  155

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMADI
Sbjct  156  YHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACIYYWKSSPIAIAVICNLCAGDGMADI  215

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG +E +  M+L FLV  +
Sbjct  216  VGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVAYMYYFASFGYIEDSGGMILRFLVGLV  275

Query  225  AAALVESHPLSTELDDN  175
                 ++     E +++
Sbjct  276  TVTAFQTRKQHEEQEED  292



>ref|XP_006662647.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=273

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 160/214 (75%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            E +A R   DQ L RKLVH+++G+V+ L WP FS+    A  +A+++  LNI K+ L+GL
Sbjct  29   ELVANRALLDQKLCRKLVHITVGLVYFLMWPFFSADDVYAPFLASIVIVLNIIKVTLIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+KD+G V SM+R GD RELLKGPLYYA  ITL   ++WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GIVKDEGVVNSMTRNGDCRELLKGPLYYACAITLTTIIFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GRR    KLP+N +KS+AGS+AM   GFLASI +M YF  FG +E++  MV+ F V+
Sbjct  149  DIAGRRFGHAKLPYNPDKSYAGSVAMFLAGFLASIMYMCYFHLFGFVEESWRMVVAFGVI  208

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA+VES P+ST LDDNLTVP+ SV  G  IF
Sbjct  209  SLAAAIVESLPISTRLDDNLTVPVTSVFVGVLIF  242



>ref|XP_003579056.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=276

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllgl  592
            EE+  R   DQ L RKLVH+S G+V+ L WP+FS+    A  +AA++  LNI K++L+GL
Sbjct  29   EEVGNRALLDQKLCRKLVHISAGLVYFLMWPLFSADDVYAPFLAAIVIALNIVKVILIGL  88

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++KD+G V SM+R GD+RELLKGPLYYA  I L   V+WR+SPI+IA++CNLCAGDG+A
Sbjct  89   GVVKDEGVVNSMTRHGDHRELLKGPLYYACAIALTTVVFWRTSPISIAVICNLCAGDGVA  148

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLG-FLV  235
            DI+GRR+   KLPHN++KS+AGS+AM   GF+ASI FM YF  FG +++    V+G F  
Sbjct  149  DIVGRRLGHAKLPHNRDKSYAGSVAMFFAGFVASILFMCYFHLFGFVDELSWAVVGAFGA  208

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             SLAAA+VES P+ST LDDNLTVP+AS L G+  F
Sbjct  209  TSLAAAVVESLPVSTSLDDNLTVPVASALVGALAF  243



>gb|ADE76360.1| unknown [Picea sitchensis]
Length=375

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 155/200 (78%), Gaps = 0/200 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+AKR  FDQ LNRK VH+S+G++FML WP+FS+G Q   +AAL PGLNIF+++ LGLG
Sbjct  163  DEMAKRDVFDQKLNRKFVHISIGLIFMLFWPVFSTGPQAPYLAALAPGLNIFRMIGLGLG  222

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ILK++  VKSMSR G+ RELLKGPLYYA TITL   ++WR SPI    + NLCAGDG AD
Sbjct  223  ILKNEAMVKSMSRHGNARELLKGPLYYASTITLVTVIFWRISPIGPVTISNLCAGDGFAD  282

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR+ + KLP+NKNKSFAGS  M   GF+ S+G++ YF+SFG  E +  M+L  L++S
Sbjct  283  IVGRRLGTVKLPYNKNKSFAGSFTMLLMGFIFSVGYLFYFASFGYYEVSTRMILSSLLIS  342

Query  228  LAAALVESHPLSTELDDNLT  169
            + A +VES P+STELDDNLT
Sbjct  343  IVATVVESLPISTELDDNLT  362



>ref|XP_007016938.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34557.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=250

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKR   DQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AA+ PG+NI ++LL+G G
Sbjct  95   QETAKRRLCDQKLNRKLVHISIGLVFMLCWPLFSSGYRGAILAAITPGVNIIRMLLIGSG  154

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA+YWR+SPIA+A +CNLCAGDG+AD
Sbjct  155  LWKDEATVKSMSRYGDYRELLKGPLYYATTITLACALYWRTSPIAVAAICNLCAGDGIAD  214

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIG  304
            ++GRR    KLP+N NKS AGS+AMA  GFLAS+G
Sbjct  215  VVGRRFGRQKLPYNSNKSIAGSVAMATAGFLASVG  249



>gb|KJB83901.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=248

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G G
Sbjct  94   QETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIIRMILIGSG  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVK+MSR+GDYRELLKGP+YYA TITLACA YWR+SPIAIA +CNLCAGDG AD
Sbjct  154  LWKDEATVKAMSRYGDYRELLKGPVYYATTITLACAFYWRTSPIAIAAICNLCAGDGFAD  213

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIG  304
            I+GR+    KLP+NKNKS AGS+AMA  GFL S+G
Sbjct  214  IVGRQFGGQKLPYNKNKSIAGSVAMAIAGFLTSVG  248



>gb|KDO66964.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=254

 Score =   212 bits (539),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G G
Sbjct  78   EETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSG  137

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG AD
Sbjct  138  MWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFAD  197

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSS-FGQLEK  265
            ++GRR    KLP+N+NKS AGS AMA+ GFL+SIG  H  SS  G+ +K
Sbjct  198  VVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGSRHQVSSAMGKQKK  246



>ref|XP_008805007.1| PREDICTED: probable phytol kinase 2, chloroplastic [Phoenix dactylifera]
Length=186

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            ML WP+FSSG     +AA++PG+NI ++LL+GLGI ++D  VKSMSR GDYRELLKGPLY
Sbjct  1    MLFWPLFSSGSHAPFLAAVVPGINIIRMLLMGLGIWRNDAIVKSMSRHGDYRELLKGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA  +TLA +++WR+SPIAIA +CNLCAGDG+ADI+GRR  S KLP+N NKSFAG+ AM 
Sbjct  61   YACALTLA-SIFWRTSPIAIAAICNLCAGDGVADIVGRRFGSRKLPYNPNKSFAGTFAML  119

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
              G +AS+G+MHY+  FG +E++  M + F  VSLAAA VES P+S++LDDNLTVP  S+
Sbjct  120  FAGLIASVGYMHYYHLFGFVEESWDMAMRFSFVSLAAAFVESLPISSKLDDNLTVPFTSI  179

Query  150  LAGSCIF  130
            L G  +F
Sbjct  180  LVGVLVF  186



>ref|XP_006387376.1| hypothetical protein POPTR_1135s00210g, partial [Populus trichocarpa]
 gb|ERP46290.1| hypothetical protein POPTR_1135s00210g, partial [Populus trichocarpa]
Length=135

 Score =   206 bits (523),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  534  ELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKS  355
            ELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMADI+GRR    K+P+NKNKS
Sbjct  1    ELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMADIVGRRFGRQKIPYNKNKS  60

Query  354  FAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDN  175
             AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVVSLA+A VES P+STELDDN
Sbjct  61   IAGSVAMALSGFVASVGFMYYFASFGYVQKSWEMLLGFLVVSLASAFVESLPISTELDDN  120

Query  174  LTVPLASVLAGSCIF  130
            LTV L S+L G+ +F
Sbjct  121  LTVTLTSILLGNLVF  135



>gb|EYU45411.1| hypothetical protein MIMGU_mgv1a012281mg [Erythranthe guttata]
Length=255

 Score =   206 bits (525),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 3/211 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            ++   +G  + +L RKLVH+SMG++ MLCWPM S GR+  ++  L+P L ++++LL G G
Sbjct  42   KQSYDKGLLNVHLFRKLVHISMGLIIMLCWPMLSCGRRRRILGGLVPVLCMYRVLLAGFG  101

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               +   + S  R+ DYRELLK  L YA+ + LA   + RS+P+AIA + NLCAGDG+AD
Sbjct  102  --TNYKPMDSQGRYRDYRELLKAALGYALAVFLATIFHLRSTPLAIATISNLCAGDGIAD  159

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG-QLEKTPHMVLGFLVV  232
            I GRR  S KLP+NKNKSFAGSI MA  GF +SI FM YFS FG  +  +P+MVLGFL+V
Sbjct  160  IAGRRYGSWKLPYNKNKSFAGSIGMAISGFTSSILFMFYFSWFGYNIRVSPNMVLGFLMV  219

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGS  139
            S+A+ALVESHP ST LDDNLTVPLAS + G+
Sbjct  220  SVASALVESHPWSTRLDDNLTVPLASAVVGT  250



>ref|XP_004977650.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X3 [Setaria italica]
Length=229

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = -2

Query  681  WPMFSSGRQGA-LVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYA  505
            WP+FSS    A  +A LI  +NI K+ ++GLG++KD+G V SM+R GD RELLKGPLYYA
Sbjct  2    WPLFSSDDVYAPFLAPLIFVINIVKVTVIGLGVVKDEGVVNSMTRHGDCRELLKGPLYYA  61

Query  504  ITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAF  325
              ITL   V+WR+SPI+IA++CNLCAGDG+ADI+GRR    KLPHN  KS+AGSIA    
Sbjct  62   CAITLTTMVFWRTSPISIAVICNLCAGDGVADIVGRRFGQVKLPHNPEKSYAGSIANFMA  121

Query  324  GFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASVLA  145
            GF+AS+ FM YF+ FG ++K+  MV  F VVSLAAA+VES P+ST LDDNLTVPLASVL 
Sbjct  122  GFIASVLFMCYFNIFGFVDKSWAMVGAFGVVSLAAAVVESLPISTRLDDNLTVPLASVLV  181

Query  144  GSCIF  130
            G+ +F
Sbjct  182  GALVF  186



>ref|XP_006387375.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
 gb|ERP46289.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
Length=174

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AK G  DQ LNRKLVH+S+G+VFMLCWP+FSSGR+GAL AA  PG+NI ++LL+G G
Sbjct  30   KETAKHG-LDQKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAFTPGVNIIQMLLIGSG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMAD
Sbjct  89   MWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMAD  148

Query  408  IIGRRIRSPKLPHNKNKSFAGSI  340
            I+GRR    K+P+NKNKS AGS+
Sbjct  149  IVGRRFGRQKIPYNKNKSIAGSV  171



>ref|XP_006292344.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
 gb|EOA25242.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
Length=207

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 146/212 (69%), Gaps = 34/212 (16%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            EI KRG  DQ L RKLVH+++G+VF+LCWP+FSSG QGAL A+L+ GLNI ++LLLGLG+
Sbjct  30   EIGKRGILDQKLIRKLVHINIGLVFLLCWPLFSSGIQGALFASLVTGLNIIRMLLLGLGV  89

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
              D+GT+KSM+R GD RELLKGPLYY +                                
Sbjct  90   YHDEGTIKSMTRHGDRRELLKGPLYYVL--------------------------------  117

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
              RR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L F V+S+
Sbjct  118  --RRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIEASGGMILRFAVISI  175

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A+ALVES P+ST++DDNLTV L S L G  +F
Sbjct  176  ASALVESLPISTDIDDNLTVSLTSALVGFLLF  207



>gb|KCW54682.1| hypothetical protein EUGRSUZ_I00621 [Eucalyptus grandis]
Length=191

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 129/166 (78%), Gaps = 14/166 (8%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFS-----------SGRQGALVAAlipgl  622
            EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FS           SG +GAL+AALI G+
Sbjct  29   EETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSLARRLLLINCSSGHRGALLAALILGV  88

Query  621  nifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALV  442
            NI ++LLLG GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA +
Sbjct  89   NIIRMLLLGSGIWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAAM  148

Query  441  CNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIG  304
            CNLCAGD   DIIGRR+   K+P+N+NK  AGSIAM   GFLAS+G
Sbjct  149  CNLCAGD---DIIGRRLGKHKIPYNRNKYLAGSIAMGCAGFLASLG  191



>ref|NP_001140612.1| uncharacterized protein LOC100272684 [Zea mays]
 gb|ACF84174.1| unknown [Zea mays]
 gb|AFW64550.1| hypothetical protein ZEAMMB73_110888 [Zea mays]
Length=193

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI 
Sbjct  12   KAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVADIA  71

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V+SLA
Sbjct  72   GRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVISLA  131

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  132  AAVVESLPISTRLDDNLTVSVASVLVGALVF  162



>ref|XP_001766222.1| predicted protein [Physcomitrella patens]
 gb|EDQ68854.1| predicted protein, partial [Physcomitrella patens]
Length=234

 Score =   196 bits (497),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 149/215 (69%), Gaps = 3/215 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + K+ Y  Q L+RKLVH++ G++F  CWP +SS      +AAL+P  N  +LL+ GLG
Sbjct  21   DFLTKKKYLGQKLSRKLVHITSGLLFASCWPFYSSFPGAQYLAALVPVSNGIRLLVYGLG  80

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
             LKD+G VKS+SR GD RELL+GPLYY + +  +  ++WR SP+ +  +  +C GDG+AD
Sbjct  81   FLKDEGLVKSVSREGDPRELLRGPLYYVVVLVFSTILFWRDSPVGVLALAMMCGGDGIAD  140

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLV  235
            I+GRR  S KLP+N  KS+AGSIAM  FGFL S G + YFS  G  QL+ T   +L   V
Sbjct  141  IVGRRFGSSKLPYNSGKSWAGSIAMFLFGFLVSYGCLWYFSLMGFYQLD-TRSALLRLSV  199

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VSLAA +VES P+ST+LDDN+TVPL +V+ G  +F
Sbjct  200  VSLAATIVESLPISTKLDDNVTVPLTTVIVGMLLF  234



>gb|AFW64554.1| hypothetical protein ZEAMMB73_110888 [Zea mays]
Length=283

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI 
Sbjct  102  KAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVADIA  161

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V+SLA
Sbjct  162  GRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVISLA  221

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  222  AAVVESLPISTRLDDNLTVSVASVLVGALVF  252



>emb|CDY65782.1| BnaA03g56260D [Brassica napus]
Length=178

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  534  ELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKS  355
            ELLKGPLYYA++IT AC  YW++SPIAIA+VCNLCAGDGMADI+GRR+ + KLP+N+NK+
Sbjct  43   ELLKGPLYYALSITSACIFYWKTSPIAIAVVCNLCAGDGMADIVGRRLGTKKLPYNRNKT  102

Query  354  FAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPH-MVLGFLVVSLAAALVESHPLSTELDD  178
             AGSI MA  GFLAS+ +M YF+SFG +E +   M+L F ++S+A+ALVES P+ST++DD
Sbjct  103  IAGSIGMAISGFLASVAYMFYFASFGYIESSGWGMILRFFIISVASALVESLPISTDIDD  162

Query  177  NLTVPLASVLAGSCIF  130
            NLTV L S L G+ +F
Sbjct  163  NLTVSLTSALVGTLLF  178



>gb|EMT05709.1| Putative phytol kinase 2, chloroplastic [Aegilops tauschii]
Length=267

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 132/249 (53%), Gaps = 84/249 (34%)
 Frame = -2

Query  747  YFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGT  568
            Y    LNRKL+H+++GMV +L WP+FSSGR                              
Sbjct  60   YLIMKLNRKLMHITIGMVPLLFWPLFSSGR------------------------------  89

Query  567  VKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIR  388
                       E LK PLYY   I LA +V WR+SPIAIAL+CNLCAGDG+ADI+GRR+ 
Sbjct  90   -----------EFLKAPLYYVTAIALATSVLWRTSPIAIALICNLCAGDGVADIVGRRLG  138

Query  387  SPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL-----EKTPH-----------  256
              KLP+N  KS+AGSIAMA  GFLASIG MHYF +FG +     EK P+           
Sbjct  139  KEKLPYNPKKSYAGSIAMAIAGFLASIGCMHYFHTFGFIEESWKEKLPYNPKKSYAGSIA  198

Query  255  ---------------------------MVLGFLVVSLAAALVESHPLSTELDDNLTVPLA  157
                                       M  GF VVS+AA+LV+SHP +TELDDNLTVPLA
Sbjct  199  MAIAGFLASIGCMHYFHTFGFIEESWRMTFGFPVVSVAASLVQSHPNNTELDDNLTVPLA  258

Query  156  SVLAGSCIF  130
            S L GS I 
Sbjct  259  SFLVGSLIL  267



>ref|XP_002966017.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
 ref|XP_002971473.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ27222.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ33437.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
Length=247

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 137/209 (66%), Gaps = 0/209 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+AKR  FD+ L+RKLVH+ +G++FML WP+FS   +   +AA+ P  N  +++  G G
Sbjct  35   DELAKRDVFDKKLSRKLVHICVGLIFMLFWPLFSDAPRARYLAAIAPLTNALRMVAFGTG  94

