BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004N13

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P55004.1|PHYE_IPONI  RecName: Full=Phytochrome E                     389   3e-123   Ipomoea nil [qian niu]
ref|XP_009631925.1|  PREDICTED: phytochrome E isoform X2                294   3e-88    Nicotiana tomentosiformis
ref|XP_006355589.1|  PREDICTED: phytochrome E-like isoform X1           290   1e-86    Solanum tuberosum [potatoes]
ref|XP_009631929.1|  PREDICTED: phytochrome E isoform X3                289   2e-86    Nicotiana tomentosiformis
ref|XP_009631916.1|  PREDICTED: phytochrome E isoform X1                287   1e-85    Nicotiana tomentosiformis
ref|XP_006355590.1|  PREDICTED: phytochrome E-like isoform X2           285   7e-85    Solanum tuberosum [potatoes]
ref|XP_010316899.1|  PREDICTED: phytochrome E isoform X1                284   2e-84    Solanum lycopersicum
ref|XP_009766581.1|  PREDICTED: phytochrome E isoform X1                283   2e-84    Nicotiana sylvestris
ref|XP_004232975.1|  PREDICTED: phytochrome E isoform X2                279   1e-82    
ref|XP_009766582.1|  PREDICTED: phytochrome E isoform X2                279   1e-82    Nicotiana sylvestris
gb|AAF25812.1|AF178571_1  phytochrome E                                 278   3e-82    Solanum lycopersicum
ref|XP_008225374.1|  PREDICTED: phytochrome E isoform X1                258   3e-75    Prunus mume [ume]
ref|XP_007025187.1|  Phytochrome E isoform 1                            256   7e-75    
ref|XP_007214557.1|  hypothetical protein PRUPE_ppa000491mg             256   9e-75    
ref|XP_007214556.1|  hypothetical protein PRUPE_ppa000491mg             255   2e-74    
ref|XP_007138490.1|  hypothetical protein PHAVU_009G213400g             254   7e-74    Phaseolus vulgaris [French bean]
ref|XP_008225375.1|  PREDICTED: phytochrome E isoform X2                253   1e-73    Prunus mume [ume]
gb|KDP21198.1|  hypothetical protein JCGZ_21669                         253   1e-73    Jatropha curcas
ref|XP_010052113.1|  PREDICTED: phytochrome E isoform X1                251   4e-73    Eucalyptus grandis [rose gum]
ref|XP_010052114.1|  PREDICTED: phytochrome E isoform X2                251   8e-73    Eucalyptus grandis [rose gum]
gb|EYU43280.1|  hypothetical protein MIMGU_mgv1a000521mg                248   9e-72    Erythranthe guttata [common monkey flower]
ref|XP_002519749.1|  phytochrome B, putative                            247   2e-71    Ricinus communis
ref|XP_004161142.1|  PREDICTED: phytochrome E-like                      230   2e-71    
ref|XP_009352111.1|  PREDICTED: phytochrome E-like                      247   3e-71    
gb|KHG11315.1|  Phytochrome E                                           246   3e-71    Gossypium arboreum [tree cotton]
gb|KJB69756.1|  hypothetical protein B456_011G040900                    246   7e-71    Gossypium raimondii
ref|XP_008371559.1|  PREDICTED: phytochrome E-like                      245   1e-70    
ref|XP_008383527.1|  PREDICTED: phytochrome E-like                      244   3e-70    
ref|XP_006449616.1|  hypothetical protein CICLE_v10014092mg             243   9e-70    
gb|KDO78033.1|  hypothetical protein CISIN_1g001210mg                   242   9e-70    Citrus sinensis [apfelsine]
ref|XP_006467542.1|  PREDICTED: phytochrome E-like isoform X2           242   9e-70    Citrus sinensis [apfelsine]
gb|KHN04123.1|  Phytochrome E                                           242   1e-69    Glycine soja [wild soybean]
gb|KDO78034.1|  hypothetical protein CISIN_1g001210mg                   242   1e-69    Citrus sinensis [apfelsine]
ref|XP_006467541.1|  PREDICTED: phytochrome E-like isoform X1           242   1e-69    Citrus sinensis [apfelsine]
ref|XP_004488313.1|  PREDICTED: phytochrome E-like isoform X1           242   2e-69    Cicer arietinum [garbanzo]
ref|NP_001276186.1|  phytochrome E-like                                 240   4e-69    Glycine max [soybeans]
ref|XP_008358619.1|  PREDICTED: phytochrome E-like                      240   6e-69    
ref|XP_010100997.1|  Phytochrome E                                      240   7e-69    Morus notabilis
emb|CAN62723.1|  hypothetical protein VITISV_030984                     240   8e-69    Vitis vinifera
ref|XP_003546574.1|  PREDICTED: phytochrome E-like                      239   9e-69    
ref|XP_006467543.1|  PREDICTED: phytochrome E-like isoform X3           239   1e-68    Citrus sinensis [apfelsine]
emb|CBI30813.3|  unnamed protein product                                237   2e-68    Vitis vinifera
ref|XP_002271671.1|  PREDICTED: phytochrome E                           238   5e-68    Vitis vinifera
ref|XP_003595571.1|  Phytochrome E                                      238   5e-68    Medicago truncatula
ref|XP_004488314.1|  PREDICTED: phytochrome E-like isoform X2           237   7e-68    Cicer arietinum [garbanzo]
ref|NP_001273774.1|  phytochrome E-like                                 236   1e-67    Glycine max [soybeans]
gb|ACC60972.1|  phytochrome E                                           236   1e-67    Vitis riparia [frost grape]
gb|KHN41345.1|  Phytochrome E                                           236   2e-67    Glycine soja [wild soybean]
ref|XP_004295419.1|  PREDICTED: phytochrome E-like isoform X1           236   3e-67    Fragaria vesca subsp. vesca
ref|XP_004288913.2|  PREDICTED: phytochrome E-like isoform X1           235   5e-67    Fragaria vesca subsp. vesca
ref|XP_011460392.1|  PREDICTED: phytochrome E-like isoform X2           235   6e-67    Fragaria vesca subsp. vesca
ref|XP_011459626.1|  PREDICTED: phytochrome E-like isoform X2           234   9e-67    Fragaria vesca subsp. vesca
ref|XP_009353857.1|  PREDICTED: phytochrome E-like                      234   1e-66    Pyrus x bretschneideri [bai li]
ref|XP_004147430.1|  PREDICTED: phytochrome E-like                      229   7e-65    Cucumis sativus [cucumbers]
ref|XP_008443902.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome E      229   8e-65    Cucumis melo [Oriental melon]
ref|XP_011085288.1|  PREDICTED: phytochrome E                           209   1e-57    Sesamum indicum [beniseed]
gb|ACE79200.1|  phytochrome B-3                                         204   6e-56    Glycine max [soybeans]
gb|ACJ61499.1|  phytochrome B                                           204   7e-56    Glycine max [soybeans]
gb|KHN12867.1|  Phytochrome B                                           203   8e-56    Glycine soja [wild soybean]
ref|NP_001240097.1|  phytochrome B-like                                 203   1e-55    Glycine max [soybeans]
gb|AEA41043.1|  phytochrome B                                           202   2e-55    Amphicarpaea edgeworthii [Chinese hog-peanut]
sp|P42499.1|PHYB_SOYBN  RecName: Full=Phytochrome B                     202   4e-55    Glycine max [soybeans]
dbj|BAF44083.1|  phytochrome b                                          201   6e-55    Lotus japonicus
ref|XP_007147366.1|  hypothetical protein PHAVU_006G118200g             201   8e-55    Phaseolus vulgaris [French bean]
ref|XP_006841448.1|  hypothetical protein AMTR_s00003p00079190          200   1e-54    Amborella trichopoda
gb|ACE79199.2|  phytochrome B-2                                         200   2e-54    Glycine max [soybeans]
ref|XP_003546314.1|  PREDICTED: phytochrome B-like isoformX1            200   2e-54    
gb|KDP27911.1|  hypothetical protein JCGZ_18991                         199   3e-54    Jatropha curcas
ref|XP_008438960.1|  PREDICTED: phytochrome B                           199   3e-54    Cucumis melo [Oriental melon]
emb|CBI22877.3|  unnamed protein product                                197   5e-54    Vitis vinifera
ref|XP_004165483.1|  PREDICTED: phytochrome B-like                      199   5e-54    
gb|EYU45495.1|  hypothetical protein MIMGU_mgv1a000516mg                198   6e-54    Erythranthe guttata [common monkey flower]
gb|ACC60970.1|  phytochrome B                                           198   8e-54    Vitis riparia [frost grape]