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +L++   VK++SR G  RELLKGPLYYAITI++A   +WR+SP  +  + NLCAGDG AD
Sbjct  95   LLENKAFVKAVSRDGHPRELLKGPLYYAITISIATLFFWRNSPCGVVTIANLCAGDGFAD  154

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I GR+    KLP+N NKS  GS+AM       S+ +   FS  G  +     ++G + VS
Sbjct  155  IFGRKYGRWKLPYNPNKSLQGSVAMFVMSAAFSMLYTFLFSQLGYFDMGVRTIIGIVAVS  214

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAG  142
            LA  +VES P+S+ LDDNLTVP  ++  G
Sbjct  215  LATTVVESLPISSALDDNLTVPATAMAVG  243



>ref|XP_011098893.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum]
Length=241

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 144/201 (72%), Gaps = 3/201 (1%)
 Frame = -2

Query  735  NLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSM  556
            +L RKL+H+S G++ MLCWPMFS    G + AALIPGL +FKLL+  L   K+   +K +
Sbjct  39   HLYRKLIHISAGLIVMLCWPMFSGDLWGRVCAALIPGLCVFKLLVPALITQKEHQLIKLL  98

Query  555  SRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKL  376
             R+ D R+L++  L Y ++I      YWR+ P+AIA++C+LCAGDG+ADI GRR    KL
Sbjct  99   QRYRDSRDLVQATLAYVLSIAFTTVFYWRT-PLAIAVICSLCAGDGVADIAGRRFGGSKL  157

Query  375  PHNKNKSFAGSIAMAAFGFLASIGFMHYFS--SFGQLEKTPHMVLGFLVVSLAAALVESH  202
            P+NK+K+FAGS  MA   FLAS+ +M+YFS   + ++E TP+MVLGF +VS+A+ALVES 
Sbjct  158  PYNKSKTFAGSFGMALAAFLASLLYMYYFSWLEYIEIEATPNMVLGFFLVSVASALVESF  217

Query  201  PLSTELDDNLTVPLASVLAGS  139
            P S  LDDNLTVPLAS +  +
Sbjct  218  PFSPTLDDNLTVPLASFMLAT  238



>ref|XP_001780576.1| predicted protein [Physcomitrella patens]
 gb|EDQ54670.1| predicted protein, partial [Physcomitrella patens]
Length=240

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 140/217 (65%), Gaps = 10/217 (5%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+AKR   ++ L+RKL H+  GMVFML WP+FSS  Q   +AAL P  N  +++ LGLG
Sbjct  22   DELAKRDLLEKKLSRKLCHILSGMVFMLLWPLFSSAPQAKWLAALAPAANGLRMIGLGLG  81

Query  588  iLKDDGTVKSMSRFGDYR--------ELLKGPLYYAITITLACAVYWRSSPIAIALVCNL  433
            I K++  VK++SR G  R        ELL GPLYYAITIT++   +WR+SP+    V  L
Sbjct  82   IWKNEALVKAISRGGSQRQYLRTFCSELLHGPLYYAITITISTLCFWRNSPVGAVAVATL  141

Query  432  CAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHM  253
            CAGDG ADI+GR+  + KLP+N +KSF GS+A      LAS+G++ YFS+FG    T  M
Sbjct  142  CAGDGFADILGRKYGAHKLPYNNSKSFVGSVAFFVIASLASMGYLAYFSAFGFFTATTKM  201

Query  252  VLGFLVVSLAAALVESHPLSTELDDNLTVPLASVLAG  142
                L V+ A+A+ ES PL   LDDN TVP  +++ G
Sbjct  202  YFATLGVTFASAVAESLPL--PLDDNFTVPFTALVVG  236



>ref|XP_004496158.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cicer 
arietinum]
Length=309

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 144/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            ++  ++   +Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  94   DDFTRKNILNQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNFLRLLVNGLS  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D G +KS++R GD +ELL+GPLYY + + L   V+WR SPI +  +  +C GDG+AD
Sbjct  154  LTSDQGLIKSVTRKGDPKELLRGPLYYVVILMLCAVVFWRDSPIGVVSLAMMCGGDGVAD  213

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            IIGRR  S K+P+N+ KS+AGSI+M  FGFL SIG ++Y+S+ G ++    ++V    +V
Sbjct  214  IIGRRYGSMKIPYNQKKSWAGSISMLIFGFLVSIGMLYYYSALGHVQFDWWNIVPRVALV  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASV  151
            S+ A +VES P++  +DDN++VPLA++
Sbjct  274  SIVATVVESLPITDVVDDNISVPLATI  300



>ref|XP_007144301.1| hypothetical protein PHAVU_007G144700g [Phaseolus vulgaris]
 gb|ESW16295.1| hypothetical protein PHAVU_007G144700g [Phaseolus vulgaris]
Length=303

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 140/211 (66%), Gaps = 9/211 (4%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R    Q L+RKLVH+  G++F+  WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  88   DELTRRNILHQGLSRKLVHILSGLLFLFSWPIFSNSPKARYFAAFVPLVNCLRLLMNGLS  147

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R GD  ELL+GPLYY + +TL   V+WR SPI +  +  +C GDG+AD
Sbjct  148  LASDEGLIKSLTREGDPEELLRGPLYYVLILTLCALVFWRESPIGVVSLAMMCGGDGVAD  207

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVLG  244
            IIGR+  S K+P+N+NKS+AGSI+M  FGFL SIG ++Y+S  G ++       P +   
Sbjct  208  IIGRKYGSMKIPYNQNKSWAGSISMLVFGFLVSIGILYYYSVLGHVQLDWASTVPRVAF-  266

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASV  151
               +S  A +VES P++  +DDN++VPL ++
Sbjct  267  ---ISFVATIVESLPITKIVDDNISVPLVTM  294



>gb|KEH43364.1| phytol kinase [Medicago truncatula]
Length=306

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 143/207 (69%), Gaps = 1/207 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +++ +R   DQ L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  91   DDLTRRNVIDQGLSRKLVHILSGLLFLVSWPIFSNSLEARYFAAFVPLVNFLRLLVNGLS  150

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ D G +KS++R GD +ELL+GPLYY   + L+  V+WR SPI +  +  +C GDG+AD
Sbjct  151  LVTDPGLIKSVTRKGDPKELLRGPLYYVGILMLSALVFWRESPIGVVALAMMCGGDGVAD  210

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            IIGRR  S K+P+N+ KS+AGSIAM  FGFL SIG ++Y+S+ G ++    ++V     V
Sbjct  211  IIGRRYGSMKIPYNQKKSWAGSIAMLIFGFLVSIGMLYYYSALGHVQFDLWNIVPRVAFV  270

Query  231  SLAAALVESHPLSTELDDNLTVPLASV  151
            S  A +VES P++  +DDN++VPL ++
Sbjct  271  SFVATVVESLPITEVVDDNISVPLVTM  297



>ref|NP_001239775.1| probable phytol kinase 1, chloroplastic [Glycine max]
 sp|Q2N2K1.1|PHYK1_SOYBN RecName: Full=Probable phytol kinase 1, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42676.1| phytol kinase [Glycine max]
Length=302

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 142/211 (67%), Gaps = 9/211 (4%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  87   DELTRRNILQQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGLS  146

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R GD  ELL+GPLYY + + L+  V+WR SPI +  +  +CAGDG+AD
Sbjct  147  LASDEGLIKSVTREGDPLELLRGPLYYVLILILSALVFWRESPIGVISLAMMCAGDGIAD  206

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVLG  244
            IIGRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +   
Sbjct  207  IIGRRYGSMKIPYNEHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTLPRVAF-  265

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASV  151
               +S  A LVES P++  +DDN++VPLA++
Sbjct  266  ---ISFVATLVESLPITKVVDDNISVPLATM  293



>ref|XP_009783010.1| PREDICTED: probable phytol kinase 1, chloroplastic [Nicotiana 
sylvestris]
Length=321

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 140/212 (66%), Gaps = 1/212 (0%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +++R   +QNL+RKLVH+  G++FM  WP+FS+ R     A+++P  N  +L++ GL + 
Sbjct  106  LSERKLIEQNLSRKLVHILSGLLFMASWPIFSASRWARYFASVVPLTNCLRLVINGLSLA  165

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+ADI+
Sbjct  166  TDEGLLKSVTREGKPEELLRGPLYYVLVLILSALLFWRESPVGVISLAMMCGGDGIADIV  225

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSL  226
            GRR  S K+P+NK KS AGS++M   GFL SIG ++YFS+ G L       V    VVS 
Sbjct  226  GRRFGSIKIPYNKQKSLAGSLSMFVLGFLVSIGMLYYFSALGYLHLDWVSTVERVAVVSF  285

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             A +VES P++  +DDN++VPL S++  S  F
Sbjct  286  IATMVESLPITPTVDDNISVPLVSMVVASLAF  317



>ref|XP_003556292.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Glycine 
max]
Length=298

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 142/218 (65%), Gaps = 9/218 (4%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  83   DELTRRNILQQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGLS  142

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R GD  ELL+GPLYY + +     V+WR SP+ +  +  +CAGDG+AD
Sbjct  143  LASDEGLIKSVTREGDPLELLRGPLYYVLILIFCALVFWRESPVGVVSLAMMCAGDGIAD  202

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVLG  244
            IIGRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +   
Sbjct  203  IIGRRYGSLKIPYNQHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTVPRVAF-  261

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
               +S  A LVES P++  +DDN++VPLA+++     F
Sbjct  262  ---ISFVATLVESLPITKVIDDNISVPLATMVVAFFTF  296



>ref|XP_009591844.1| PREDICTED: probable phytol kinase 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=350

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 139/212 (66%), Gaps = 1/212 (0%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +++R    QNL+RKLVH+  G++FM  WP+FS+ R     A+++P  N  +L++ GL + 
Sbjct  135  LSERKLIQQNLSRKLVHILSGLLFMASWPIFSASRWARYFASVVPLTNCLRLVIHGLSLA  194

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+ADI+
Sbjct  195  TDEGLLKSVTREGKPEELLRGPLYYVLVLILSALLFWRESPVGVISLAMMCGGDGIADIV  254

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSL  226
            GRR  S K+P+NK KS AGS++M   GFL SIG ++YFS+ G L       V    VVS 
Sbjct  255  GRRFGSIKIPYNKQKSLAGSLSMFVLGFLVSIGMLYYFSALGYLHLDWVSTVERVAVVSF  314

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             A +VES P++  +DDN++VPL S++  S  F
Sbjct  315  IATMVESLPITPTVDDNISVPLVSMVVASLAF  346



>ref|XP_010067215.1| PREDICTED: probable phytol kinase 1, chloroplastic [Eucalyptus 
grandis]
Length=309

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 142/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RKLVH+  G++FM  WP+FS+  +    A+L+P +N F+L++ GL 
Sbjct  94   DTLTQRNLIQQSLSRKLVHILSGLLFMASWPIFSNSMEARYFASLVPLVNCFRLVVNGLS  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G VKS++R G  +ELL+GPLYY + + L   VYWR SP  +  +  +C GDG+AD
Sbjct  154  LAADEGLVKSVTREGSPQELLRGPLYYVLILILCAIVYWRESPTGVISLAMMCGGDGIAD  213

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            IIGRR  S KLP+N  KS+AGSI+M   GFL SIG + YFSS G  +    M L  + +V
Sbjct  214  IIGRRFGSQKLPYNHKKSWAGSISMFVCGFLISIGMLCYFSSLGYFQLDWTMTLQQVALV  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SLAA +VES P++  LD+N++VPL+S+L
Sbjct  274  SLAATVVESLPITEVLDNNISVPLSSML  301



>ref|XP_006436584.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 ref|XP_006485240.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X1 [Citrus sinensis]
 gb|ESR49824.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 gb|KDO55301.1| hypothetical protein CISIN_1g022218mg [Citrus sinensis]
Length=301

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 151/217 (70%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +++R    Q+L+RKLVH+  G++FM+ WP+FS+  +    AAL+P +N  +L++ GL 
Sbjct  86   DNLSQRKLIQQSLSRKLVHILSGLLFMVSWPIFSTSTEARYFAALVPLVNCLRLVINGLS  145

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++KDDG +KS++R G+ +ELL+GPLYY + + L+  V+WR SP+ +  +  +C GDG+AD
Sbjct  146  LVKDDGLIKSVTREGNPKELLRGPLYYVLMLILSALVFWRDSPVGVISLSMMCGGDGIAD  205

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLE--KTPHMVLGF  241
            +IGRR  S K+ +N+ KS+AGSI+M  FGFL S G ++++S  G  QL+  +T   V   
Sbjct  206  VIGRRFGSMKIFYNEKKSWAGSISMFVFGFLVSTGMLYFYSILGYYQLDWIETLQRV---  262

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             +VSL A +VES P++  +DDN++VPLAS++A    F
Sbjct  263  ALVSLVATVVESLPITEVVDDNISVPLASMVAAYLSF  299



>emb|CBI40186.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 141/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N  +L++ GL 
Sbjct  79   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCLRLVIYGLS  138

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R G   ELL+GPLYY + + +   V+WR SPI +  +  +C GDG+AD
Sbjct  139  LATDEGLIKSVTREGKPEELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIAD  198

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL-GFLVV  232
            I+GRR  S KLP+N+ KS+AGSI+M  FGFL SIG +HYFS+ G  +      +    ++
Sbjct  199  IMGRRFGSLKLPYNQQKSWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALI  258

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P +  +DDN++VPLAS++
Sbjct  259  SLVATVVESLPTTKVVDDNISVPLASMV  286



>ref|XP_008456566.1| PREDICTED: probable phytol kinase 1, chloroplastic [Cucumis melo]
Length=302

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 141/214 (66%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    QNL+RKLVH+  G++F + WP+FS+  +    A+++P +N  +L++ GL 
Sbjct  86   DNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTEARYFASIVPSVNCLRLVINGLS  145

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+AD
Sbjct  146  LTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVIFWRESPVGLISLGMMCGGDGIAD  205

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            I+GR+  S +LP+N+ KS+ GSI+M  FGF  SIG ++Y+S  G LE      V    +V
Sbjct  206  IMGRKFGSKRLPYNQEKSWIGSISMFIFGFCVSIGMLYYYSVLGYLELDWVKAVQNVALV  265

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A +VES P++  +DDN++VPL S+ A    F
Sbjct  266  SLVATVVESLPIAEVVDDNISVPLVSMAAAFLTF  299



>ref|XP_010067173.1| PREDICTED: probable phytol kinase 1, chloroplastic [Eucalyptus 
grandis]
Length=309

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 140/208 (67%), Gaps = 1/208 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RKLVH+  G++FM  WP+FS+  +    A+L+P +N F+L++ GL 
Sbjct  94   DTLTQRNLIQQSLSRKLVHILSGLLFMAAWPIFSNSMEARYFASLVPLVNCFRLVVNGLS  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D G VKS++R G  +ELL+GPLYY + + L   VYWR SP  +  +  +C GDG+AD
Sbjct  154  LAADKGLVKSVTREGSPQELLRGPLYYVLILILCAIVYWRESPTGVISLAMMCGGDGIAD  213

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            IIGRR  S KLP+N  KS+AGSI+M   GFL SIG + YFSS G  +    M L  + +V
Sbjct  214  IIGRRFGSQKLPYNHKKSWAGSISMFVCGFLISIGMLCYFSSLGYFQLDWTMTLQRVALV  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P++  LDDN++VPL+S+L
Sbjct  274  SLVATVVESLPITEVLDDNISVPLSSML  301



>ref|XP_001764046.1| predicted protein [Physcomitrella patens]
 gb|EDQ71185.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 136/213 (64%), Gaps = 2/213 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+AKR + ++ L+RKL H+  G+VFML WP+FS+      +AA     N F+++ LGLG
Sbjct  38   DELAKRDFLEKTLSRKLCHILSGLVFMLFWPLFSTAPLAKYLAAFALVANGFRMIGLGLG  97

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + K++  VK++SR G  RELL+GPLYYAI I +A   +WR SPI I  +  LCAGDG AD
Sbjct  98   LWKNESLVKAISRGGSRRELLQGPLYYAIAILVATLFFWRDSPIGICAIATLCAGDGFAD  157

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GR+    KLP+N +KS+ GS+A      LAS  ++  FS+ G    TP + +  L V+
Sbjct  158  IVGRKYGKLKLPYNSDKSYIGSVAFFMLASLASTVYIAIFSACGFFTATPGVYITSLAVA  217

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            LA A+VE  PL   +DDN TVP  ++  G  +F
Sbjct  218  LAGAIVEGLPL--PIDDNFTVPFTAIGVGMLLF  248



>ref|XP_004234914.1| PREDICTED: probable phytol kinase 1, chloroplastic [Solanum lycopersicum]
Length=320

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 140/213 (66%), Gaps = 3/213 (1%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +++R   +QNL+RKLVH+  G++FM  WP+FS   +    AA++P  N  +L++ GL + 
Sbjct  107  LSERKLIEQNLSRKLVHILSGLLFMASWPIFSVSGRARYFAAVVPLTNCLRLVIHGLSLA  166

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G VKS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+ADI+
Sbjct  167  TDEGLVKSVTREGKPEELLRGPLYYVLVLILSAVLFWRESPVGVISLAMMCGGDGIADIV  226

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLVVS  229
            GRR  S KLP+NK KS  GS++M   GFL SIG ++YFS+ G  QL+     V    +VS
Sbjct  227  GRRFGSTKLPYNKQKSLVGSLSMFVVGFLVSIGMLYYFSALGYFQLDWV-STVERVALVS  285

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              A +VES P++  +DDN++VPL S++  S  F
Sbjct  286  FVATMVESLPITGMVDDNISVPLVSMVVASLAF  318



>ref|XP_002269950.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Vitis vinifera]
Length=302

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 142/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N  +L++ GL 
Sbjct  87   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCLRLVIYGLS  146

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R G   ELL+GPLYY + + +   V+WR SPI +  +  +C GDG+AD
Sbjct  147  LATDEGLIKSVTREGKPEELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIAD  206

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP+N+ KS+AGSI+M  FGFL SIG +HYFS+ G  +      +  + ++
Sbjct  207  IMGRRFGSLKLPYNQQKSWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALI  266

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P +  +DDN++VPLAS++
Sbjct  267  SLVATVVESLPTTKVVDDNISVPLASMV  294



>ref|XP_006398907.1| hypothetical protein EUTSA_v10014196mg [Eutrema salsugineum]
 gb|ESQ40360.1| hypothetical protein EUTSA_v10014196mg [Eutrema salsugineum]
Length=306

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    QNL+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +L++ GL 
Sbjct  91   ESLTKRNVIPQNLSRKLVHILSGLLFVISWPIFSASTEARYFAAFVPLVNGLRLVVNGLS  150

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELLKGPL+Y I + ++   +WR SP  +  +  +C GDG+AD
Sbjct  151  VSPNSTLIKSVTREGRPEELLKGPLFYVIALLVSVVFFWRDSPTGMISLAMMCGGDGIAD  210

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L          + +V
Sbjct  211  IMGRKFGSEKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFTRVAIV  270

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A +VES P++ +LDDN++VPLA++LA    F
Sbjct  271  SLVATVVESLPITDQLDDNVSVPLATILAAYISF  304



>ref|XP_006838740.1| hypothetical protein AMTR_s00002p00254420 [Amborella trichopoda]
 gb|ERN01309.1| hypothetical protein AMTR_s00002p00254420 [Amborella trichopoda]
Length=255

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 141/214 (66%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + K+   +Q L+RKLVH+  G++F+  WP+FSS  +    AA++P +N  +L++ GL 
Sbjct  38   DVLTKKSIIEQKLSRKLVHILSGLLFLSSWPIFSSSVEARYFAAIVPLVNSLRLVVYGLS  97

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+ ++G V+S++R G   ELL+GPLYY + +      YWR SPI +  +  +CAGDG+AD
Sbjct  98   IVTNEGLVQSVTRDGRPEELLRGPLYYVLALIYCTLFYWRESPIGVISLAMMCAGDGVAD  157

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            ++GRR  + KLP NK KS+ GSI M  FGF  S+G + YFS+ G ++      +   L++
Sbjct  158  VLGRRFGNHKLPFNKQKSWVGSICMFVFGFSVSLGMLFYFSNLGYIQLDWGSTIEKVLII  217

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            ++AA +VES P++  LDDN+TVPL+S+L  S  F
Sbjct  218  AMAATIVESLPITGLLDDNITVPLSSMLVASFFF  251



>ref|XP_006588439.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Glycine max]
 ref|XP_006588440.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Glycine max]
Length=250

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 140/211 (66%), Gaps = 9/211 (4%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +  R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  35   DSLGLRKLIGQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGLS  94

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R GD  ELL+GPLYY + + L+  V+WR SPI +  +  +CAGDG+AD
Sbjct  95   LASDEGLIKSVTREGDPLELLRGPLYYVLILILSALVFWRESPIGVISLAMMCAGDGIAD  154

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVLG  244
            IIGRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +   
Sbjct  155  IIGRRYGSMKIPYNEHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTLPRVAF-  213

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASV  151
               +S  A LVES P++  +DDN++VPLA++
Sbjct  214  ---ISFVATLVESLPITKVVDDNISVPLATM  241



>ref|XP_008218940.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Prunus mume]
Length=308

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 143/214 (67%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RKLVH+  G++FML WP+FS+       A+++P +N  +LLL GL 
Sbjct  93   DNLTQRNLLQQSLSRKLVHILSGLLFMLSWPIFSTSTAARYFASVVPLVNCLRLLLHGLS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+AD
Sbjct  153  IVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGVVSLAMMCGGDGVAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            I+GR+  S K+P+N+ KS+AGSI+M  FGFL SIG ++Y+S  G  +      V    ++
Sbjct  213  IMGRKFGSIKIPYNQKKSWAGSISMFLFGFLISIGMLYYYSFLGYFQLNWVETVEKVALI  272

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A +VES P++  LDDN++VPL S+ A    F
Sbjct  273  SLVATIVESLPITEVLDDNISVPLVSMAAAYLSF  306



>ref|XP_006364440.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=316

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 141/213 (66%), Gaps = 3/213 (1%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +++R   +QNL+RKLVH+  G++FM  WP+FS+       A+++P  N  +L++ GL + 
Sbjct  103  LSERKLIEQNLSRKLVHILSGLLFMASWPIFSASGWARYFASVVPLTNCLRLVIHGLSLA  162

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS++R G   ELL+GPLYY + + L   ++WR SP+ +  +  +C GDG+ADI+
Sbjct  163  TDEGLIKSVTREGKPEELLRGPLYYVLVLILCAVLFWRESPVGVISLAMMCGGDGIADIV  222

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLVVS  229
            GRR  S KLP+NK KS+AGS++M   GFL S+G ++YFS+ G  QL+     V    +VS
Sbjct  223  GRRFGSTKLPYNKQKSWAGSLSMFVLGFLVSVGMLYYFSALGYFQLDWV-STVERVALVS  281

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              A +VES P++  +DDN++VPL S++  S  F
Sbjct  282  FIATMVESLPITGMVDDNISVPLVSMVVASLAF  314



>ref|XP_002315347.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa]
 gb|EEF01518.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa]
Length=361

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 145/215 (67%), Gaps = 3/215 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RKLVH+  G++F  CWP+FS+  Q   +A+++P +N  +L++ G  
Sbjct  146  DTLTQRNLIQQSLSRKLVHILSGLLFAACWPIFSTSTQARYLASVVPLVNCLRLIVNGFS  205

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ D+G +KS++R G+ +ELL+GPLYY + + L   V+WR SP  +  +  +C GDG+AD
Sbjct  206  LVTDEGLIKSVTREGNPQELLRGPLYYVLILILCALVFWRESPTGVISLAMMCGGDGVAD  265

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLV  235
            IIGRR  S KLP+N++KS+AGSI+M   GFL SIG + Y+S+ G  QL+ T   +    +
Sbjct  266  IIGRRFGSLKLPYNQHKSWAGSISMFICGFLISIGMLFYYSALGYFQLDWT-WTIQRVAL  324

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+L A +VES P++  +DDN+TVPL S++     F
Sbjct  325  VALVATVVESLPITEVVDDNITVPLVSMVVSMLSF  359



>ref|XP_011024295.1| PREDICTED: probable phytol kinase 1, chloroplastic [Populus euphratica]
Length=307

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 143/210 (68%), Gaps = 3/210 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RKLVH+  G++F  CWP+FS+  Q    A+++P +N  +L++ G  
Sbjct  92   DTLTQRNLIQQSLSRKLVHILSGLLFAGCWPIFSTSAQARYFASVVPLVNCLRLIVHGFS  151

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ D+G +KS++R G+ +ELL+GPLYY + + L   V+WR SP  +  +  +C GDG+AD
Sbjct  152  LVTDEGLIKSVTREGNPQELLRGPLYYVLILILCALVFWRESPTGVISLAMMCGGDGVAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLV  235
            IIGRR  S KLP+N++KS+AGS++M   GFL SIG + Y+S+ G  QL+ T   +    +
Sbjct  212  IIGRRFGSLKLPYNQHKSWAGSLSMLTCGFLISIGMLSYYSALGYFQLDWT-WTIQRVAL  270

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLA  145
            V+L A +VES P++  +DDN+TVPL S++ 
Sbjct  271  VALVATVVESLPITEVVDDNITVPLVSMVV  300



>ref|XP_009361416.1| PREDICTED: probable phytol kinase 1, chloroplastic [Pyrus x bretschneideri]
Length=308

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 142/217 (65%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    QNL+RKLVH+  G+ FML WP+FS+       A+++P +N  +LLL G  
Sbjct  93   DNLTQRNLLRQNLSRKLVHILSGIFFMLSWPIFSTSTNARYFASVVPLVNCLRLLLHGFS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+AD
Sbjct  153  LVPNEGLVKSVTREGNPKELLRGPLYYVLVLILCALVFWRESPVGLISLAMMCGGDGVAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLGF  241
            I+GR+  S K+P+N  KS+AGSI+M  FGFL S+G ++Y+S  G  E    +T   V   
Sbjct  213  IMGRKFGSIKIPYNPKKSWAGSISMFLFGFLISMGMLYYYSFLGYFELNWIQTAEKV---  269

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              V+L A LVES P++  LDDN++VPLAS+ A    F
Sbjct  270  AFVALVATLVESLPITEVLDDNISVPLASMAAAYLSF  306



>ref|XP_010490961.1| PREDICTED: phytol kinase 1, chloroplastic [Camelina sativa]
Length=308

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  93   ESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVVNGLS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+AD
Sbjct  153  VSPNSTLIKSVTREGRPEELLKGPLFYVLALLMSSVFFWRESPIGMISLAMMCGGDGIAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L          + +V
Sbjct  213  IMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLNMNWETTFQRVAIV  272

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A +VES P++ ++DDN++VPLA++LA    F
Sbjct  273  SMVATVVESLPITDQVDDNVSVPLATILAAYLCF  306



>ref|XP_008375637.1| PREDICTED: probable phytol kinase 1, chloroplastic [Malus domestica]
Length=305

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 142/217 (65%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    QNL+RKLVH+  G+ FML WP+FS+       A+++P +N  +LLL G  
Sbjct  90   DNLTQRNLLRQNLSRKLVHILSGIFFMLSWPIFSTSTDARYFASVVPLVNCLRLLLHGFS  149

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+AD
Sbjct  150  LVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGDGVAD  209

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLGF  241
            I+GR+  S K+P+N  KS+AGSI+M  FGFL S+G ++Y+S  G  E    +T   V   
Sbjct  210  IMGRKFGSIKIPYNPKKSWAGSISMFLFGFLISMGMLYYYSFLGYFELNWIQTAEKV---  266

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              V+L A LVES P++  LDDN++VPLAS+ A    F
Sbjct  267  AFVALVATLVESLPITEVLDDNVSVPLASMAAAYLSF  303



>emb|CDY44860.1| BnaC09g50600D [Brassica napus]
Length=299

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q L+RKLVH+  G++F+L WP+FS+ ++     AL+P +N  +L++ GL 
Sbjct  84   ESLTKRNVISQRLSRKLVHILSGLLFVLSWPIFSASKEARYFTALVPLVNCVRLVVNGLS  143

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  +   +KS++R G   ELL+GPL+Y + + ++   +WR SPI +  +  +C GDG+AD
Sbjct  144  ISPNSTLIKSVTREGRPEELLRGPLFYVLALLVSAVFFWRDSPIGMISLAMMCGGDGIAD  203

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS AGSI+M  FGF+ SIG ++Y+SS G L          + +V
Sbjct  204  IMGRKFGSQKIPYNPRKSLAGSISMFIFGFIISIGLLYYYSSLGYLHMNWETTFTKVAIV  263

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A LVES P++ ++DDN++VPLA+++A    F
Sbjct  264  SMVATLVESLPIADQIDDNVSVPLATIMAAYVSF  297



>gb|KGN63038.1| hypothetical protein Csa_2G385070 [Cucumis sativus]
Length=300

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL 
Sbjct  85   DNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTGARYFASIVPTVNCLRLVINGLS  144

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+AD
Sbjct  145  LTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVIFWRESPVGLISLGMMCGGDGIAD  204

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            I+GR+  S +LP+N+ KS+ GSI+M  FGF  SIG ++YFS  G LE      V    ++
Sbjct  205  IMGRKFGSKRLPYNQEKSWVGSISMFIFGFCVSIGMLYYFSVLGYLELDWVKAVQNVALI  264

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A +VES P +  +DDN++VPL S+ A    F
Sbjct  265  SLVATVVESLPSAGVVDDNISVPLVSMAAAFLTF  298



>gb|KJB83903.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=212

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G G
Sbjct  94   QETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIIRMILIGSG  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDG  418
            + KD+ TVK+MSR+GDYRELLKGP+YYA TITLACA YWR+SPIAIA +CNLCAGDG
Sbjct  154  LWKDEATVKAMSRYGDYRELLKGPVYYATTITLACAFYWRTSPIAIAAICNLCAGDG  210



>ref|XP_010423571.1| PREDICTED: phytol kinase 1, chloroplastic-like [Camelina sativa]
Length=308

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  93   ESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVVNGLS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+AD
Sbjct  153  VSPNSTLIKSVTREGRPEELLKGPLFYVLALLMSAVFFWRESPIGMISLAMMCGGDGIAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L          + +V
Sbjct  213  IMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLNMNWETTFQRVALV  272

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A +VES P++ ++DDN++VPLA++LA    F
Sbjct  273  SMVATVVESLPITDQVDDNVSVPLATILAAYLCF  306



>ref|XP_009122590.1| PREDICTED: phytol kinase 1, chloroplastic-like [Brassica rapa]
 emb|CDX70220.1| BnaA10g25690D [Brassica napus]
Length=299

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q  +RKLVH+  G++F+L WP+FS  ++    AAL+P +N  +L++ GL 
Sbjct  84   ESLTKRNVISQRFSRKLVHILSGLLFVLSWPIFSPSKEARYFAALVPLVNCVRLVVNGLS  143

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELL+GPL+Y + + ++   +WR SPI +  +  +C GDG+AD
Sbjct  144  VSPNSTLIKSVTREGRPEELLRGPLFYVLALLVSAVFFWRDSPIGMISLAMMCGGDGIAD  203

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS AGSI+M  FGF+ SIG ++Y+SS G L          + +V
Sbjct  204  IMGRKFGSQKIPYNPRKSLAGSISMFIFGFIISIGLLYYYSSLGYLHMNWETTFTKVAIV  263

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A LVES P++ ++DDN++VPLA+++A    F
Sbjct  264  SMVATLVESLPITDQIDDNVSVPLATIMAAYVSF  297



>ref|NP_196069.1| phytol kinase 1 [Arabidopsis thaliana]
 sp|Q9LZ76.1|PHYK1_ARATH RecName: Full=Phytol kinase 1, chloroplastic; AltName: Full=Vitamin 
E pathway gene 5 protein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB85555.1| putative protein [Arabidopsis thaliana]
 gb|AAX22258.1| At5g04490 [Arabidopsis thaliana]
 gb|AED90752.1| phytol kinase 1 [Arabidopsis thaliana]
Length=304

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 138/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  89   ESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGLS  148

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  +   +KS++R G   ELLKGPL+Y + +  +   +WR SPI +  +  +C GDG+AD
Sbjct  149  ISPNSMLIKSVTREGRAEELLKGPLFYVLALLFSAVFFWRESPIGMISLAMMCGGDGIAD  208

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L       L  + +V
Sbjct  209  IMGRKFGSTKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHMNWETTLQRVAMV  268

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A +VES P++ +LDDN++VPLA++LA    F
Sbjct  269  SMVATVVESLPITDQLDDNISVPLATILAAYLSF  302



>ref|XP_010028018.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=148

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALI G+NI ++LLLG G
Sbjct  29   EETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALILGVNIIRMLLLGSG  88

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDG  418
            I KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA +CNLCAGDG
Sbjct  89   IWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAAMCNLCAGDG  145



>gb|AAO42044.1| unknown protein [Arabidopsis thaliana]
Length=304

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 138/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  89   ESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGLS  148