dbj|BAH47482.1|  phytochrome E                                          197   9e-54    Cardamine resedifolia
ref|XP_002278263.1|  PREDICTED: phytochrome B                           197   1e-53    Vitis vinifera
gb|ACU21557.1|  phytochrome B                                           197   1e-53    Medicago sativa [alfalfa]
gb|ABN07956.1|  GAF; Heavy metal sensor kinase                          197   1e-53    Medicago truncatula
emb|CAA05294.1|  phytochrome B1                                         191   2e-53    Solanum lycopersicum
ref|XP_003594734.1|  Phytochrome b1                                     197   2e-53    
emb|CAA05296.1|  phytochrome B1                                         191   2e-53    Solanum lycopersicum
ref|XP_006285990.1|  hypothetical protein CARUB_v10007527mg             196   3e-53    Capsella rubella
gb|AAF14344.1|AF069305_1  phytochrome B                                 196   3e-53    Pisum sativum [garden pea]
ref|XP_004486544.1|  PREDICTED: phytochrome B-like                      196   3e-53    Cicer arietinum [garbanzo]
dbj|BAH47475.1|  phytochrome E                                          196   3e-53    Cardamine nipponica
dbj|BAH47478.1|  phytochrome E                                          196   3e-53    Cardamine nipponica
ref|XP_002519230.1|  phytochrome B, putative                            196   3e-53    Ricinus communis
dbj|BAH47481.1|  phytochrome E                                          196   3e-53    Cardamine nipponica
dbj|BAH47480.1|  phytochrome E                                          196   3e-53    Cardamine nipponica
dbj|BAH47476.1|  phytochrome E                                          196   3e-53    Cardamine nipponica
gb|ACC60966.1|  phytochrome B                                           196   4e-53    Vitis vinifera
gb|ACU21558.1|  phytochrome B                                           196   4e-53    Medicago sativa [alfalfa]
gb|AAA34093.1|  phytochrome B                                           192   5e-53    Nicotiana tabacum [American tobacco]
dbj|BAH47477.1|  phytochrome E                                          196   5e-53    Cardamine nipponica
ref|XP_004134246.1|  PREDICTED: phytochrome B-like                      195   7e-53    
ref|XP_007035807.1|  Phytochrome B isoform 1                            195   7e-53    
gb|AHZ63957.1|  phytochrome                                             195   7e-53    Podocarpus rubens
dbj|BAH47474.1|  phytochrome E                                          194   1e-52    Cardamine nipponica
dbj|BAH47471.1|  phytochrome E                                          194   1e-52    Cardamine nipponica
dbj|BAH47472.1|  phytochrome E                                          194   1e-52    Cardamine nipponica
ref|XP_008368328.1|  PREDICTED: phytochrome B                           194   1e-52    
dbj|BAH47473.1|  phytochrome E                                          194   1e-52    Cardamine nipponica
ref|XP_008223364.1|  PREDICTED: phytochrome B                           194   2e-52    Prunus mume [ume]
ref|XP_011071377.1|  PREDICTED: phytochrome B                           194   2e-52    Sesamum indicum [beniseed]
gb|KJB72840.1|  hypothetical protein B456_011G200200                    194   2e-52    Gossypium raimondii
gb|KJB72839.1|  hypothetical protein B456_011G200200                    193   4e-52    Gossypium raimondii
sp|P29130.2|PHYB_TOBAC  RecName: Full=Phytochrome B                     192   6e-52    Nicotiana tabacum [American tobacco]
ref|XP_009606016.1|  PREDICTED: phytochrome B                           192   7e-52    Nicotiana tomentosiformis
ref|XP_009789287.1|  PREDICTED: phytochrome B                           192   9e-52    Nicotiana sylvestris
gb|AHZ89696.1|  phytochrome B                                           192   1e-51    Dimocarpus longan [longan]
ref|XP_011019938.1|  PREDICTED: phytochrome B isoform X2                192   1e-51    Populus euphratica
ref|XP_011019931.1|  PREDICTED: phytochrome B isoform X1                192   1e-51    Populus euphratica
gb|AEK06067.1|  phytochrome B2                                          191   2e-51    Populus balsamifera [balsam poplar]
gb|AEK06070.1|  phytochrome B2                                          191   2e-51    Populus balsamifera [balsam poplar]
gb|AEK06073.1|  phytochrome B2                                          191   2e-51    Populus balsamifera [balsam poplar]
gb|AEK06060.1|  phytochrome B2                                          191   2e-51    Populus balsamifera [balsam poplar]
gb|AEK06057.1|  phytochrome B2                                          191   2e-51    Populus balsamifera [balsam poplar]
ref|XP_002314949.2|  hypothetical protein POPTR_0010s15600g             191   2e-51    Populus trichocarpa [western balsam poplar]
ref|XP_007227356.1|  hypothetical protein PRUPE_ppa000510mg             191   2e-51    Prunus persica
sp|P34094.2|PHYB_SOLTU  RecName: Full=Phytochrome B                     191   3e-51    Solanum tuberosum [potatoes]
emb|CAA74992.1|  phytochrome B                                          191   3e-51    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011010461.1|  PREDICTED: phytochrome B isoform X1                191   3e-51    Populus euphratica
ref|XP_010318997.1|  PREDICTED: phytochrome B1                          191   3e-51    
ref|XP_009372122.1|  PREDICTED: phytochrome B-like                      191   3e-51    Pyrus x bretschneideri [bai li]
ref|XP_009336299.1|  PREDICTED: phytochrome B-like                      190   4e-51    Pyrus x bretschneideri [bai li]
gb|ACV87354.1|  phytochrome B                                           190   5e-51    Aquilegia formosa
emb|CDX78827.1|  BnaA01g08940D                                          189   6e-51    
ref|XP_004295077.1|  PREDICTED: phytochrome B-like                      189   8e-51    Fragaria vesca subsp. vesca
gb|AAQ11872.1|  phytochrome B                                           189   8e-51    Stellaria longipes
ref|XP_006358209.1|  PREDICTED: phytochrome B                           189   8e-51    Solanum tuberosum [potatoes]
ref|XP_009131404.1|  PREDICTED: phytochrome E                           189   9e-51    Brassica rapa
emb|CDO98760.1|  unnamed protein product                                187   1e-50    Coffea canephora [robusta coffee]
dbj|BAM36555.1|  phytochrome B                                          189   1e-50    Fragaria x ananassa
gb|KDO71942.1|  hypothetical protein CISIN_1g037299mg                   189   1e-50    Citrus sinensis [apfelsine]
emb|CDY61670.1|  BnaC01g40810D                                          189   1e-50    Brassica napus [oilseed rape]
ref|XP_006488839.1|  PREDICTED: phytochrome B-like isoform X1           189   1e-50    Citrus sinensis [apfelsine]
ref|NP_001274786.1|  phytochrome B                                      189   1e-50    Solanum tuberosum [potatoes]
ref|XP_010671734.1|  PREDICTED: phytochrome B isoform X1                189   2e-50    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008360243.1|  PREDICTED: phytochrome B-like isoform X1           188   2e-50    
gb|AHZ63956.1|  phytochrome                                             188   3e-50    Taiwania cryptomerioides
ref|XP_008808701.1|  PREDICTED: phytochrome B-like                      187   3e-50    Phoenix dactylifera
ref|XP_010065155.1|  PREDICTED: phytochrome B                           187   6e-50    Eucalyptus grandis [rose gum]
gb|ACN40636.1|  unknown                                                 187   7e-50    Picea sitchensis
gb|AHZ63958.1|  phytochrome                                             187   7e-50    Pinus parviflora [goyo-matsu]
gb|AJE63445.1|  phytochrome P                                           186   9e-50    Picea abies
ref|XP_008781148.1|  PREDICTED: phytochrome B                           186   1e-49    Phoenix dactylifera
ref|XP_010938231.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome ...    186   1e-49    