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  +   +KS++R G   ELLKGPL+Y + +  +   +WR SPI +  +  +C GDG+AD
Sbjct  149  ISPNSMLIKSVTREGRAEELLKGPLFYVLALLFSAVFFWRESPIGMISLAMMCGGDGIAD  208

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L       L  + +V
Sbjct  209  IMGRKFGSTKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHMNWETTLQRVAMV  268

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A +VES P++ +LDDN++VPLA++LA    F
Sbjct  269  SMVATVVESLPITDQLDDNISVPLATILAAYLSF  302



>ref|XP_011094481.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Sesamum indicum]
Length=308

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q L+RKLVH+  G++F+  WP+FS+       A+++P LN  +L++ GL 
Sbjct  93   DNLTRRNIIEQTLSRKLVHILSGLLFLASWPIFSASTGARYFASVVPSLNCLRLVMNGLS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS+SR G   ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+AD
Sbjct  153  LTTDEGLIKSVSREGKPEELLRGPLYYVLVLILCAIVFWRESPVGMISLAMMCGGDGIAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S K+P+N  KS+AGSI+M  FGFL SIG ++YF+  G ++      L  + +V
Sbjct  213  IMGRRFGSVKIPYNPQKSWAGSISMFLFGFLVSIGMLYYFAVLGYIQLEWMQTLERVALV  272

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S  A L+ES P +  +DDN++VPLAS++    +F
Sbjct  273  SFVATLIESLPTTGIVDDNISVPLASMVTSLLVF  306



>gb|KHN00934.1| Putative phytol kinase 1, chloroplastic [Glycine soja]
Length=227

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 139/216 (64%), Gaps = 9/216 (4%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            + +R      L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL + 
Sbjct  14   VHRRAPPPSGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGLSLA  73

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS++R GD  ELL+GPLYY + +     V+WR SP+ +  +  +CAGDG+ADII
Sbjct  74   SDEGLIKSVTREGDPLELLRGPLYYVLILIFCALVFWRESPVGVVSLAMMCAGDGIADII  133

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVLGFL  238
            GRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +     
Sbjct  134  GRRYGSLKIPYNQHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTVPRVAF---  190

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             +S  A LVES P++  +DDN++VPLA+++     F
Sbjct  191  -ISFVATLVESLPITKVIDDNISVPLATMVVAFFTF  225



>ref|XP_006288296.1| hypothetical protein CARUB_v10001540mg [Capsella rubella]
 gb|EOA21194.1| hypothetical protein CARUB_v10001540mg [Capsella rubella]
Length=307

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  92   ESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVINGLS  151

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+AD
Sbjct  152  LSPNSTLIKSVTREGRPEELLKGPLFYVLALLISVVFFWRDSPIGMMSLAMMCGGDGIAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L+         + +V
Sbjct  212  IMGRKYGSVKIPYNPRKSWAGSISMFIFGFSISIGLLYYYSSLGYLDMNWGTTFQRVAIV  271

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A +VES P++ +LDDN++VPLA++LA    F
Sbjct  272  SMVATVVESLPITDQLDDNVSVPLATILAAYLSF  305



>ref|XP_010906567.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X3 
[Elaeis guineensis]
Length=256

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 134/205 (65%), Gaps = 1/205 (0%)
 Frame = -2

Query  741  DQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVK  562
            +Q+L+RK+VHV  G++FM  WP+FSS  +    AA++P +N  +L+  GL I  D+G +K
Sbjct  49   EQSLSRKVVHVLSGLLFMSSWPIFSSSTEARYFAAIVPLVNCIRLVTYGLRIFTDEGLIK  108

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            S++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG ADI+GRR  + 
Sbjct  109  SVTREGKPEELLRGPLYYVMVLMFCSVVFWRESPVGVVSLAMMSGGDGFADILGRRYGAT  168

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSLAAALVES  205
            KLP+N+ KS+ GSI+M  FGFL SIG ++YFS+ G         V    VVSLAA +VES
Sbjct  169  KLPYNRQKSWIGSISMFIFGFLFSIGMLYYFSALGCFHLDWNKAVERVAVVSLAATVVES  228

Query  204  HPLSTELDDNLTVPLASVLAGSCIF  130
             P+S  +DDN++VPL  +L  S +F
Sbjct  229  LPISDFVDDNISVPLTCMLTASLLF  253



>ref|XP_006364441.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X2 [Solanum tuberosum]
Length=313

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 137/204 (67%), Gaps = 3/204 (1%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +++R   +QNL+RKLVH+  G++FM  WP+FS+       A+++P  N  +L++ GL + 
Sbjct  103  LSERKLIEQNLSRKLVHILSGLLFMASWPIFSASGWARYFASVVPLTNCLRLVIHGLSLA  162

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS++R G   ELL+GPLYY + + L   ++WR SP+ +  +  +C GDG+ADI+
Sbjct  163  TDEGLIKSVTREGKPEELLRGPLYYVLVLILCAVLFWRESPVGVISLAMMCGGDGIADIV  222

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLVVS  229
            GRR  S KLP+NK KS+AGS++M   GFL S+G ++YFS+ G  QL+     V    +VS
Sbjct  223  GRRFGSTKLPYNKQKSWAGSLSMFVLGFLVSVGMLYYFSALGYFQLDWV-STVERVALVS  281

Query  228  LAAALVESHPLSTELDDNLTVPLA  157
              A +VES P++  +DDN++VPLA
Sbjct  282  FIATMVESLPITGMVDDNISVPLA  305



>ref|XP_007218720.1| hypothetical protein PRUPE_ppa009034mg [Prunus persica]
 gb|EMJ19919.1| hypothetical protein PRUPE_ppa009034mg [Prunus persica]
Length=308

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 141/214 (66%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RKLVH+  G++FML WP+FS+       A ++P +N  +LLL GL 
Sbjct  93   DNLTQRNLLQQSLSRKLVHILSGLLFMLSWPIFSTSTAARYFATVVPLVNCLRLLLHGLS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+ ++G VKS++R G+ +ELL+GPLYY + + L    +WR SP+ +  +  +C GDG+AD
Sbjct  153  IVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALAFWRESPVGVVSLAMMCGGDGVAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            I+GR+  S K+P+N+ KS+AGSI+M  FGF+ SIG ++Y+S  G  +      V    ++
Sbjct  213  IMGRKFGSIKIPYNQKKSWAGSISMFLFGFVISIGMLYYYSFLGYFQLNWVETVEKVALI  272

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A +VES P++  LDDN++VPL S+ A    F
Sbjct  273  SLVATIVESLPITDVLDDNISVPLVSMAAAYLSF  306



>ref|XP_004138682.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004159238.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cucumis 
sativus]
Length=297

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 137/208 (66%), Gaps = 1/208 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL 
Sbjct  85   DNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTGARYFASIVPTVNCLRLVINGLS  144

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+AD
Sbjct  145  LTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVIFWRESPVGLISLGMMCGGDGIAD  204

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            I+GR+  S +LP+N+ KS+ GSI+M  FGF  SIG ++YFS  G LE      V    ++
Sbjct  205  IMGRKFGSKRLPYNQEKSWVGSISMFIFGFCVSIGMLYYFSVLGYLELDWVKAVQNVALI  264

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P +  +DDN++VPL  ++
Sbjct  265  SLVATVVESLPSAGVVDDNISVPLTEMM  292



>ref|XP_010452347.1| PREDICTED: phytol kinase 1, chloroplastic-like [Camelina sativa]
Length=307

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 139/214 (65%), Gaps = 2/214 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  93   ESLTKRNVIQQRLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVINGLS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELL+GPL+Y + + L  AV+WR SPI +  +  +C GDG+AD
Sbjct  153  VSPNSTLIKSVTREGRPEELLEGPLFYVLAL-LMSAVFWRESPIGMISLAMMCGGDGIAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L          + +V
Sbjct  212  IMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLNMNWETTFQRVAIV  271

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A +VES P++ ++DDN++VPLA++LA    F
Sbjct  272  SMVATVVESLPITDQVDDNVSVPLATILAAYLCF  305



>gb|AAM61593.1| unknown [Arabidopsis thaliana]
Length=304

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 137/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  89   ESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGLS  148

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  +   +KS++R G   ELLKGPL+Y + +  +   +WR SPI +  +  +C GDG+AD
Sbjct  149  ISPNSMLIKSVTREGRAEELLKGPLFYVLALLFSAVFFWRESPIGMISLAMMCGGDGIAD  208

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L       L  + +V
Sbjct  209  IMGRKFGSTKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHINWETTLQRVAIV  268

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ A +VES P++ +LDDN++VPLA++L     F
Sbjct  269  SMVATVVESLPITDQLDDNVSVPLATILTAYLSF  302



>emb|CDO99832.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 140/210 (67%), Gaps = 3/210 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +++       QNL+RKLVH+  G++FM  WPMFS+       A+L+P +N  +L++ GL 
Sbjct  111  DKLTSANLIQQNLSRKLVHILSGLLFMASWPMFSTSTGARYFASLVPLINCLRLVVYGLS  170

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+G V S++R G   ELL+GPLYY + + L+   +WR SP+ +  V  +C GDG+AD
Sbjct  171  LAKDEGLVNSVTREGKPEELLRGPLYYVMILILSAIFFWRDSPVGVVSVSMMCGGDGIAD  230

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLV  235
            I+GRR  S KLP+N+ KS+AGS++M   GFL SIG ++YFS+ G  QL+ +   +    +
Sbjct  231  IMGRRFGSLKLPYNQQKSWAGSLSMFVLGFLISIGMLYYFSALGCFQLDWS-CTIQRVAL  289

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLA  145
            VSL A LVES P +  +DDN++VP+AS++ 
Sbjct  290  VSLVATLVESLPTTGIVDDNISVPIASMVT  319



>ref|XP_009130827.1| PREDICTED: phytol kinase 1, chloroplastic-like [Brassica rapa]
 gb|AFB74217.1| phytol kinase [Brassica napus]
Length=307

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 137/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q L+RKLVH+  G++F+L WP+FS+  +    AA +P +N  +L++ GL 
Sbjct  92   ESLTKRDVIPQRLSRKLVHILSGLLFVLSWPIFSASTEARYFAAFVPLVNGLRLVVNGLS  151

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   ++S++R G   ELLKGPL+Y + + +A   +WR SP  +  +  +C GDG+AD
Sbjct  152  VSPNSTLIQSVTREGRPEELLKGPLFYVLALLVAAVFFWRDSPTGMISLAMMCGGDGIAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS AGSI+M  FGF  SIG ++Y+SS G L          + +V
Sbjct  212  IMGRKYGSYKIPYNPRKSLAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFTRVAIV  271

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A LVES P++ ++DDN++VPLA++LA    F
Sbjct  272  SLVATLVESLPITDQIDDNVSVPLATILAAYLSF  305



>ref|XP_002871097.1| hypothetical protein ARALYDRAFT_325092 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47356.1| hypothetical protein ARALYDRAFT_325092 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 140/217 (65%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  89   ESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGLS  148

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+AD
Sbjct  149  VSPNSTLIKSVTREGRPEELLKGPLFYVLALLISAIFFWRESPIGMISLAMMCGGDGIAD  208

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL----EKTPHMVLGF  241
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L    E T   V   
Sbjct  209  IMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHMNWETTFQRV---  265

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             ++S+ A +VES P++ +LDDN++VPLA++LA    F
Sbjct  266  AMISMVATVVESLPITDQLDDNVSVPLATILAAYLSF  302



>gb|EPS60714.1| phytol kinase, partial [Genlisea aurea]
Length=241

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 139/212 (66%), Gaps = 1/212 (0%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +  R   ++ L+RKLVH+  G++F+  WP+FS+      +A+L+P +N  +LLL GL + 
Sbjct  30   LTSRKIVEKALSRKLVHILSGLLFLAAWPIFSTSTGARYLASLVPTMNFLRLLLNGLSLT  89

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KD+  + S+SR G   ELL+GPLYY + + L    +WR SP+ I  +  +CAGDG+ADI+
Sbjct  90   KDEALIASVSREGKPEELLRGPLYYVVVLMLCTISFWRDSPVGIISLSMMCAGDGIADIV  149

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSL  226
            GRR  + K+P+N +KS+AGS++M  FGFL SIG ++Y+   G +E +    +    +VS+
Sbjct  150  GRRFGNVKIPYNADKSWAGSVSMFLFGFLVSIGMLYYYWILGYIELEWIQTIENVALVSV  209

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             A +VES P  + LDDN++VPL+S++    +F
Sbjct  210  VATVVESLPTKSTLDDNISVPLSSIITSLLLF  241



>ref|XP_004307151.1| PREDICTED: phytol kinase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=311

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + KR    Q+L+RKLVH+S G++F+L WP+FS+  +    A ++P  N  +LLL GL 
Sbjct  96   DYLTKRNVLQQSLSRKLVHISSGLLFVLSWPIFSTSTEARYFATVVPLFNGLRLLLSGLS  155

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ ++G VKS++R G+ +ELL+GPLYY + + +   V+WR SP+ +  +  +C GDG+AD
Sbjct  156  LVPNEGLVKSVTREGNPKELLRGPLYYVLILIVCALVFWRESPVGVISLAMMCGGDGVAD  215

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            I+GRR  S K+P+N+ KS+AGSI+M  FG L S+  ++Y+S  G         V   + V
Sbjct  216  IMGRRFGSIKIPYNQKKSWAGSISMFVFGSLVSLAMLYYYSCLGYFNLDWAKTVQKVVFV  275

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A  VES P++  +DDN++VPLAS+ A    F
Sbjct  276  SLVATAVESIPITEVVDDNISVPLASMAAAYLSF  309



>ref|XP_010906565.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=323

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 138/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA++P +N  +L+  GL 
Sbjct  107  DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSTEARYFAAIVPLVNCIRLVTYGLR  166

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  167  IFTDEGLIKSVTREGKPEELLRGPLYYVMVLMFCSVVFWRESPVGVVSLAMMSGGDGFAD  226

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            I+GRR  + KLP+N+ KS+ GSI+M  FGFL SIG ++YFS+ G         V    VV
Sbjct  227  ILGRRYGATKLPYNRQKSWIGSISMFIFGFLFSIGMLYYFSALGCFHLDWNKAVERVAVV  286

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAA +VES P+S  +DDN++VPL  +L  S +F
Sbjct  287  SLAATVVESLPISDFVDDNISVPLTCMLTASLLF  320



>gb|KHG03995.1| putative phytol kinase 1, chloroplastic [Gossypium arboreum]
Length=334

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 142/215 (66%), Gaps = 7/215 (3%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            + ++    QNL+RKLVH+  G++F + WP+FS+  +    A+L+P +N  +L++ GL + 
Sbjct  121  LTQKELIQQNLSRKLVHILSGLLFAISWPIFSNADEARYFASLVPLINCLRLVIHGLSLS  180

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D   +KS++R G+ +ELL+GPLYY   + L    +WR SP+ +  + N+C GDG ADII
Sbjct  181  DDQSLIKSVTREGNPKELLRGPLYYVAMLMLCALAFWRESPVGVICLANMCGGDGFADII  240

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLGFLV  235
            GR+  S K+P+N++KS+ GSI+M   GF+ SIG ++Y+S+ G L+     T H V    +
Sbjct  241  GRKYGSSKIPYNQSKSWVGSISMFVSGFIISIGMLYYYSALGYLQLDWGYTMHRV---AL  297

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SL A +VES P++  +DDN++VPLAS+LA    F
Sbjct  298  ISLVATVVESLPITMLIDDNISVPLASMLAAYLTF  332



>emb|CDY69673.1| BnaCnng64700D [Brassica napus]
Length=304

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 136/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E + KR    Q L+RKLVH+  G++F L WP+FS+  +    AA +P +N  +L++ GL 
Sbjct  89   ESLTKRDVIPQRLSRKLVHILSGLLFALSWPIFSASTEARYFAAFVPLVNGLRLVVNGLS  148

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   ++S++R G   ELLKGPL+Y + + +A   +WR SP  +  +  +C GDG+AD
Sbjct  149  VSPNSTLIQSVTREGRPEELLKGPLFYVLALLVAAVFFWRDSPTGMISLAMMCGGDGIAD  208

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GR+  S K+P+N  KS AGSI+M  FGF  SIG ++Y+SS G L          + +V
Sbjct  209  IMGRKYGSYKIPYNPRKSLAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFTRVAIV  268

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A LVES P++ ++DDN++VPLA++LA    F
Sbjct  269  SLVATLVESLPITDQIDDNVSVPLATILAAYLSF  302



>ref|XP_009396489.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 137/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A+R    ++L+RK VHV  G+++M  WP FSS       AA++P LN  +LL  GL 
Sbjct  102  DTLAERNIIQKSLSRKAVHVLSGLLYMATWPFFSSSMVARYFAAVVPLLNCIRLLCYGLR  161

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +L D+G VKS++R G   ELL+GPLYY I + L   V+WR SP+ +  +  +  GDG AD
Sbjct  162  LLTDEGVVKSVAREGRPEELLRGPLYYVIVLLLCTLVFWRESPVGVVSLTMMSGGDGFAD  221

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR    KLP+N+ KS+ GSI+M  FG   S+G ++YFS FG +   P   +  + ++
Sbjct  222  IVGRRYGVTKLPYNQQKSWVGSISMFVFGLFFSVGMLYYFSVFGYVHFDPEQTITRVALI  281

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAA +VES P+S  +DDN++VPL S+L    +F
Sbjct  282  SLAATVVESLPISDVVDDNVSVPLTSMLTSVLLF  315



>gb|KJB60478.1| hypothetical protein B456_009G307400 [Gossypium raimondii]
Length=298

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 141/215 (66%), Gaps = 7/215 (3%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            + ++    QNL+RKLVH+  G++F + WP+FS+  +    A+L+P  N  +L++ GL + 
Sbjct  85   LTQKELIQQNLSRKLVHILSGLLFAISWPIFSNADEARYFASLVPLFNCLRLVIHGLSLT  144

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D   +KS++R G+ +ELL+GPLYY   + L   V+WR SP+ +  +  +C GDG+ADII
Sbjct  145  DDQSLIKSVTREGNPKELLRGPLYYVAMLMLCALVFWRESPVGVICLAMMCGGDGVADII  204

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLGFLV  235
            GR+  S K+P+N++KS+ GSI+M   GF+ SIG ++Y+S+ G L+     T H V     
Sbjct  205  GRKYGSSKIPYNQSKSWVGSISMFVSGFIISIGMLYYYSALGYLQLDWGYTLHRV---AF  261

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SL A +VES P++  +DDN++VPLAS+LA    F
Sbjct  262  ISLVATVVESLPITMLIDDNISVPLASMLAAYLTF  296



>ref|XP_007010114.1| Vitamin E pathway gene 5 isoform 1 [Theobroma cacao]
 gb|EOY18924.1| Vitamin E pathway gene 5 isoform 1 [Theobroma cacao]
Length=348

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 141/211 (67%), Gaps = 3/211 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + ++    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL 
Sbjct  133  DTLTQKELIQQNLSRKLVHILSGLLFAVSWPIFSNSLLARYFASVVPLVNCVRLVIHGLS  192

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D   +KS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+AD
Sbjct  193  LADDQRLIKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGDGVAD  252

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLV  235
            I+GRR  S KLP+N+NKS+ GSI+M  FGF  S+G ++Y+S  G  QL+    M    L 
Sbjct  253  ILGRRFGSSKLPYNRNKSWVGSISMFVFGFFISVGMLYYYSVLGYFQLDWGWTMCRVAL-  311

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAG  142
            VSL A +VES P +T +DDN++VPLA+++A 
Sbjct  312  VSLVATVVESLPFTTVVDDNISVPLATMIAA  342



>gb|KDP45055.1| hypothetical protein JCGZ_01555 [Jatropha curcas]
Length=319

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    QNL+RKLVH+  G++F + WP+FS+  +    A L+P +N  +L++ GL 
Sbjct  104  DTLTQRKLIQQNLSRKLVHILSGLLFAVSWPIFSTSTEARYFATLVPLVNGLRLVIHGLS  163

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +DG +KS++R G   ELLKGPLYY + + L   V+WR SPI +  +  +C GDG+AD
Sbjct  164  LATNDGLIKSVTREGKPEELLKGPLYYVLMLILCALVFWRESPIGLISLAMMCGGDGVAD  223

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP+N+ KS+ GSI+M   GFL S+G ++Y+S+ G  +      +  + ++
Sbjct  224  IMGRRFGSMKLPYNQQKSWVGSISMFISGFLISMGMLYYYSALGYFDFDWIWTMKRVALI  283

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +L A +VES P +  +DDN++VPL S+LA    F
Sbjct  284  ALVATIVESLPTTETIDDNISVPLTSILAAYLSF  317



>ref|XP_010552940.1| PREDICTED: phytol kinase 1, chloroplastic [Tarenaya hassleriana]
Length=313

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 136/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + KR    Q+L+RKLVH+  G++F L WP+FS+  +    AAL+P +N  +LL+ GL 
Sbjct  98   KNLTKRDLIPQSLSRKLVHILSGLLFALSWPIFSASTEARYFAALVPLVNCLRLLVNGLS  157

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D   ++S++R G   ELLKGPLYY I + +   ++WR SPI +  +  +C GDG+AD
Sbjct  158  VSPDASLIQSVTREGKAEELLKGPLYYVIVLIITVLMFWRDSPIGMITLAMMCGGDGIAD  217

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S K+P+N  KS+ GS++M   GF  S G ++Y+S  G L       L  + +V
Sbjct  218  IMGRRFGSQKIPYNPRKSWVGSVSMFIVGFTISTGVLYYYSKLGYLNLNWDTALQRVALV  277

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL A +VES P++  LDDNL+VP+AS++A    F
Sbjct  278  SLVATIVESLPITDRLDDNLSVPMASIVAAYVSF  311



>gb|KFK24895.1| hypothetical protein AALP_AA8G038700 [Arabis alpina]
Length=302

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 139/217 (64%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL 
Sbjct  87   DNLTKRNVIPQSLSRKLVHILSGLLFVLSWPIFSESTEARYFAAFVPLVNCLRLVVNGLS  146

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  +   +KS++R G   ELL+GPL+Y   + ++   +WR SP  +  +  +C GDG+AD
Sbjct  147  VTPNSTLIKSVTREGRPEELLRGPLFYVFALLVSVVFFWRDSPTGMLSLAMMCGGDGIAD  206

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL----EKTPHMVLGF  241
            I+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L    E T   V   
Sbjct  207  IMGRKFGSVKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFQRV---  263

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             +VS+ A +VES P++ +LDDN++VPLA++LA    F
Sbjct  264  AMVSMVATVVESLPITDQLDDNVSVPLATILAAYVSF  300



>gb|ACP43458.1| phytol kinase [Lactuca sativa]
Length=309

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 137/217 (63%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +QNL+RKLVH+  G+++M CWP+FS+       A + P LN  +LL+ GL 
Sbjct  94   DYLTQRQIIEQNLSRKLVHILSGLLYMGCWPIFSTSTDARYFAVIAPLLNCTRLLVHGLS  153

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ ++  +KS++R G   ELL+GPLYY + + L+  ++WR SPI +  +  +C GDG+AD
Sbjct  154  LVPNEDLIKSVTREGKPEELLRGPLYYVLMLILSSLLFWRDSPIGVVSLSMMCGGDGIAD  213

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLGF  241
            I+GRR    K+P+NK KS+ GSI+M   GFL S+G ++YFS  G  E    KT   V   
Sbjct  214  IMGRRFGLHKIPYNKQKSWVGSISMFMVGFLVSVGMLYYFSKLGYFELDWLKTMERV---  270

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             +V++ A LVES P    LDDN++VPL S+L     F
Sbjct  271  AMVAIVATLVESLPTKGGLDDNISVPLVSMLTAYLSF  307



>ref|XP_010665627.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=317

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 136/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +  R    + L+RKLVH+  G++F+  WP+FS+  +    A+L P  N  +L++ GL 
Sbjct  102  DYLTDRNIISKKLSRKLVHIFSGLLFVASWPLFSTSSEARYFASLAPLANCLRLVVYGLS  161

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R G   ELL GPLYY +T+ +   V+WR SP+ +  +  +C GDG+AD
Sbjct  162  LATDEGLIKSVTREGKPEELLTGPLYYVLTLAVCAIVFWRESPVGLLSLAMMCGGDGVAD  221

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHM-VLGFLVV  232
            I+GR+    KLP+N+ KS+AGSI+M AFGFL SIG ++Y+S+ G  +   ++  +   VV
Sbjct  222  IMGRKFGHVKLPYNQKKSWAGSISMFAFGFLISIGMLYYYSALGYFQLDWNITTIRVAVV  281

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
               A +VES P +  +DDN++VPL ++L     F
Sbjct  282  CFIATIVESLPTTEIIDDNISVPLVTLLTAYICF  315



>gb|ACF84080.1| unknown [Zea mays]
Length=170

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -2

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI GRR    KLPHN  KS+AGSIAM 
Sbjct  13   YACAITLTTIVFWRTSPISIAVICNLCAGDGVADIAGRRFGHVKLPHNPEKSYAGSIAMF  72

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
              GF+AS+ FM YF+ FG +EK+  MV  F V+SLAAA+VES P+ST LDDNLTV +ASV
Sbjct  73   LAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVISLAAAVVESLPISTRLDDNLTVSVASV  132

Query  150  LAGSCIF  130
            L G+ +F
Sbjct  133  LVGALVF  139



>gb|KDO66966.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=244

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 16/161 (10%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G G
Sbjct  78   EETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSG  137

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            + KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG   
Sbjct  138  MWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDG---  194

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFS  286
                          + +S    +  + F  L+++ +++ FS
Sbjct  195  -------------KETESLCMPVLSSLFTGLSAVQYLNLFS  222



>emb|CDP05574.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            MLCWPMFSSG QG  +AA++PG N FKLLLLGL + KD+  VK MS  GD+  +L    Y
Sbjct  1    MLCWPMFSSGNQGGFLAAMVPGFNAFKLLLLGLEMRKDEKAVKLMSGLGDHCSVLNASFY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y   I+LA  VYWR+SP+A+A VCNLC    +A I+GRR  S +LP+N+NKS AG+ +M 
Sbjct  61   YLTAISLASVVYWRTSPVAVAAVCNLC----IAPIVGRRFGSLELPYNRNKSVAGTFSMV  116

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHP  199
            A  FLASI +M YFS FG L+++  MV  F VVSL A L ESHP
Sbjct  117  AASFLASIWYMQYFSIFGYLQESWKMVYKFFVVSLVAGLGESHP  160



>ref|XP_002447301.1| hypothetical protein SORBIDRAFT_06g032370 [Sorghum bicolor]
 gb|EES11629.1| hypothetical protein SORBIDRAFT_06g032370 [Sorghum bicolor]
Length=304

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL+ GL 
Sbjct  86   DELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARYFAAVVPLLNSIRLLIYGLR  145

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+  VKS++R G   ELL+GPLYY + +  +  V+WR SP+ I  +  +  GDG AD
Sbjct  146  LYTDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESPVGIVSLSMMSGGDGFAD  205

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP NK KS+AGSI+M   GFL S   M YFSS G ++      LG L +V
Sbjct  206  IVGRRYGSVKLPFNKKKSWAGSISMFISGFLLSAMMMFYFSSLGYIDVIWQEALGKLALV  265

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  266  ALAATVVECIPVTEVVDDNISVPLATMLVAFLLF  299



>ref|XP_001418836.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97129.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=251

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 127/214 (59%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A RG F    +RKLVHV+ G  F   WP+FS+       AA IP     +L  +G G
Sbjct  38   DALADRGAFASTTSRKLVHVTSGTFFACTWPLFSASGAARFFAAAIPLAQGVRLFGIGSG  97

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K+   V+++SR G   ELLKGPLYY   +    + YWR++PI I  +  +C GDG AD
Sbjct  98   MIKNASAVRAVSREGGKEELLKGPLYYTAVLAACTSAYWRTNPIGIVAMAMMCGGDGFAD  157

Query  408  IIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            ++GR+  +   LP N+ KSFAGS    A GF  + G + YF +FG +E TP      L++
Sbjct  158  LVGRKFGKGNALPWNEEKSFAGSAGFVAGGFGVASGLLAYFDAFGFIEATPTTYFVTLII  217

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + A ALVES P+++ +DDN +V + ++  GS ++
Sbjct  218  AFACALVESLPITSIVDDNFSVAITAIACGSLLY  251



>ref|XP_003580789.1| PREDICTED: probable phytol kinase, chloroplastic [Brachypodium 
distachyon]
Length=312

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 133/214 (62%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GLG
Sbjct  92   DALTERRLVEQSLSRKIVHVLSGVMFMSSWPLFSNSNEARFFAAVVPFLNGIRLLTYGLG  151

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               D+  VKS++R G   ELL+GPLYY I + L    +WR SPI I  +  +  GDG AD
Sbjct  152  FYSDEALVKSVTREGKREELLRGPLYYVIVLLLIVLAFWRDSPIGIVSLSMMSGGDGFAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV-V  232
            I+GRR  S KLP NK KS+AGS+AM   GFL S   + YFS  G +        G LV V
Sbjct  212  IVGRRYGSLKLPFNKKKSWAGSVAMFISGFLLSALMLSYFSWLGYIHVNWEETFGKLVLV  271

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++     +F
Sbjct  272  ALAATVVECIPVTDVVDDNISVPLATMFVAFMLF  305



>ref|NP_001105847.1| probable phytol kinase, chloroplastic precursor [Zea mays]
 sp|Q2N2K4.1|PHYK_MAIZE RecName: Full=Probable phytol kinase, chloroplastic; Flags: Precursor 
[Zea mays]
 gb|ABA42673.1| phytol kinase [Zea mays]
 gb|ACG37691.1| phytol kinase 2 [Zea mays]
 tpg|DAA35443.1| TPA: putative phytol kinase, Precursor [Zea mays]
Length=303

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL+ GL 
Sbjct  82   DELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLIYGLR  141

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+  VKS++R G   ELL+GPLYY + +  +  V+WR SPI I  +  +  GDG AD
Sbjct  142  LYTDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFAD  201

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +V
Sbjct  202  IVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLALV  261

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  262  ALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  295



>ref|XP_005643081.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18537.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
Length=281

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 131/211 (62%), Gaps = 2/211 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
              ++ RG  DQ L+RKLVH+  G  F LCWP+FS+       AA++P LN+ ++L LG G
Sbjct  61   RALSSRGIVDQKLSRKLVHILAGPGFALCWPLFSADPNARFFAAIVPCLNLLRVLALGTG  120

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ D  TV +MSR GD  ELL+GPLYY + +  A  VYWR SP+ + +   +C GDG+AD
Sbjct  121  VIDDPKTVNAMSREGDKSELLRGPLYYVVVLLGATLVYWRESPVGVVVFSLMCGGDGLAD  180

Query  408  IIGRRIRSP-KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            I+GRR+    KLP N +KS+AGS AM   G   +I F+ +F S G  E     M LG   
Sbjct  181  IVGRRLGGRHKLPWNSSKSWAGSGAMFLGGSSMAIAFIAFFCSMGYFECDIAAMALGVAA  240

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAG  142
            ++  A L+ES P++ ++DDN++VP    L G
Sbjct  241  IAAVATLIESLPINQKIDDNISVPGTVALLG  271



>gb|ABA42672.1| phytol kinase [Zea mays]
Length=268

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R   +++L+RK+VHV  G++FM  WP+ S+  +    AA++P LN  +LL+ GL 
Sbjct  47   DELTERRLIEKSLSRKVVHVLSGVLFMSSWPLVSNSTEARYFAAVVPFLNSMRLLIYGLR  106

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+  VKS++R G   ELL+GPLYY + +  +  V+WR SPI I  +  +  GDG AD
Sbjct  107  LYTDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFAD  166

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +V
Sbjct  167  IVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLALV  226

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  227  ALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  260



>gb|AIE88275.1| hypothetical protein OG_BBa0063K01.6 [Oryza glaberrima]
Length=314

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 137/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +  R   +QNL+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL 
Sbjct  95   DGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARFFAAIVPLLNCIRLLTYGLR  154

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+  VKS++R G   ELL+GPLYY I + ++  V+WR SPI I  +  +  GDG AD
Sbjct  155  LSTDEALVKSVTREGKPEELLRGPLYYVIVLLVSVLVFWRQSPIGIVSLSMMSGGDGFAD  214

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+NKS+ GSI+M   GFL S   + YFS  G       + LG L +V
Sbjct  215  IVGRRYGSAKLPFNENKSWIGSISMFISGFLLSALMLFYFSCLGYFTVCWDLALGKLALV  274

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++LA   +F
Sbjct  275  ALAATVVECIPVNDVVDDNISVPLATMLAAYLLF  308



>sp|Q7XR51.1|PHYK1_ORYSJ RecName: Full=Probable phytol kinase 1, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 emb|CAE02829.1| OSJNBa0043A12.34 [Oryza sativa Japonica Group]
 emb|CAH67696.1| H0624F09.4 [Oryza sativa Indica Group]
 gb|EEC78224.1| hypothetical protein OsI_17864 [Oryza sativa Indica Group]
Length=314