ref|XP_002868009.1|  hypothetical protein ARALYDRAFT_914880             185   3e-49    Arabidopsis lyrata subsp. lyrata
ref|XP_010109967.1|  Phytochrome B                                      185   3e-49    
sp|Q41046.1|PHY_PINSY  RecName: Full=Phytochrome                        185   4e-49    Pinus sylvestris [Scotch pine]
emb|CAA54075.1|  phytochrome E                                          184   4e-49    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193547.4|  phytochrome E                                         184   4e-49    Arabidopsis thaliana [mouse-ear cress]
gb|AGU91425.1|  phytochrome B                                           184   7e-49    Chrysanthemum boreale
dbj|BAM67033.1|  phytochrome b                                          184   7e-49    Chrysanthemum seticuspe f. boreale
dbj|BAP76066.1|  putative PHYP                                          183   8e-49    Cryptomeria japonica
gb|AHZ63960.1|  phytochrome                                             183   1e-48    Welwitschia mirabilis
ref|XP_010267948.1|  PREDICTED: phytochrome B                           183   1e-48    Nelumbo nucifera [Indian lotus]
ref|XP_010921452.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome B      182   3e-48    Elaeis guineensis
ref|XP_009391516.1|  PREDICTED: phytochrome B                           182   4e-48    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFY06994.1|  phytochrome B                                           167   6e-48    Vaccinium myrtillus [bilberry]
ref|XP_010445296.1|  PREDICTED: phytochrome E                           181   8e-48    
ref|XP_006406774.1|  hypothetical protein EUTSA_v100199781mg            167   3e-47    
ref|XP_009757538.1|  PREDICTED: phytochrome B-like                      172   8e-47    Nicotiana sylvestris
ref|XP_010449501.1|  PREDICTED: phytochrome E isoform X1                177   1e-46    
ref|XP_010449502.1|  PREDICTED: phytochrome E isoform X2                177   1e-46    Camelina sativa [gold-of-pleasure]
gb|AHZ63959.1|  phytochrome                                             177   1e-46    Gnetum montanum
ref|XP_006414145.1|  hypothetical protein EUTSA_v10024375mg             176   2e-46    
ref|XP_010434577.1|  PREDICTED: phytochrome E-like isoform X2           176   3e-46    Camelina sativa [gold-of-pleasure]
ref|XP_010434576.1|  PREDICTED: phytochrome E-like isoform X1           176   3e-46    Camelina sativa [gold-of-pleasure]
ref|XP_011100755.1|  PREDICTED: phytochrome B-like                      176   3e-46    Sesamum indicum [beniseed]
gb|AAG25725.1|AF309806_1  phytochrome B1                                176   4e-46    Populus trichocarpa [western balsam poplar]
ref|XP_002312330.2|  Phytochrome B family protein                       176   4e-46    
prf||1709211A  phytochrome                                              166   4e-46    Selaginella martensii
gb|ABB13338.1|  phytochrome B                                           172   1e-45    Hordeum vulgare subsp. spontaneum [wild barley]
dbj|BAP91202.1|  phytochrome B CDS                                      175   1e-45    Hordeum bulbosum
gb|KFK28490.1|  phytochrome e                                           175   1e-45    Arabis alpina [alpine rockcress]
ref|XP_003558068.1|  PREDICTED: phytochrome B                           175   1e-45    Brachypodium distachyon [annual false brome]
emb|CDX82382.1|  BnaA03g34390D                                          161   3e-45    
gb|AEK26584.1|  phytochrome B1                                          173   4e-45    Populus tremula [European aspen]
ref|XP_006355734.1|  PREDICTED: phytochrome B-like                      173   5e-45    Solanum tuberosum [potatoes]
gb|ACN27021.1|  unknown                                                 162   5e-45    Zea mays [maize]
gb|AHZ63982.1|  phytochrome                                             172   8e-45    Pellia neesiana
ref|XP_009591321.1|  PREDICTED: phytochrome B-like                      172   1e-44    Nicotiana tomentosiformis
dbj|BAJ96486.1|  predicted protein                                      172   1e-44    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAW56586.1|  phytochrome B                                           171   2e-44    Arabidopsis thaliana [mouse-ear cress]
gb|EEC75099.1|  hypothetical protein OsI_11260                          170   3e-44    Oryza sativa Indica Group [Indian rice]
gb|AAX76779.1|  putative phytochrome B                                  171   3e-44    Triticum aestivum [Canadian hard winter wheat]
sp|P93527.2|PHYB_SORBI  RecName: Full=Phytochrome B                     171   3e-44    Sorghum bicolor [broomcorn]
ref|XP_010529136.1|  PREDICTED: phytochrome E                           171   3e-44    Tarenaya hassleriana [spider flower]
ref|XP_010321412.1|  PREDICTED: phytochrome B isoform X1                171   3e-44    
gb|AAW56590.1|  phytochrome B                                           170   4e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296857.1|  hypothetical protein CARUB_v10012844mg             170   6e-44    Capsella rubella
gb|AHZ63978.1|  phytochrome                                             170   6e-44    Scapania nemorea
ref|XP_006651316.1|  PREDICTED: phytochrome B-like                      170   6e-44    Oryza brachyantha
sp|A2XFW2.2|PHYB_ORYSI  RecName: Full=Phytochrome B                     169   8e-44    Oryza sativa Indica Group [Indian rice]
gb|EEE58928.1|  hypothetical protein OsJ_10581                          169   8e-44    Oryza sativa Japonica Group [Japonica rice]
emb|CAA40795.2|  phytochrome B                                          169   8e-44    Oryza sativa Indica Group [Indian rice]
gb|AFK30993.1|  phytochrome b                                           169   8e-44    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31025.1|  phytochrome b                                           169   9e-44    Oryza sativa f. spontanea
gb|AFK31023.1|  phytochrome b                                           169   9e-44    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31046.1|  phytochrome b                                           169   9e-44    Oryza rufipogon [common wild rice]
gb|AFK31026.1|  phytochrome b                                           169   9e-44    Oryza sativa f. spontanea
gb|AFK30971.1|  phytochrome b                                           169   9e-44    Oryza sativa Indica Group [Indian rice]
gb|AHZ63972.1|  phytochrome                                             169   9e-44    Isoetes tegetiformans [Merlin's grass]
gb|AFK30985.1|  phytochrome b                                           169   9e-44    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049910.2|  Os03g0309200                                       169   9e-44    
gb|AFK31044.1|  phytochrome b                                           169   9e-44    Oryza rufipogon [common wild rice]
gb|AFK31040.1|  phytochrome b                                           169   9e-44    Oryza rufipogon [common wild rice]
gb|AFK30983.1|  phytochrome b                                           169   9e-44    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30981.1|  phytochrome b                                           169   9e-44    Oryza sativa Japonica Group [Japonica rice]
gb|AHZ63979.1|  phytochrome                                             169   9e-44    Porella pinnata
ref|XP_010414753.1|  PREDICTED: phytochrome B-like isoform X3           169   9e-44    Camelina sativa [gold-of-pleasure]
gb|AFK31045.1|  phytochrome b                                           169   9e-44    Oryza rufipogon [common wild rice]
gb|AFK31003.1|  phytochrome b                                           169   1e-43    Oryza sativa Indica Group [Indian rice]
gb|AFK31001.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31035.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31029.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31018.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30979.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AAW56589.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK31030.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
ref|XP_010414759.1|  PREDICTED: phytochrome B-like isoform X4           169   1e-43    Camelina sativa [gold-of-pleasure]
gb|AFK31024.1|  phytochrome b                                           169   1e-43    Oryza sativa f. spontanea
gb|AFK30984.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30978.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31049.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK30982.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
sp|Q10MG9.1|PHYB_ORYSJ  RecName: Full=Phytochrome B                     169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AAW56588.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AAR32737.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK31031.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31039.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31022.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31011.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31028.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|ABY61301.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AAW56587.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK31004.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30973.1|  phytochrome b                                           169   1e-43    Oryza sativa Indica Group [Indian rice]
gb|ABY61307.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK31047.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AAW56580.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|ABY61300.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK31043.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31036.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31034.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31017.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31015.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30999.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30988.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31041.1|  phytochrome b                                           169   1e-43    Oryza rufipogon [common wild rice]
gb|AFK31027.1|  phytochrome b                                           169   1e-43    Oryza officinalis
gb|AFK31053.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31007.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30992.1|  phytochrome b                                           169   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|ABY61314.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK30970.1|  phytochrome b                                           169   1e-43    Oryza sativa Indica Group [Indian rice]
gb|AAW56578.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AAW56576.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
ref|NP_179469.1|  phytochrome B                                         169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AAW56577.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AHZ64000.1|  phytochrome                                             169   1e-43    Phaeoceros carolinianus
gb|AHZ63999.1|  phytochrome                                             169   1e-43    Paraphymatoceros hallii
gb|AAW56575.1|  phytochrome B                                           169   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK31002.1|  phytochrome b                                           169   2e-43    Oryza sativa Indica Group [Indian rice]
gb|AFK30974.1|  phytochrome b                                           169   2e-43    Oryza sativa Indica Group [Indian rice]
gb|AFK30997.1|  phytochrome b                                           169   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30995.1|  phytochrome b                                           168   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30972.1|  phytochrome b                                           168   2e-43    Oryza sativa Indica Group [Indian rice]
gb|AFK30990.1|  phytochrome b                                           168   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30989.1|  phytochrome b                                           168   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30998.1|  phytochrome b                                           168   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AFK30994.1|  phytochrome b                                           168   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|KFK40923.1|  phytochrome b                                           168   3e-43    Arabis alpina [alpine rockcress]
gb|AFK31042.1|  phytochrome b                                           168   3e-43    Oryza rufipogon [common wild rice]
ref|XP_010467718.1|  PREDICTED: phytochrome B-like isoform X1           168   3e-43    Camelina sativa [gold-of-pleasure]
ref|XP_006414374.1|  hypothetical protein EUTSA_v10024253mg             168   3e-43    Eutrema salsugineum [saltwater cress]
gb|AHZ63839.1|  phytochrome                                             168   3e-43    Anthoceros punctatus
gb|AFK31038.1|  phytochrome b                                           168   3e-43    Oryza rufipogon [common wild rice]
ref|XP_010489599.1|  PREDICTED: phytochrome B isoform X1                167   4e-43    Camelina sativa [gold-of-pleasure]
gb|AHZ63991.1|  phytochrome                                             167   4e-43    
gb|AAR30915.1|  phytochrome B                                           167   4e-43    
ref|XP_002467973.1|  hypothetical protein SORBIDRAFT_01g037340          167   4e-43    
gb|AAR30914.1|  phytochrome B                                           167   4e-43    
gb|AAR30905.1|  phytochrome B                                           167   4e-43    
gb|AAR30903.1|  phytochrome B                                           167   4e-43    
gb|AAR30916.1|  phytochrome B                                           167   4e-43    
gb|AFK31032.1|  phytochrome b                                           167   5e-43    
gb|AHZ63973.1|  phytochrome                                             167   5e-43    
gb|AFK30986.1|  phytochrome b                                           167   6e-43    
gb|AHX73747.1|  phytochrome                                             167   6e-43    
gb|AHZ63998.1|  phytochrome                                             167   6e-43    
gb|AFK30980.1|  phytochrome b                                           167   7e-43    
ref|XP_010548998.1|  PREDICTED: phytochrome B                           167   7e-43    
gb|ABW91071.1|  phytochrome-4                                           166   8e-43    
dbj|BAJ34089.1|  unnamed protein product                                166   9e-43    
gb|KHG20019.1|  Phytochrome B                                           166   9e-43    
gb|AFK31033.1|  phytochrome b                                           166   9e-43    
gb|AHZ63981.1|  phytochrome                                             166   1e-42    
gb|ACN34970.1|  unknown                                                 154   1e-42    
ref|XP_002991119.1|  hypothetical protein SELMODRAFT_161430             166   1e-42    
ref|XP_002991641.1|  hypothetical protein SELMODRAFT_161807             166   1e-42    
ref|XP_001773550.1|  phytochrome 4                                      166   1e-42    
emb|CDX75900.1|  BnaC03g39830D                                          166   1e-42    
ref|XP_001778155.1|  phytochrome 1                                      166   1e-42    
gb|AAW56591.1|  phytochrome B                                           166   1e-42    
ref|XP_002886263.1|  phytochrome B                                      166   1e-42    
gb|AAM94953.1|  phytochrome                                             166   2e-42    
gb|AHZ63990.1|  phytochrome                                             166   2e-42    