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 137/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +  R   +QNL+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL 
Sbjct  95   DGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARFFAAIVPLLNCIRLLTYGLR  154

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+  VKS++R G   ELL+GPLYY I + ++  V+WR SPI I  +  +  GDG AD
Sbjct  155  LSTDEALVKSVTREGKPEELLRGPLYYVIVLLVSVLVFWRQSPIGIVSLSMMSGGDGFAD  214

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+NKS+ GSI+M   GFL S   + YFS  G       + LG L +V
Sbjct  215  IVGRRYGSAKLPFNENKSWIGSISMFISGFLLSALMLFYFSCLGYFTVCWDLALGKLALV  274

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++LA   +F
Sbjct  275  ALAATVVECIPVNDVVDDNISVPLATMLAAYLLF  308



>gb|EEE61880.1| hypothetical protein OsJ_16572 [Oryza sativa Japonica Group]
Length=314

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 137/214 (64%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +  R   +QNL+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL 
Sbjct  95   DGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARFFAAIVPLLNCIRLLTYGLR  154

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+  VKS++R G   ELL+GPLYY I + ++  V+WR SPI I  +  +  GDG AD
Sbjct  155  LSTDEALVKSVTREGKPEELLRGPLYYVIVLLVSVLVFWRQSPIGIVSLSMMSGGDGFAD  214

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+NKS+ GSI+M   GFL S   + YFS  G       + LG L +V
Sbjct  215  IVGRRYGSAKLPFNENKSWIGSISMFISGFLLSALMLFYFSCLGYFTVCWDLALGKLALV  274

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++LA   +F
Sbjct  275  ALAATVVECIPVNDVVDDNISVPLATMLAAYLLF  308



>ref|XP_007010115.1| Vitamin E pathway gene 5 isoform 2 [Theobroma cacao]
 gb|EOY18925.1| Vitamin E pathway gene 5 isoform 2 [Theobroma cacao]
Length=345

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 138/211 (65%), Gaps = 6/211 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + ++    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL 
Sbjct  133  DTLTQKELIQQNLSRKLVHILSGLLFAVSWPIFSNSLLARYFASVVPLVNCVRLVIHGLS  192

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D   +KS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GD   D
Sbjct  193  LADDQRLIKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGD---D  249

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLV  235
            I+GRR  S KLP+N+NKS+ GSI+M  FGF  S+G ++Y+S  G  QL+    M    L 
Sbjct  250  ILGRRFGSSKLPYNRNKSWVGSISMFVFGFFISVGMLYYYSVLGYFQLDWGWTMCRVAL-  308

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAG  142
            VSL A +VES P +T +DDN++VPLA+++A 
Sbjct  309  VSLVATVVESLPFTTVVDDNISVPLATMIAA  339



>ref|XP_010278283.1| PREDICTED: probable phytol kinase, chloroplastic [Nelumbo nucifera]
Length=326

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 131/205 (64%), Gaps = 1/205 (0%)
 Frame = -2

Query  741  DQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVK  562
            +Q  +RKLVH+  G+++M  WP+FS+       AAL+P LN  +L++ GL +  D+G VK
Sbjct  115  EQTFSRKLVHILSGLLYMFSWPIFSTSITARFFAALVPFLNCVRLVVYGLSLANDEGLVK  174

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            S++R G+  ELL+GPLYY + + L   ++WR SPI +  +  +  GDG ADI+GRR  S 
Sbjct  175  SVTREGNPEELLRGPLYYVLILILCAVIFWRESPIGVISLAMMAGGDGFADIMGRRFGSL  234

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSLAAALVES  205
            KLP+N++KS+ GSI+M   GFL S+G ++YFS+ G  +      V    +VSL A +VES
Sbjct  235  KLPYNQHKSWIGSISMFLSGFLISMGMLYYFSALGYFQLDWVWTVEKVALVSLVATVVES  294

Query  204  HPLSTELDDNLTVPLASVLAGSCIF  130
             P    +DDN++VP+ S+L     F
Sbjct  295  FPNKEGIDDNISVPITSMLMSLLFF  319



>ref|XP_009396497.1| PREDICTED: probable phytol kinase, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=328

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 137/226 (61%), Gaps = 13/226 (6%)
 Frame = -2

Query  768  EEIAKRGYFD-QNLNRKLVHVSMGMVFMLCWPMF-----------SSGRQGALVAAlipg  625
            + +A+R     Q+L+RK VHV  G+++M  WP F           SS       AA++P 
Sbjct  102  DTLAERNIIQKQSLSRKAVHVLSGLLYMATWPFFRSVIVLTQSICSSSMVARYFAAVVPL  161

Query  624  lnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIAL  445
            LN  +LL  GL +L D+G VKS++R G   ELL+GPLYY I + L   V+WR SP+ +  
Sbjct  162  LNCIRLLCYGLRLLTDEGVVKSVAREGRPEELLRGPLYYVIVLLLCTLVFWRESPVGVVS  221

Query  444  VCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEK  265
            +  +  GDG ADI+GRR    KLP+N+ KS+ GSI+M  FG   S+G ++YFS FG +  
Sbjct  222  LTMMSGGDGFADIVGRRYGVTKLPYNQQKSWVGSISMFVFGLFFSVGMLYYFSVFGYVHF  281

Query  264  TPHMVLGFL-VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             P   +  + ++SLAA +VES P+S  +DDN++VPL S+L    +F
Sbjct  282  DPEQTITRVALISLAATVVESLPISDVVDDNVSVPLTSMLTSVLLF  327



>gb|KCW65249.1| hypothetical protein EUGRSUZ_G02725 [Eucalyptus grandis]
Length=190

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            M  WP+FS+  +    A+L+P +N F+L++ GL +  D G VKS++R G  +ELL+GPLY
Sbjct  1    MAAWPIFSNSMEARYFASLVPLVNCFRLVVNGLSLAADKGLVKSVTREGSPQELLRGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y + + L   VYWR SP  +  +  +C GDG+ADIIGRR  S KLP+N  KS+AGSI+M 
Sbjct  61   YVLILILCAIVYWRESPTGVISLAMMCGGDGIADIIGRRFGSQKLPYNHKKSWAGSISMF  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VVSLAAALVESHPLSTELDDNLTVPLAS  154
              GFL SIG + YFSS G  +    M L  + +VSL A +VES P++  LDDN++VPL+S
Sbjct  121  VCGFLISIGMLCYFSSLGYFQLDWTMTLQRVALVSLVATVVESLPITEVLDDNISVPLSS  180

Query  153  VL  148
            +L
Sbjct  181  ML  182



>ref|XP_010658680.1| PREDICTED: phytol kinase 1, chloroplastic isoform X2 [Vitis vinifera]
Length=277

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 125/208 (60%), Gaps = 26/208 (13%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N          
Sbjct  87   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCL--------  138

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
                             RELL+GPLYY + + +   V+WR SPI +  +  +C GDG+AD
Sbjct  139  -----------------RELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIAD  181

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL-GFLVV  232
            I+GRR  S KLP+N+ KS+AGSI+M  FGFL SIG +HYFS+ G  +      +    ++
Sbjct  182  IMGRRFGSLKLPYNQQKSWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALI  241

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P +  +DDN++VPLAS++
Sbjct  242  SLVATVVESLPTTKVVDDNISVPLASMV  269



>ref|XP_008795886.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=309

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 140/217 (65%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA +P +N  +L+  GL 
Sbjct  93   DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSIEARYFAAFVPLVNCIRLVTYGLR  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  153  IFSDEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG----QLEKTPHMVLGF  241
            I+GRR  + KLP+N+ KS+ GSI+M  FGF  SIG ++YFS+FG      +K    V   
Sbjct  213  ILGRRYGATKLPYNRQKSWIGSISMFIFGFFFSIGMLYYFSAFGCFHLDWDKAVERV---  269

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             VVSLAA +VES P++  +DDN++VPL S+L  S +F
Sbjct  270  AVVSLAATVVESLPVTEFVDDNISVPLTSMLTASLLF  306



>ref|XP_002500009.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61267.1| predicted protein, partial [Micromonas sp. RCC299]
Length=235

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 133/215 (62%), Gaps = 2/215 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A +   ++ L+RK++H + G  F L WP+FSS       AA +P L   +L  +G G
Sbjct  21   DVLASKKILERKLSRKVIHTTSGPFFALTWPLFSSSPAACYFAACVPALQAVRLFGIGSG  80

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++K++  V+++SR GD  ELLKGPL Y I + +  A+YWR SP  +A +  +C GDGMAD
Sbjct  81   LIKNENAVRAVSREGDKGELLKGPLIYTIVLVVTTALYWRGSPEGVAALALMCGGDGMAD  140

Query  408  IIGRRIRS-PKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            I+GRR+ +  KLP N++KS AGS+A    GF  S+GF+  F   G +E       G L V
Sbjct  141  IVGRRLGAGNKLPFNEDKSAAGSLAFFIVGFGMSVGFVALFHHLGYMEMDAGAAAGRLAV  200

Query  231  SLAAALV-ESHPLSTELDDNLTVPLASVLAGSCIF  130
              AA  V E+ P++  LDDN++VP+ +++ GS +F
Sbjct  201  LAAACTVAEALPVTGVLDDNISVPVLALVLGSFLF  235



>ref|XP_002968111.1| hypothetical protein SELMODRAFT_440293 [Selaginella moellendorffii]
 gb|EFJ30365.1| hypothetical protein SELMODRAFT_440293 [Selaginella moellendorffii]
Length=195

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 125/195 (64%), Gaps = 1/195 (1%)
 Frame = -2

Query  711  VSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRE  532
            ++ G +FML WP+FSS      + +L+P  N  +LL+LGLG+  ++G VKSMSR GD +E
Sbjct  1    MTTGPLFMLSWPLFSSSSASRYICSLVPLANAVRLLILGLGLRTNEGVVKSMSRDGDAKE  60

Query  531  LLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSF  352
            LL+GPLYY   + ++   +WR SP+ +  +  +C GDG+ADIIGR+    KLP+N+ KS+
Sbjct  61   LLRGPLYYVAVLFISTVCFWRDSPVGMIALSVMCGGDGIADIIGRKFGREKLPYNEKKSW  120

Query  351  AGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV-VSLAAALVESHPLSTELDDN  175
            AGS AM   G   S   ++YF+  G     P   L  +  +SLAA LVES P+++ LDDN
Sbjct  121  AGSTAMFVCGTALSFASIYYFTYLGFYALDPLDTLARVTFISLAATLVESLPITSSLDDN  180

Query  174  LTVPLASVLAGSCIF  130
            L VP  ++L GS +F
Sbjct  181  LMVPTTAMLLGSILF  195



>gb|KCW65250.1| hypothetical protein EUGRSUZ_G02725 [Eucalyptus grandis]
Length=180

 Score =   147 bits (371),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = -2

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            D G VKS++R G  +ELL+GPLYY + + L   VYWR SP  +  +  +C GDG+ADIIG
Sbjct  28   DKGLVKSVTREGSPQELLRGPLYYVLILILCAIVYWRESPTGVISLAMMCGGDGIADIIG  87

Query  399  RRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VVSLA  223
            RR  S KLP+N  KS+AGSI+M   GFL SIG + YFSS G  +    M L  + +VSL 
Sbjct  88   RRFGSQKLPYNHKKSWAGSISMFVCGFLISIGMLCYFSSLGYFQLDWTMTLQRVALVSLV  147

Query  222  AALVESHPLSTELDDNLTVPLASVL  148
            A +VES P++  LDDN++VPL+S+L
Sbjct  148  ATVVESLPITEVLDDNISVPLSSML  172



>ref|XP_004960241.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=300

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 135/216 (63%), Gaps = 1/216 (0%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            + +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL + 
Sbjct  84   LTERRLVEKSLSRKIVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLTYGLRLS  143

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+  VKS++R G   ELL+GPLYY + +  +  V+WR S I I  +  +  GDG ADI+
Sbjct  144  TDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESAIGIVSLSMMSGGDGFADIV  203

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VVSL  226
            GRR  S KLP N+ KS+ GSI+M   GFL S   + YFSS G +  +     G L +V+L
Sbjct  204  GRRYGSVKLPFNEKKSWIGSISMFISGFLLSAIMLFYFSSLGYIHVSWEEAFGKLALVAL  263

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF*SRT  118
            AA +VE  P+   +DDN++VPLA++L    +F S T
Sbjct  264  AATVVECIPVIDVVDDNISVPLATMLVAFLLFGSNT  299



>emb|CDP04896.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  705  MGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGD-YREL  529
            MG+VF LCWP FSSG QG  +AA++PG N FK+LLLGL + KD+  VK MS  GD YR++
Sbjct  1    MGLVFTLCWPRFSSGNQGGFLAAMVPGFNAFKMLLLGLEMRKDEKAVKLMSGLGDHYRQI  60

Query  528  LKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFA  349
            LK   Y+   I+LA  VYWR+SP+A+A VC LCAGD +A I+GRR  S KLP+NKNKS A
Sbjct  61   LKASFYFLTAISLASVVYWRTSPVAVAAVCKLCAGDRIAPIVGRRFGSLKLPYNKNKSIA  120

Query  348  GSIAMAAFGFLASIGF  301
            G+IAM A  FLASI F
Sbjct  121  GTIAMVAASFLASIFF  136



>ref|XP_003080172.1| Predicted ER membrane protein (ISS) [Ostreococcus tauri]
 emb|CAL54339.1| Phosphatidate cytidylyltransferase [Ostreococcus tauri]
Length=298

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 121/211 (57%), Gaps = 1/211 (0%)
 Frame = -2

Query  759  AKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLK  580
            A  G F    +RKLVHV+ G+ F   WP+FS+       A  IP +   +L  +G GI+K
Sbjct  88   ADAGTFASTTSRKLVHVTSGVGFACAWPLFSAAASAKAFACAIPVIQGARLFGIGSGIIK  147

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            ++  V+++SR G   ELLKGPLYY   ++   + YWR+SPI I  +  +C GDG ADI+G
Sbjct  148  NESAVRAVSRAGGKEELLKGPLYYTAALSALTSGYWRTSPIGIVAIAMMCGGDGFADIVG  207

Query  399  RRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            RR      LP N +KSFAGS    A GF  + G + YF  FG +E T         +S A
Sbjct  208  RRFGEGNALPWNGDKSFAGSAGFVAGGFGIASGLLAYFQHFGFIETTGSTYAATFAISCA  267

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             ALVES P+S+ LDDN TV   +V  G+ +F
Sbjct  268  CALVESLPVSSVLDDNFTVVFTAVALGTLLF  298



>sp|Q2N2K3.1|PHYK_WHEAT RecName: Full=Probable phytol kinase, chloroplastic; Flags: Precursor 
[Triticum aestivum]
 gb|ABA42674.1| phytol kinase [Triticum aestivum]
Length=300

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 132/214 (62%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RK+VHV  G+ FM  WP+FS+       AA++P LN  +LL  GLG
Sbjct  82   DALTERRLVQQSLSRKVVHVLSGVFFMASWPLFSNSTSARFFAAVVPFLNCVRLLTYGLG  141

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               D+  VKS++R G   ELL+GPLYY I + +   V+WR SPI I  +  +  GDG AD
Sbjct  142  FYSDEALVKSVTREGKREELLRGPLYYVIVLLIIVLVFWRDSPIGIVSLSMMSGGDGFAD  201

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV-V  232
            I+GRR  S KLP NK KS+ GS AM   GFL S   + YFS  G +  +    LG LV V
Sbjct  202  IVGRRFGSLKLPFNKKKSWVGSAAMFISGFLLSALMLSYFSWLGYIHVSWDQALGKLVLV  261

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  262  ALAATVVECIPVTDVVDDNISVPLATMLVAFLLF  295



>ref|XP_011094482.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Sesamum indicum]
Length=221

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS+SR G   ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+ADI+
Sbjct  68   TDEGLIKSVSREGKPEELLRGPLYYVLVLILCAIVFWRESPVGMISLAMMCGGDGIADIM  127

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VVSL  226
            GRR  S K+P+N  KS+AGSI+M  FGFL SIG ++YF+  G ++      L  + +VS 
Sbjct  128  GRRFGSVKIPYNPQKSWAGSISMFLFGFLVSIGMLYYFAVLGYIQLEWMQTLERVALVSF  187

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             A L+ES P +  +DDN++VPLAS++    +F
Sbjct  188  VATLIESLPTTGIVDDNISVPLASMVTSLLVF  219



>gb|EYU39693.1| hypothetical protein MIMGU_mgv1a014475mg [Erythranthe guttata]
Length=188

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G  KS+SR G   ELLKGPLYY + + L   ++WR SPI +  +  +C GDG+ADI+
Sbjct  36   TDEGLTKSVSRLGKPEELLKGPLYYVLVLILCAILFWRESPIGMISLAMMCGGDGIADIM  95

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLVVS  229
            GRR  S K+P+N  KS AGSI+M  FGFL SIG ++YF + G  QLE  P  V    +V+
Sbjct  96   GRRFGSVKIPYNPEKSLAGSISMFLFGFLVSIGMLYYFVALGYIQLEWVPT-VERVALVA  154

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              A LVES P +  +DDN++VPLAS++    +F
Sbjct  155  FVATLVESLP-NRIVDDNISVPLASMVTSFLVF  186



>sp|Q2N2K2.1|PHYK2_SOYBN RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42675.1| phytol kinase [Glycine max]
Length=292

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 133/214 (62%), Gaps = 12/214 (6%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL+ GL 
Sbjct  82   DELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLIYGLR  141

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+             ELL+GPLYY + +  +  V+WR SPI I  +  +  GDG AD
Sbjct  142  LYTDEAL-----------ELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFAD  190

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +V
Sbjct  191  IVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLALV  250

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  251  ALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  284



>ref|XP_008795887.1| PREDICTED: probable phytol kinase, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=280

 Score =   142 bits (358),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 126/217 (58%), Gaps = 36/217 (17%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+FS                          
Sbjct  93   DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFS--------------------------  126

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  127  ---DEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFAD  183

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG----QLEKTPHMVLGF  241
            I+GRR  + KLP+N+ KS+ GSI+M  FGF  SIG ++YFS+FG      +K    V   
Sbjct  184  ILGRRYGATKLPYNRQKSWIGSISMFIFGFFFSIGMLYYFSAFGCFHLDWDKAVERV---  240

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             VVSLAA +VES P++  +DDN++VPL S+L  S +F
Sbjct  241  AVVSLAATVVESLPVTEFVDDNISVPLTSMLTASLLF  277



>ref|XP_010556037.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=85

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  558  MSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPK  379
            MSR GD RELLKGPLYYA +ITLAC  YWR+SPIAIA++CNLCAGDGMADI+GRR+ + K
Sbjct  1    MSRHGDRRELLKGPLYYASSITLACVFYWRTSPIAIAVICNLCAGDGMADIVGRRLGTEK  60

Query  378  LPHNKNKSFAGSIAMAAFGFLASI  307
            LP+N++KS AGSIAMA  GF AS+
Sbjct  61   LPYNRSKSIAGSIAMATSGFTASV  84



>ref|XP_006436583.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 ref|XP_006485241.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR49823.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 gb|KDO55302.1| hypothetical protein CISIN_1g022218mg [Citrus sinensis]
Length=280

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 106/153 (69%), Gaps = 3/153 (2%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KDDG +KS++R G+ +ELL+GPLYY + + L+  V+WR SP+ +  +  +C GDG+AD+I
Sbjct  127  KDDGLIKSVTREGNPKELLRGPLYYVLMLILSALVFWRDSPVGVISLSMMCGGDGIADVI  186

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLVVS  229
            GRR  S K+ +N+ KS+AGSI+M  FGFL S G ++++S  G  QL+     +    +VS
Sbjct  187  GRRFGSMKIFYNEKKSWAGSISMFVFGFLVSTGMLYFYSILGYYQLDWI-ETLQRVALVS  245

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            L A +VES P++  +DDN++VPLAS++A    F
Sbjct  246  LVATVVESLPITEVVDDNISVPLASMVAAYLSF  278



>ref|XP_002955247.1| hypothetical protein VOLCADRAFT_45651 [Volvox carteri f. nagariensis]
 gb|EFJ43766.1| hypothetical protein VOLCADRAFT_45651 [Volvox carteri f. nagariensis]
Length=198

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 123/198 (62%), Gaps = 3/198 (2%)
 Frame = -2

Query  738  QNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKS  559
            Q L+RKLVH + G +F+L W +FS+      +AA++P LN  +L+ +G G++ D G VKS
Sbjct  1    QKLSRKLVHTTTGPIFVLTWILFSASPDARYLAAVVPMLNFSRLMAVGTGLISDPGLVKS  60

Query  558  MSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRI-RSP  382
            +SR GD  ELLKGPL+Y +T+  A  + WR +P  +  V  +C GDG+ADI+GRR     
Sbjct  61   VSRSGDRGELLKGPLFYVVTLVAATVLCWRDNPAGLIAVAMMCGGDGLADIVGRRWGGGA  120

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP--HMVLGFLVVSLAAALVE  208
            KLP NK KS+AGS AM   GF  S G +  F + G     P   M+     V+L A +VE
Sbjct  121  KLPINKAKSWAGSFAMLLGGFGMSYGLISLFCNLGFFSCYPPATMLSCLGAVALGATIVE  180

Query  207  SHPLSTELDDNLTVPLAS  154
            + P++  +DDN++VP+ +
Sbjct  181  ALPINQYVDDNVSVPVVA  198



>ref|XP_002532923.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
 gb|EEF29465.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
Length=249

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q L+RKLVH+  G++F + WP+FS+  +    A+++P +N  +L++ GL 
Sbjct  93   DTLTQRNIIQQTLSRKLVHILSGLLFAVSWPIFSNSVEARYFASIVPLVNCLRLVINGLT  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R G+ +ELL+GPLYY + +     V+WR SP+ +  +  +C GDG+AD
Sbjct  153  LATDEGLIKSVTREGNPKELLRGPLYYVLVLIFCALVFWRESPVGVMALAMMCGGDGVAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGF  301
            I+GRR  S KLPHN  KS+AGSI+M   GFL SIGF
Sbjct  213  IMGRRFGSAKLPHNHQKSWAGSISMFISGFLISIGF  248



>ref|XP_001694607.1| phytol kinase-related protein [Chlamydomonas reinhardtii]
 gb|EDP02602.1| phytol kinase-related protein [Chlamydomonas reinhardtii]
Length=304

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 122/201 (61%), Gaps = 3/201 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A  G  +Q L+RKLVH + G +F+L W +FS+     ++AA++P LN  +L  +G G
Sbjct  74   DYLAANGTLEQKLSRKLVHTTTGPIFVLTWALFSANPMARVLAAVVPMLNFMRLFAVGTG  133

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ D G V S+SR GD  ELLKGPL+Y +T+  A  + WR +P  +  V  +C GDG+AD
Sbjct  134  LVSDPGLVNSVSRSGDRTELLKGPLFYVVTLVAATVLCWRDNPAGLIAVSMMCGGDGLAD  193

Query  408  IIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL-GFL-  238
            I+GRR+ R   LP+N  KS AGS+AM   G+  + G +  F   G     P   L G L 
Sbjct  194  IVGRRLGRGNPLPYNTQKSVAGSVAMLVGGYGMAYGLISLFCGLGFFACYPPATLFGCLG  253

Query  237  VVSLAAALVESHPLSTELDDN  175
             V+LAA  VES P++  +DDN
Sbjct  254  AVALAATAVESLPINKWVDDN  274



>ref|XP_010665628.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=296

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            D+G +KS++R G   ELL GPLYY +T+ +   V+WR SP+ +  +  +C GDG+ADI+G
Sbjct  144  DEGLIKSVTREGKPEELLTGPLYYVLTLAVCAIVFWRESPVGLLSLAMMCGGDGVADIMG  203

Query  399  RRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHM-VLGFLVVSLA  223
            R+    KLP+N+ KS+AGSI+M AFGFL SIG ++Y+S+ G  +   ++  +   VV   
Sbjct  204  RKFGHVKLPYNQKKSWAGSISMFAFGFLISIGMLYYYSALGYFQLDWNITTIRVAVVCFI  263

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A +VES P +  +DDN++VPL ++L     F
Sbjct  264  ATIVESLPTTEIIDDNISVPLVTLLTAYICF  294



>ref|XP_004344106.1| phytol kinase 2, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR20703.1| phytol kinase 2, putative [Acanthamoeba castellanii str. Neff]
Length=238

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 126/211 (60%), Gaps = 12/211 (6%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E +  RG    N  RK +HV  G +F+LCW  F    Q    AA++PGL   +  LLGLG
Sbjct  24   ETLRDRGVLSANACRKWIHVGTGPLFILCWLAFPQDAQARYWAAVVPGLITLRFALLGLG  83

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +LKD+ TV+S+SR GD  ELLKGPL Y I   +   VYWR S + I+++  LCAGDG AD
Sbjct  84   VLKDEKTVRSLSRTGDRTELLKGPLIYGIIFVVCTCVYWRDSSVGISILLILCAGDGFAD  143

Query  408  IIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFM----HYFSSFGQLEKTPHMVLG  244
            + GR+   + +LPHN++KS+AGS A     F+AS+ F     H F + G L       L 
Sbjct  144  LAGRKYGGAARLPHNRSKSWAGSCAF----FVASLAFQCAYAHLFHAQGWLRVGLAQSLP  199

Query  243  FLV-VSLAAALVESHPLSTELDDNLTVPLAS  154
             +V V+L + +VES P+S    DNLTV LA+
Sbjct  200  TIVAVTLVSTVVESLPVSDW--DNLTVSLAA  228



>gb|ACG23902.1| hypothetical protein [Zea mays]
Length=259

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 115/214 (54%), Gaps = 45/214 (21%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R   +++L+RK+VHV  G++FM  WP+F                           
Sbjct  82   DELTERRLIEKSLSRKVVHVLSGVLFMSSWPLF---------------------------  114

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
                             RELL+GPLYY + +  +  V+WR SPI I  +  +  GDG AD
Sbjct  115  -----------------RELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFAD  157

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +V
Sbjct  158  IVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLALV  217

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  218  ALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  251



>ref|XP_003057921.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57872.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=248

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 122/202 (60%), Gaps = 2/202 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A     ++ L+RKL+H S G  F+L WP+FS+       AA +P L   +L+ +G+G
Sbjct  34   DVLASNDVLERKLSRKLIHTSCGPFFVLLWPLFSASPSAKYFAAAVPVLQGIRLMAIGVG  93

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
             ++++  ++++SR GD  ELL+GPLYY   + +  AV+WR SP  IA +  +C GDG+AD
Sbjct  94   AIENEDAIRAVSREGDRTELLRGPLYYTAVLVVCTAVFWRGSPSGIAALSLMCGGDGLAD  153

Query  408  IIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            I+GRR+ +   LP N +KS+AGS AM   GF  S+    +F + G +   P    G L +
Sbjct  154  IVGRRLGKGNPLPFNADKSYAGSAAMFLGGFGLSLALCAFFHALGYMSVDPGSAAGRLAL  213

Query  234  VSLAAALVESHPLSTELDDNLT  169
            ++ A   +E+ P  + LDDN++
Sbjct  214  IAAACTAIEALPAGSFLDDNIS  235



>ref|XP_008668661.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Zea 
mays]
 tpg|DAA35441.1| TPA: hypothetical protein ZEAMMB73_657762 [Zea mays]
Length=259

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 115/214 (54%), Gaps = 45/214 (21%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+ +R   +++L+RK+VHV  G++FM  WP+F                           
Sbjct  82   DELTERRLIEKSLSRKVVHVLSGVLFMSSWPLF---------------------------  114

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
                             RELL+GPLYY + +  +  V+WR SPI I  +  +  GDG AD
Sbjct  115  -----------------RELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFAD  157

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +V
Sbjct  158  IVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLALV  217

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  218  ALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  251



>ref|WP_012164598.1| phosphatidate cytidylyltransferase [Acaryochloris marina]
 gb|ABW29270.1| phosphatidate cytidylyltransferase [Acaryochloris marina MBIC11017]
Length=244

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 124/214 (58%), Gaps = 3/214 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A  G  +Q L+RK++H+  G +F+LCWP FS        AAL+P     + + +G+G
Sbjct  33   DALAANGILEQKLSRKIIHMGTGPLFVLCWPFFSPQPTACYFAALVPLAITLQFIGIGVG  92

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
             ++D   V++M+R G+ +E+LKGPL+Y +   +    +WR+SP+ +  +  +C GDG+AD
Sbjct  93   WIQDPDAVQAMTRTGNPKEILKGPLFYGLVFVVCTIGFWRTSPVGMLALMMMCGGDGLAD  152

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR+   KLP +  KS+AGS AM A  FL +  F+  F+     +      +G +  +
Sbjct  153  IVGRRLGVHKLPFSPEKSWAGSAAMFAGSFLFAFSFLSLFNRLNYFQPPLVGTVGIVAAI  212

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +L A LVES P      DNLT+   +V+ G   F
Sbjct  213  ALIATLVESLPFRD--IDNLTLTGVAVVLGLWWF  244



>ref|WP_010480729.1| phosphatidate cytidylyltransferase [Acaryochloris sp. CCMEE 5410]
Length=244

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 127/215 (59%), Gaps = 5/215 (2%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A  G  +Q L+RK++H+  G +F+LCWP FS        AAL+P     + + +G+G
Sbjct  33   DALAANGMLEQKLSRKIIHMGTGPLFVLCWPFFSPQPTARYFAALVPLAITLQFIAIGVG  92

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV-YWRSSPIAIALVCNLCAGDGMA  412
             ++D   V++M+R G+ +E+LKGPL+Y + + +AC + +WR+SP+ +  +  +C GDG+A
Sbjct  93   WIQDPDAVQAMTRTGNPKEILKGPLFYGL-VFVACTIGFWRTSPVGMLALMMMCGGDGLA  151

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR+   KLP +  KS+AGS AM A  FL +  F+  F+     +      +G +  
Sbjct  152  DIVGRRLGVHKLPFSPEKSWAGSAAMFAGSFLFAFSFLSLFNRLNYFQPPLAGTIGIVAA  211

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            ++L A LVE+ P      DNLT+   +V  G   F
Sbjct  212  IALIATLVEALPFRD--IDNLTLTGVAVALGLWWF  244



>gb|AFW64553.1| hypothetical protein ZEAMMB73_110888 [Zea mays]
Length=214

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI 
Sbjct  102  KAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVADIA  161

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFS  286
            GRR    KLPHN  KS+AGSIAM   GF+AS+ + +  S
Sbjct  162  GRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLYANRLS  200



>ref|XP_004960242.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=289

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 129/218 (59%), Gaps = 12/218 (6%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL 
Sbjct  82   DVLTERRLVEKSLSRKIVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLTYGLR  141

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+             ELL+GPLYY + +  +  V+WR S I I  +  +  GDG AD
Sbjct  142  LSTDEAL-----------ELLRGPLYYVLVLLFSVLVFWRESAIGIVSLSMMSGGDGFAD  190

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP N+ KS+ GSI+M   GFL S   + YFSS G +  +     G L +V
Sbjct  191  IVGRRYGSVKLPFNEKKSWIGSISMFISGFLLSAIMLFYFSSLGYIHVSWEEAFGKLALV  250

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*SRT  118
            +LAA +VE  P+   +DDN++VPLA++L    +F S T
Sbjct  251  ALAATVVECIPVIDVVDDNISVPLATMLVAFLLFGSNT  288



>ref|WP_013560255.1| phosphatidate cytidylyltransferase [Anaerolinea thermophila]
 dbj|BAJ63878.1| putative phosphatidate cytidylyltransferase [Anaerolinea thermophila 
UNI-1]
Length=233

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 120/214 (56%), Gaps = 3/214 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A RG+   +L+RK++H+  G +F+LCW  F +      +AAL+P L   +  L+G G
Sbjct  22   DYLAYRGWVSSSLSRKIIHLGTGPIFVLCWLFFPNTPLSKWLAALVPLLITLQFFLVGTG  81

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
             ++D   V +MSR GD RE+L+GPLYY +   L   ++W+ SPI +  +  L  GDG+AD
Sbjct  82   WIRDPQAVSAMSRTGDRREILRGPLYYGVVFVLLTLIFWKDSPIGVVALMILSGGDGLAD  141

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            IIG+R  S  L  +  K+  GS+++   G   SI  +  F   G  + +     L  + +
Sbjct  142  IIGKRFPSSSLAWSPRKTVWGSLSVFVGGVFFSILVLSVFRLLGVFQFEWWDTFLKVVGI  201

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             +AA +VES P      DNLTVPL SV  G  +F
Sbjct  202  GIAATVVESLPFQDI--DNLTVPLVSVFLGYFLF  233



>ref|WP_040625197.1| phosphatidate cytidylyltransferase [Smithella sp. ME-1]
Length=233