ref|NP_001169810.1|  uncharacterized protein LOC100383702               165   2e-42    
tpg|DAA45039.1|  TPA: phytochromeB1                                     165   3e-42    
emb|CAA52933.1|  phytochrome                                            165   3e-42    
gb|AAM91631.1|  putative phytochrome D                                  161   3e-42    
sp|Q01549.1|PHY1_SELMA  RecName: Full=Phytochrome 1                     165   3e-42    
gb|AHZ63980.1|  phytochrome                                             165   3e-42    
gb|AHZ63985.1|  phytochrome                                             164   4e-42    
gb|AHZ63989.1|  phytochrome                                             164   4e-42    
ref|XP_004984602.1|  PREDICTED: phytochrome B-like                      164   6e-42    
emb|CDX92112.1|  BnaA05g22950D                                          164   8e-42    
gb|AAM94952.1|  phytochrome                                             164   8e-42    
gb|AHZ63987.1|  phytochrome                                             163   9e-42    
ref|XP_010414738.1|  PREDICTED: phytochrome B-like isoform X1           164   9e-42    
ref|XP_010414746.1|  PREDICTED: phytochrome B-like isoform X2           164   9e-42    
dbj|BAH79251.1|  phytochrome B                                          163   1e-41    
dbj|BAH79250.1|  phytochrome B                                          163   1e-41    
gb|AAM94954.1|  phytochrome                                             163   1e-41    
dbj|BAH79245.1|  phytochrome B                                          163   1e-41    
dbj|BAH79249.1|  phytochrome B                                          163   1e-41    
dbj|BAH79244.1|  phytochrome B                                          163   2e-41    
gb|AIK23233.1|  phytochrome B                                           163   2e-41    
ref|NP_001288833.1|  phytochrome B                                      163   2e-41    
gb|AIK23234.1|  phytochrome B                                           163   2e-41    
ref|XP_009146045.1|  PREDICTED: phytochrome B                           163   2e-41    
ref|XP_001761145.1|  phytochrome 5a                                     162   2e-41    
ref|XP_001782339.1|  phytochrome 2                                      162   2e-41    
dbj|BAH79248.1|  phytochrome B                                          162   3e-41    
gb|EPS68696.1|  hypothetical protein M569_06071                         162   3e-41    
ref|XP_006283034.1|  hypothetical protein CARUB_v10004026mg             162   4e-41    
ref|XP_001754366.1|  phytochrome 5c                                     161   7e-41    
ref|NP_001168077.1|  phytochromeB2                                      160   1e-40    
ref|XP_002868148.1|  phytochrome D                                      160   1e-40    
gb|AHZ63995.1|  phytochrome                                             160   1e-40    
ref|XP_001767224.1|  phytochrome 5b3                                    160   2e-40    
gb|AAW56596.1|  phytochrome D                                           160   2e-40    
gb|AAW56600.1|  phytochrome D                                           160   2e-40    
dbj|BAB39687.1|  phytochrome                                            160   2e-40    
gb|AAW56594.1|  phytochrome D                                           160   2e-40    
gb|AAW56602.1|  phytochrome D                                           160   2e-40    
gb|AHZ63975.1|  phytochrome                                             160   2e-40    
gb|AAW56593.1|  phytochrome D                                           160   2e-40    
gb|AAW56605.1|  phytochrome D                                           160   2e-40    
gb|AAW56603.1|  phytochrome D                                           160   2e-40    
gb|AAW56592.1|  phytochrome D                                           160   2e-40    
ref|NP_193360.1|  phytochrome D                                         160   2e-40    
emb|CAA54072.1|  phytochrome D                                          160   2e-40    
emb|CDX95888.1|  BnaC05g36390D                                          160   2e-40    
gb|AAW56599.1|  phytochrome D                                           159   2e-40    
emb|CAA52883.1|  phytochrome                                            158   2e-40    
gb|AHZ63988.1|  phytochrome                                             159   2e-40    
gb|AAB19058.1|  phytochrome photoreceptor                               159   2e-40    
ref|XP_010440189.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome D      159   3e-40    
gb|AHZ63996.1|  phytochrome                                             159   3e-40    
gb|AAW56601.1|  phytochrome D                                           159   4e-40    
gb|AAM94956.1|  phytochrome                                             159   4e-40    
sp|Q39557.1|PHY2_CERPU  RecName: Full=Phytochrome 2                     157   1e-39    
gb|AHZ63983.1|  phytochrome                                             157   1e-39    
gb|AHZ63992.1|  phytochrome                                             157   2e-39    
gb|AHZ63946.1|  phytochrome                                             156   2e-39    
ref|XP_008662713.1|  PREDICTED: phytochrome B-like                      145   2e-39    
gb|AHZ63994.1|  phytochrome                                             156   3e-39    
gb|AAW56606.1|  phytochrome D                                           156   3e-39    
gb|AHZ63997.1|  phytochrome                                             156   3e-39    
gb|AHZ63986.1|  phytochrome                                             156   4e-39    
gb|AHZ63949.1|  phytochrome                                             154   7e-39    
gb|AHZ63977.1|  phytochrome                                             155   7e-39    
gb|AHZ63984.1|  phytochrome                                             155   8e-39    
ref|XP_001766035.1|  phytochrome 3                                      155   1e-38    
gb|AAM94955.1|  phytochrome                                             155   1e-38    
dbj|BAF51709.1|  phytochrome3                                           154   1e-38    
gb|AHZ64003.1|  phytochrome                                             154   1e-38    
gb|AHZ63939.1|  phytochrome                                             154   2e-38    
gb|AHZ63942.1|  phytochrome                                             153   4e-38    
gb|AHZ63945.1|  phytochrome                                             153   4e-38    
sp|P33529.2|PHY_MOUSC  RecName: Full=Phytochrome                        152   6e-38    
gb|AHZ63950.1|  phytochrome                                             152   7e-38    
gb|AHZ63938.1|  phytochrome                                             152   1e-37    
dbj|BAA33775.1|  phytochrome 2                                          152   1e-37    
dbj|BAE20162.1|  phytochrome                                            151   1e-37    
gb|AHZ63937.1|  phytochrome                                             151   2e-37    
gb|AHZ63976.1|  phytochrome                                             150   3e-37    
gb|AHZ63974.1|  phytochrome                                             150   3e-37    
gb|AHZ63948.1|  phytochrome                                             150   4e-37    
gb|AHZ63943.1|  phytochrome                                             149   5e-37    
gb|AHZ63971.1|  phytochrome                                             149   7e-37    
gb|AHZ63947.1|  phytochrome                                             149   7e-37    
gb|AHZ63970.1|  phytochrome                                             149   1e-36    
gb|AHZ63940.1|  phytochrome                                             149   1e-36    
gb|AHZ63944.1|  phytochrome                                             148   2e-36    
gb|AAC49128.1|  phytochrome                                             147   3e-36    
gb|KFK36127.1|  phytochrome d                                           147   5e-36    
gb|AHZ63941.1|  phytochrome                                             147   6e-36    
ref|XP_010247418.1|  PREDICTED: phytochrome E-like                      146   1e-35    
gb|AHZ63969.1|  phytochrome                                             145   3e-35    
gb|AHZ64001.1|  phytochrome                                             142   2e-34    
dbj|BAP76065.1|  putative PYHO                                          142   2e-34    
gb|AAW56607.1|  phytochrome B                                           140   7e-34    
sp|Q40762.1|PHY_PICAB  RecName: Full=Phytochrome                        140   9e-34    
gb|AHZ63968.1|  phytochrome                                             140   9e-34    
gb|AHZ63953.1|  phytochrome                                             139   2e-33    
gb|AHZ64005.1|  phytochrome                                             139   3e-33    
gb|AHZ64002.1|  phytochrome                                             138   5e-33    
gb|KGN65574.1|  hypothetical protein Csa_1G461000                       138   6e-33    
gb|AHZ64004.1|  phytochrome                                             137   2e-32    
gb|AHZ63967.1|  phytochrome                                             136   2e-32    
gb|AEA50886.1|  phyB1                                                   123   1e-31    
gb|AHZ64011.1|  phytochrome                                             132   6e-31    
ref|XP_006447805.1|  hypothetical protein CICLE_v10014096mg             131   1e-30    
gb|KDO41031.1|  hypothetical protein CISIN_1g001215mg                   131   2e-30    
ref|XP_009402833.1|  PREDICTED: phytochrome C                           129   6e-30    
gb|AHZ64006.1|  phytochrome                                             129   7e-30    
gb|AHZ63963.1|  phytochrome                                             129   8e-30    
gb|AAW56598.1|  phytochrome D                                           129   1e-29    
gb|AFV79441.1|  phytochrome N                                           128   1e-29    
gb|AFV79543.1|  phytochrome N                                           128   1e-29    
gb|AFV79450.1|  phytochrome N                                           128   1e-29    
gb|AFV79519.1|  phytochrome N                                           128   1e-29    
gb|AFV79442.1|  phytochrome N                                           128   1e-29    
gb|AFV79487.1|  phytochrome N                                           128   1e-29    
gb|AFV79446.1|  phytochrome N                                           128   1e-29    
gb|AFV79512.1|  phytochrome N                                           128   1e-29    
gb|AFV79483.1|  phytochrome N                                           128   1e-29    
gb|AFV79440.1|  phytochrome N                                           128   1e-29    
gb|AFV79437.1|  phytochrome N                                           128   1e-29    
gb|AFV79436.1|  phytochrome N                                           127   1e-29    
gb|AFV79506.1|  phytochrome N                                           127   2e-29    
gb|AFV79449.1|  phytochrome N                                           127   2e-29    
sp|P42496.2|PHY_ADICA  RecName: Full=Phytochrome 1                      128   2e-29    
gb|AFV79549.1|  phytochrome N                                           127   3e-29    
emb|CAJ21307.1|  phytochrome B2                                         127   3e-29    
emb|CAJ21304.1|  phytochrome B2                                         127   3e-29    
emb|CAJ21309.1|  phytochrome B2                                         127   3e-29    
emb|CAJ21302.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21338.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21291.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21297.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21293.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21337.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21318.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21319.1|  phytochrome B2                                         127   4e-29    
emb|CDX98218.1|  BnaC07g08800D                                          122   4e-29    
emb|CAJ21295.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21317.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21332.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21324.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21323.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21321.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21312.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21298.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21305.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21292.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21310.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21314.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21322.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21308.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21294.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21296.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21328.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21316.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21311.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21329.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21313.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21333.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21300.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21327.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21334.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21306.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21315.1|  phytochrome B2                                         127   4e-29    
emb|CAJ21336.1|  phytochrome B2                                         127   5e-29    
emb|CAJ21325.1|  phytochrome B2                                         127   5e-29    
gb|AGF69670.1|  phytochrome B2                                          127   5e-29    
gb|AGF69557.1|  phytochrome B2                                          127   5e-29    
emb|CAJ21330.1|  phytochrome B2                                         127   5e-29    
gb|AGF69581.1|  phytochrome B2                                          127   5e-29    
gb|AGF69569.1|  phytochrome B2                                          127   5e-29    
gb|AGF69618.1|  phytochrome B2                                          127   5e-29    
dbj|BAP76064.1|  putative PHYN2                                         127   5e-29    
gb|AGF69603.1|  phytochrome B2                                          127   5e-29    
emb|CAJ21301.1|  phytochrome B2                                         127   5e-29    
gb|AGF69659.1|  phytochrome B2                                          127   5e-29    
gb|AGF69587.1|  phytochrome B2                                          127   5e-29    
gb|AGF69582.1|  phytochrome B2                                          127   5e-29    
gb|AGF69550.1|  phytochrome B2                                          127   5e-29    
gb|AGF69656.1|  phytochrome B2                                          127   5e-29    
gb|AGF69665.1|  phytochrome B2                                          127   5e-29    
gb|AGF69553.1|  phytochrome B2                                          127   5e-29    
ref|XP_007035808.1|  Phytochrome B isoform 2                            126   8e-29    
emb|CAJ21299.1|  phytochrome B2                                         126   9e-29    
gb|AAG25726.1|AF309807_1  phytochrome B2                                126   9e-29    
gb|AGF69606.1|  phytochrome B2                                          125   1e-28    
emb|CAJ21320.1|  phytochrome B2                                         125   1e-28    
gb|AGF69605.1|  phytochrome B2                                          125   1e-28    