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 122/218 (56%), Gaps = 11/218 (5%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +  A +G   + L+RK++H+  G +F+L W +F        +AA+IP     +  L+G+G
Sbjct  22   DYFASKGLISKKLSRKIIHIGTGPIFVLSWLLFPEDPLSRYLAAIIPLFITIQFFLIGIG  81

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ D  +V +MSR GD +E+LKGP +Y +   L   ++WR SPI I  +  LC GDG AD
Sbjct  82   VINDQASVDAMSRTGDPKEILKGPFFYGVIFVLLTILFWRESPIGIIALMILCGGDGFAD  141

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL-----EKTPHMVLG  244
            II RR+ S  L  +  KSFAG+I+M   G + S   +  F  FG L     +  P +   
Sbjct  142  IISRRVPSFALKWSPGKSFAGTISMFFGGLIFSSILIFIFIKFGFLNIIFWDGFPKI---  198

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             L++++ A +VES PL     DN+TVP   VL G  +F
Sbjct  199  -LLLNILATIVESLPLRDW--DNITVPAIVVLDGLILF  233



>ref|XP_005645987.1| hypothetical protein COCSUDRAFT_53992 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21443.1| hypothetical protein COCSUDRAFT_53992 [Coccomyxa subellipsoidea 
C-169]
Length=238

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 122/214 (57%), Gaps = 6/214 (3%)
 Frame = -2

Query  759  AKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLK  580
            ++R   DQ L+RK++H+  G++F+L WP ++       + A +P +      ++GLG + 
Sbjct  25   SRRKVMDQTLSRKVMHIGNGILFVLFWPCYTEHAVSKYLCASVPLVAALHFAMVGLGAVT  84

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            D+  V S +R GD RELL+GPL Y   I     ++WR SP  +  +  LCAGDG+ADI+G
Sbjct  85   DESLVASATRTGDRRELLRGPLLYGTIIGTLTIIFWRESPSGVTAIAVLCAGDGLADIVG  144

Query  399  RRIRSP-KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEK---TPHMVLGFLVV  232
            RR+ +  +LP++ +KS AGS+A    G +A+   + Y   +  L +   T  + LG ++ 
Sbjct  145  RRLGAANRLPYSPDKSAAGSMACFLGGAVAAGACLVYLRKWNCLSQELGTWEIALGSIIT  204

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +   A VES PL+    DN TVPLA+ L     F
Sbjct  205  AGVGAAVESLPLAEV--DNWTVPLAAALTARAFF  236



>ref|XP_008795889.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X4 
[Phoenix dactylifera]
Length=265

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 116/217 (53%), Gaps = 51/217 (24%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+F                           
Sbjct  93   DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIF---------------------------  125

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
                             RELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  126  -----------------RELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFAD  168

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG----QLEKTPHMVLGF  241
            I+GRR  + KLP+N+ KS+ GSI+M  FGF  SIG ++YFS+FG      +K    V   
Sbjct  169  ILGRRYGATKLPYNRQKSWIGSISMFIFGFFFSIGMLYYFSAFGCFHLDWDKAVERV---  225

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             VVSLAA +VES P++  +DDN++VPL S+L  S +F
Sbjct  226  AVVSLAATVVESLPVTEFVDDNISVPLTSMLTASLLF  262



>ref|XP_007514499.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14739.1| predicted protein [Bathycoccus prasinos]
Length=345

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 127/228 (56%), Gaps = 19/228 (8%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E+A+R   +  L+RKLVHV+ G  F + W +F         A L+P L  F+L  +G G
Sbjct  121  DELARREILEAKLSRKLVHVTSGTFFAMTWCLFGDQWYSKAFATLVPSLQAFRLFAIGSG  180

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++++   V+++SR G   ELL GP YY I + +   ++WR SP+   +V  +C GDG+AD
Sbjct  181  LIENKNAVRAVSRGGGKEELLYGPFYYTIVLMVTTLLFWRESPVGFLVVSLMCGGDGVAD  240

Query  408  IIGRRI-----RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLG  244
            I+GRR+     + PK P ++ KSFAGS AM   GFL ++   H F   G      + V G
Sbjct  241  IVGRRLGKTGKKWPK-PFDERKSFAGSAAMVITGFLFTVSLTHLFGVMGFFPN--NRVFG  297

Query  243  ----------FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
                       L+  L+ A+VE+ P ++++DDN++V   + L GS  F
Sbjct  298  GPDDIGYYAVILLACLSCAVVEALP-ASKVDDNISVAAVAALLGSLAF  344



>ref|XP_008218941.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Prunus mume]
Length=239

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RKLVH+  G++FML WP+FS+       A+++P +N  +LLL GL 
Sbjct  93   DNLTQRNLLQQSLSRKLVHILSGLLFMLSWPIFSTSTAARYFASVVPLVNCLRLLLHGLS  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I+ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+AD
Sbjct  153  IVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGVVSLAMMCGGDGVAD  212

Query  408  IIGRRIRSPKLPHNKNKSFA  349
            I+GR+  S K+P+N+ KS+A
Sbjct  213  IMGRKFGSIKIPYNQKKSWA  232



>ref|XP_006653001.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Oryza 
brachyantha]
Length=194

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 113/188 (60%), Gaps = 1/188 (1%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            M  WP+FS+       AA++P LN  +LL  GL +  D+  VKS++R G   ELL+GPLY
Sbjct  1    MSSWPLFSNSPGARFFAAIVPLLNCIRLLTYGLRLSTDEALVKSVTREGKPEELLRGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y I + ++  V+WR SPI I  +  +  GDG ADI+GRR  S KLP NK KS+ GSI+M 
Sbjct  61   YVIVLLVSVLVFWRESPIGIISLSMMSGGDGFADIVGRRFGSMKLPFNKKKSWIGSISMF  120

Query  330  AFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLAS  154
              G+L S   + YFS  G         +    + +LAA +VE  P++  +DDN++VPLA+
Sbjct  121  ISGYLLSALMLFYFSCLGYFNVCWELALGKLALAALAATVVECIPVTDVVDDNISVPLAT  180

Query  153  VLAGSCIF  130
            +LA   +F
Sbjct  181  MLAAFLLF  188



>dbj|GAM20177.1| hypothetical protein SAMD00019534_033520, partial [Acytostelium 
subglobosum LB1]
Length=227

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 114/201 (57%), Gaps = 5/201 (2%)
 Frame = -2

Query  738  QNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVA-AlipglnifkllllglgiLKDDGTVK  562
            Q L+ + +H+  G V++ CW ++      A  A A++P   + +  L+GLG++KD+  VK
Sbjct  23   QTLSAQKIHIGTGFVYICCWGLYYKDDIYAKYAVAMVPAGVVLQFSLIGLGLIKDEKAVK  82

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            SMSR G   ELL GP+ Y I I L+  +YW  SPI I     LC GDG A ++G  I   
Sbjct  83   SMSRSGAPHELLYGPVTYGIVIVLSTIIYWVDSPIGITATSVLCCGDGFAGLVGEAIGKH  142

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL--GFLVVSLAAALVE  208
            +LP+NK+KS  G++A  A  F+ SI ++    S+G L +   +      L+V +   LVE
Sbjct  143  RLPYNKHKSMNGTMAFFAASFVGSIVYLMIIQSYGYLAQLSILAFIPSLLLVCIVCTLVE  202

Query  207  SHPLSTELDDNLTVPLASVLA  145
            S P+     DN+TV L+ V+A
Sbjct  203  SLPIDNW--DNVTVFLSCVVA  221



>gb|EWM28810.1| Phosphatidate cytidylyltransferase [Nannochloropsis gaditana]
Length=344

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 118/228 (52%), Gaps = 23/228 (10%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
              +A  G  D   +RKL+H   G +F+LCWP FS+     L AA +P L I  ++  GL 
Sbjct  116  TSLAISGAIDSKDSRKLIHCGSGPLFLLCWPFFSAEGTARLFAAGVPLLQIVAMIASGLA  175

Query  588  iL------------------KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSS  463
                                K  G V ++SR G+  E+L+GPL Y + + LA  V+WR S
Sbjct  176  KAPSPAKNDSGIRAGESAMGKPSGLVAAISRSGNPAEVLRGPLIYVVILLLATVVFWRES  235

Query  462  PIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSS  283
             + +  V  + AGDGMADI+GRR  + K   +  KS+AGS A A  GF+ S+  + +F+ 
Sbjct  236  VVGLVAVAQMAAGDGMADIVGRRWGAQKWSFSSTKSYAGSSAFALSGFVVSVALIAWFNF  295

Query  282  FGQLEK-TPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPL-ASVLA  145
            +G +   T  +     ++S+  A VE  P     DDN+ VP+ AS LA
Sbjct  296  WGLVPALTAGVACKVALISILCAAVELVPWG---DDNIFVPMVASALA  340



>ref|XP_005854647.1| hypothetical protein NGA_2086500 [Nannochloropsis gaditana CCMP526]
 gb|EKU21713.1| hypothetical protein NGA_2086500 [Nannochloropsis gaditana CCMP526]
Length=344

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 118/228 (52%), Gaps = 23/228 (10%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
              +A  G  D   +RKL+H   G +F+LCWP FS+     L AA +P L I  ++  GL 
Sbjct  116  TSLAISGAIDSKDSRKLIHCGSGPLFLLCWPFFSAEGTARLFAAGVPLLQIVAMIASGLA  175

Query  588  iL------------------KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSS  463
                                K  G V ++SR G+  E+L+GPL Y + + LA  V+WR S
Sbjct  176  KAPSPAKNDSGIGAGESAMGKPSGLVAAISRSGNPAEVLRGPLIYVVILLLATVVFWRES  235

Query  462  PIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSS  283
             + +  V  + AGDGMADI+GRR  + K   +  KS+AGS A A  GF+ S+  + +F+ 
Sbjct  236  VVGLVAVAQMAAGDGMADIVGRRWGAQKWSFSSTKSYAGSSAFALSGFVVSVALIAWFNF  295

Query  282  FGQLEK-TPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPL-ASVLA  145
            +G +   T  +     ++S+  A VE  P     DDN+ VP+ AS LA
Sbjct  296  WGLVPALTAGVACKVALISILCAAVELVPWG---DDNIFVPMVASALA  340



>ref|XP_008795888.1| PREDICTED: probable phytol kinase, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=278

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 92/142 (65%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA +P +N  +L+  GL 
Sbjct  93   DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSIEARYFAAFVPLVNCIRLVTYGLR  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  153  IFSDEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGS  343
            I+GRR  + KLP+N+ KS+ GS
Sbjct  213  ILGRRYGATKLPYNRQKSWIGS  234



>gb|KCW54678.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=185

 Score = 97.8 bits (242),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALIPG+NI ++LLLG G
Sbjct  29   EETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALIPGVNIIRMLLLGSG  88

Query  588  iLKDDGTVKSMSRFGDYR  535
            I KD+ TVKSM+RFGD R
Sbjct  89   IWKDEATVKSMTRFGDRR  106


 Score = 48.5 bits (114),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = -3

Query  551  DLETTGNF*RGLYTMLSQSLWLVLSIGEVPQLQLP*FATSVLVTVWLTLSAGGSEARSFP  372
            D   +GNF +G Y+M SQS  L   IG + Q QL  +ATS    V  T S GG     FP
Sbjct  120  DRGESGNFLKGRYSMFSQSHLLARIIGGLRQSQLQQYATSAPEMVLRTSSEGGLANIKFP  179

Query  371  TTRTNP  354
            TT TNP
Sbjct  180  TTVTNP  185



>ref|XP_005706670.1| phosphatidate cytidylyltransferase/ phytol kinase [Galdieria 
sulphuraria]
 gb|EME30150.1| phosphatidate cytidylyltransferase/ phytol kinase [Galdieria 
sulphuraria]
Length=332

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 114/213 (54%), Gaps = 7/213 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A + + ++ ++RK+VH++   +F+L WP F+    G+   A +  L +   L +   
Sbjct  118  QWVASKNWIERTISRKIVHMTCTPLFVLTWPFFTDS-SGSRWVACLVPLIMGLRLWIAGK  176

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
                D   K +SR G   E LKGPLYY I   L     W+ SP+ I  +  LC GDG A+
Sbjct  177  GWSSDTISKIVSRKGSIEEALKGPLYYVIVTFLVTLFCWKDSPLGIVALMQLCLGDGFAE  236

Query  408  IIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG-QLEKTPHM-VLGFL  238
            ++GRR  +S   P  ++KS  G++A +  GFLAS   + YF+  G +   T  +     L
Sbjct  237  VVGRRWGKSLTWPFCRDKSVIGTLAFSIAGFLASYCAVVYFNIVGMKFYGTEELSTFSLL  296

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGS  139
            +++LA + VE   L    DDN +VPL ++L G+
Sbjct  297  IITLACSAVE---LVNFWDDNFSVPLMAILIGA  326



>ref|XP_005850569.1| hypothetical protein CHLNCDRAFT_140477 [Chlorella variabilis]
 gb|EFN58467.1| hypothetical protein CHLNCDRAFT_140477 [Chlorella variabilis]
Length=286

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 117/246 (48%), Gaps = 45/246 (18%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            + + G     L RK++H+  G ++MLCWP++S+      +AA +P L   + +L+G GI+
Sbjct  31   VGRLGLLPTRLARKMMHIGTGPLYMLCWPLYSAAPSSRWLAASVPALAGVQFMLVGTGIV  90

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            +DD  V   SR G   ELL+GPL YA     A  ++WR SP  +  +  LCAGDG+A+++
Sbjct  91   RDDTLVAGASRSGRREELLRGPLLYAAVHVAATLIWWRHSPCGVLALAILCAGDGLAEVV  150

Query  402  GR--------------------------------RIRSPKLPHNKNKSFAGSIAMAAFGF  319
            GR                                R  +  LPHN +K+  G++A    G 
Sbjct  151  GRACSSAAASADAPARGGKKGSVDSGSTWRRSVLRALARPLPHNCDKTVGGTLACWLGGA  210

Query  318  LASIGFMHYFSSFGQ------------LEKTPHMVLGFLVVSLAAALVESHPLSTELDDN  175
             AS+  + YF   G             L+    +V G L+ S   AL ES PL  E  DN
Sbjct  211  AASLPLLLYFMRHGMFASAGPAAAGGVLQWGWPLVRGVLLCSGFGALAESLPLGGE-ADN  269

Query  174  LTVPLA  157
            +T+ LA
Sbjct  270  VTIALA  275



>gb|EMS55542.1| putative phytol kinase, chloroplastic [Triticum urartu]
Length=246

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 1/137 (1%)
 Frame = -2

Query  537  RELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNK  358
            RELL+GPLYY I + +   V+WR SPI I  +  +  GDG ADI+GRR  S KLP N  K
Sbjct  105  RELLRGPLYYVIVLLIIVLVFWRDSPIGIISLSMMSGGDGFADIVGRRFGSLKLPFNDKK  164

Query  357  SFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV-VSLAAALVESHPLSTELD  181
            S+ GS AM   GFL S   + YFS  G ++ +    +G LV V+LAA  VE  P++  +D
Sbjct  165  SWVGSAAMFISGFLLSALMLSYFSWLGYIQVSWDQAIGKLVLVALAATAVECIPVTDVVD  224

Query  180  DNLTVPLASVLAGSCIF  130
            DN++VPLA++L    +F
Sbjct  225  DNISVPLATMLVAFLLF  241



>ref|XP_004351203.1| hypothetical protein DFA_10953 [Dictyostelium fasciculatum]
 gb|EGG14695.1| hypothetical protein DFA_10953 [Dictyostelium fasciculatum]
Length=242

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -2

Query  726  RKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllglgiLKDDGTVKSMSR  550
            RKLVH+  G+++++ W ++      + L  ++IP L  F+  L+G+G+LKD   V SMSR
Sbjct  37   RKLVHIGTGIIYVMSWGLYPINDPSSRLYCSIIPALVTFQFTLVGMGLLKDKKVVDSMSR  96

Query  549  FGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPH  370
             G+ RELL GP  Y I   L+  +YW +SP+ I  +  LC GDG A +IG      ++P+
Sbjct  97   SGNPRELLFGPATYGIIFVLSTIIYWANSPVGITALSLLCFGDGFAGLIGSEFGRARIPY  156

Query  369  NKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP--HMVLGFLVVSLAAALVESHPL  196
            N++K+  GS++   F  + S+  +    S+G L        +   +VVS+  A+VES P+
Sbjct  157  NRSKTIVGSVSFVIFSVVGSLMLLTIIQSYGYLIHFSLYAFIPSLIVVSIIGAIVESLPI  216

Query  195  STELDDNLTVPLASVLA  145
              E  DN+TV +  VL 
Sbjct  217  --EDWDNITVFMCCVLV  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100