>sp|P55004.1|PHYE_IPONI RecName: Full=Phytochrome E [Ipomoea nil]
 gb|AAA84970.1| phytochrome E [Ipomoea nil]
Length=1115

 Score =   389 bits (998),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG
Sbjct  927   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGN FIHIQFRMTHPGQGLPS
Sbjct  987   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNVFIHIQFRMTHPGQGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR
Sbjct  1047  ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  1106

Query  219   ESSMDTKAE  193
             ESSMDTKA+
Sbjct  1107  ESSMDTKAD  1115



>ref|XP_009631925.1| PREDICTED: phytochrome E isoform X2 [Nicotiana tomentosiformis]
Length=1145

 Score =   294 bits (753),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD G I DG++VEL  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPDQIK+LP+YG
Sbjct  954   DNMDFGRIEDGSKVELNMEEFVLGNVVDAIVSQVMILLKEKNLQLLHDIPDQIKTLPLYG  1013

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQL+LSDFLLSIV HAPSPDGWVEI+V PGLKLIQDGNEFIH+QFRMTHPGQGLP+
Sbjct  1014  DQIKLQLILSDFLLSIVHHAPSPDGWVEIKVLPGLKLIQDGNEFIHLQFRMTHPGQGLPA  1073

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
             ALIEDM  G  R TTQEG+ L+ SQKLV MMNGHV YVRE+ KCYFLIDL+ KT K
Sbjct  1074  ALIEDMSGGRNRGTTQEGIALNFSQKLVNMMNGHVRYVREENKCYFLIDLELKTGK  1129



>ref|XP_006355589.1| PREDICTED: phytochrome E-like isoform X1 [Solanum tuberosum]
Length=1136

 Score =   290 bits (742),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD GGI DG++VEL  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPD IK+LP+YG
Sbjct  945   DNMDFGGIEDGSKVELNMEEFVLGNVVDAIVSQVMIFLKEKNLQLLHDIPDHIKTLPLYG  1004

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQ VLSDFLLS+V HAPSPDGWVEI+V PGLKLIQDGNE IH+QFRMTHPGQGLP+
Sbjct  1005  DQIKLQRVLSDFLLSVVHHAPSPDGWVEIKVLPGLKLIQDGNELIHLQFRMTHPGQGLPA  1064

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALI+DM     RWTTQEG+ L++SQKL+ +MNGHV YVRE+ KCYFLID++ +T KP   
Sbjct  1065  ALIDDMSGERNRWTTQEGIALNVSQKLLNVMNGHVRYVREEDKCYFLIDVELQTSKPTQH  1124

Query  219   ESSMDTKAE  193
                ++   E
Sbjct  1125  GPKLEATQE  1133



>ref|XP_009631929.1| PREDICTED: phytochrome E isoform X3 [Nicotiana tomentosiformis]
Length=1144

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD G I DG +VEL  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPDQIK+LP+YG
Sbjct  954   DNMDFGRIEDG-KVELNMEEFVLGNVVDAIVSQVMILLKEKNLQLLHDIPDQIKTLPLYG  1012

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQL+LSDFLLSIV HAPSPDGWVEI+V PGLKLIQDGNEFIH+QFRMTHPGQGLP+
Sbjct  1013  DQIKLQLILSDFLLSIVHHAPSPDGWVEIKVLPGLKLIQDGNEFIHLQFRMTHPGQGLPA  1072

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
             ALIEDM  G  R TTQEG+ L+ SQKLV MMNGHV YVRE+ KCYFLIDL+ KT K
Sbjct  1073  ALIEDMSGGRNRGTTQEGIALNFSQKLVNMMNGHVRYVREENKCYFLIDLELKTGK  1128



>ref|XP_009631916.1| PREDICTED: phytochrome E isoform X1 [Nicotiana tomentosiformis]
Length=1152

 Score =   287 bits (734),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 156/183 (85%), Gaps = 7/183 (4%)
 Frame = -3

Query  759   ENMDSGGIVDG-------NRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQI  601
             +NMD G I DG       ++VEL  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPDQI
Sbjct  954   DNMDFGRIEDGLLSPGFSSKVELNMEEFVLGNVVDAIVSQVMILLKEKNLQLLHDIPDQI  1013

Query  600   KSLPIYGDQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTH  421
             K+LP+YGDQIKLQL+LSDFLLSIV HAPSPDGWVEI+V PGLKLIQDGNEFIH+QFRMTH
Sbjct  1014  KTLPLYGDQIKLQLILSDFLLSIVHHAPSPDGWVEIKVLPGLKLIQDGNEFIHLQFRMTH  1073

Query  420   PGQGLPSALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFK  241
             PGQGLP+ALIEDM  G  R TTQEG+ L+ SQKLV MMNGHV YVRE+ KCYFLIDL+ K
Sbjct  1074  PGQGLPAALIEDMSGGRNRGTTQEGIALNFSQKLVNMMNGHVRYVREENKCYFLIDLELK  1133

Query  240   TQK  232
             T K
Sbjct  1134  TGK  1136



>ref|XP_006355590.1| PREDICTED: phytochrome E-like isoform X2 [Solanum tuberosum]
Length=1135

 Score =   285 bits (729),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD GGI DG +VEL  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPD IK+LP+YG
Sbjct  945   DNMDFGGIEDG-KVELNMEEFVLGNVVDAIVSQVMIFLKEKNLQLLHDIPDHIKTLPLYG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQ VLSDFLLS+V HAPSPDGWVEI+V PGLKLIQDGNE IH+QFRMTHPGQGLP+
Sbjct  1004  DQIKLQRVLSDFLLSVVHHAPSPDGWVEIKVLPGLKLIQDGNELIHLQFRMTHPGQGLPA  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALI+DM     RWTTQEG+ L++SQKL+ +MNGHV YVRE+ KCYFLID++ +T KP   
Sbjct  1064  ALIDDMSGERNRWTTQEGIALNVSQKLLNVMNGHVRYVREEDKCYFLIDVELQTSKPTQH  1123

Query  219   ESSMDTKAE  193
                ++   E
Sbjct  1124  GPKLEATQE  1132



>ref|XP_010316899.1| PREDICTED: phytochrome E isoform X1 [Solanum lycopersicum]
Length=1138

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD GGI DG++V+L  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPDQIK+LP+YG
Sbjct  947   DNMDFGGIEDGSKVQLNMEEFVLGNVVDAIVSQVMIFLKEKNLQLLHDIPDQIKTLPLYG  1006

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQ VLSDFLLS+V HAPSPDGWVEI+V PGLKLIQDGNE IH+Q RMTHPGQGLP+
Sbjct  1007  DQIKLQRVLSDFLLSVVHHAPSPDGWVEIKVLPGLKLIQDGNELIHLQLRMTHPGQGLPA  1066

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALI+DM     RWTTQEG+ L+++QKL+ +MNGHV YVR + KCYFLID++ +T KP   
Sbjct  1067  ALIDDMSGERNRWTTQEGIALNVAQKLLNVMNGHVRYVRGEDKCYFLIDVELQTSKPTQH  1126

Query  219   ESSMDTKAE  193
                ++   E
Sbjct  1127  GPKLEVTQE  1135



>ref|XP_009766581.1| PREDICTED: phytochrome E isoform X1 [Nicotiana sylvestris]
Length=1142

 Score =   283 bits (725),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD G I DG++VEL  EEFV+GNV+DA+ SQVMI LKEKNLQLLHDIPDQIK+LP+YG
Sbjct  951   DNMDFGSIEDGSKVELNMEEFVLGNVVDAIESQVMILLKEKNLQLLHDIPDQIKTLPLYG  1010

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQL+LSDFLLS+V HAPSPDGWVEI+V PGLKLIQDGNE I +QFRMTHPGQGLP+
Sbjct  1011  DQIKLQLILSDFLLSVVHHAPSPDGWVEIKVLPGLKLIQDGNECIRLQFRMTHPGQGLPA  1070

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
             ALIEDM  G  R TTQEG+ L+ SQKLV  MNGHV YVRE+ KCYFLIDL+ KT K
Sbjct  1071  ALIEDMSGGRNRGTTQEGIALNFSQKLVNTMNGHVRYVREENKCYFLIDLELKTGK  1126



>ref|XP_004232975.1| PREDICTED: phytochrome E isoform X2 [Solanum lycopersicum]
Length=1137

 Score =   279 bits (713),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD GGI DG +V+L  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPDQIK+LP+YG
Sbjct  947   DNMDFGGIEDG-KVQLNMEEFVLGNVVDAIVSQVMIFLKEKNLQLLHDIPDQIKTLPLYG  1005

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQ VLSDFLLS+V HAPSPDGWVEI+V PGLKLIQDGNE IH+Q RMTHPGQGLP+
Sbjct  1006  DQIKLQRVLSDFLLSVVHHAPSPDGWVEIKVLPGLKLIQDGNELIHLQLRMTHPGQGLPA  1065

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALI+DM     RWTTQEG+ L+++QKL+ +MNGHV YVR + KCYFLID++ +T KP   
Sbjct  1066  ALIDDMSGERNRWTTQEGIALNVAQKLLNVMNGHVRYVRGEDKCYFLIDVELQTSKPTQH  1125

Query  219   ESSMDTKAE  193
                ++   E
Sbjct  1126  GPKLEVTQE  1134



>ref|XP_009766582.1| PREDICTED: phytochrome E isoform X2 [Nicotiana sylvestris]
Length=1141

 Score =   279 bits (713),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 151/176 (86%), Gaps = 1/176 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD G I DG +VEL  EEFV+GNV+DA+ SQVMI LKEKNLQLLHDIPDQIK+LP+YG
Sbjct  951   DNMDFGSIEDG-KVELNMEEFVLGNVVDAIESQVMILLKEKNLQLLHDIPDQIKTLPLYG  1009

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQL+LSDFLLS+V HAPSPDGWVEI+V PGLKLIQDGNE I +QFRMTHPGQGLP+
Sbjct  1010  DQIKLQLILSDFLLSVVHHAPSPDGWVEIKVLPGLKLIQDGNECIRLQFRMTHPGQGLPA  1069

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
             ALIEDM  G  R TTQEG+ L+ SQKLV  MNGHV YVRE+ KCYFLIDL+ KT K
Sbjct  1070  ALIEDMSGGRNRGTTQEGIALNFSQKLVNTMNGHVRYVREENKCYFLIDLELKTGK  1125



>gb|AAF25812.1|AF178571_1 phytochrome E [Solanum lycopersicum]
Length=1137

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +NMD GGI DG +V+L  EEFV+GNV+DA+VSQVMI LKEKNLQLLHDIPDQIK+LP+YG
Sbjct  947   DNMDFGGIEDG-KVQLNMEEFVLGNVVDAIVSQVMIFLKEKNLQLLHDIPDQIKTLPLYG  1005

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQ VLSDFLLS+V HAPSPDGWVEI+V PGLKLIQDGNE IH+Q RMTHPGQGLP+
Sbjct  1006  DQIKLQRVLSDFLLSVVHHAPSPDGWVEIKVLPGLKLIQDGNELIHLQLRMTHPGQGLPA  1065

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALI+DM     RWTTQEG+ L+++QKL+ +MNGHV YVR + KCYFLID++ +T KP   
Sbjct  1066  ALIDDMSGERNRWTTQEGIALNVAQKLLNVMNGHVRYVRGEDKCYFLIDVELQTLKPTQH  1125

Query  219   ESSMDTKAE  193
                ++   E
Sbjct  1126  GPKLEVTQE  1134



>ref|XP_008225374.1| PREDICTED: phytochrome E isoform X1 [Prunus mume]
Length=1136

 Score =   258 bits (658),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+M+   I +G+ V+L   EFV+GN++DA+VSQ MI L+ KNLQL H+IP+++KSL ++G
Sbjct  945   EDMNMRSIEEGSSVKLNMGEFVLGNILDAIVSQSMISLRAKNLQLFHEIPEEVKSLSLHG  1004

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V HAPSPDGWVEI++ PGLKLIQDGN  I +QFRMTHPGQGLP+
Sbjct  1005  DQIRLQLVLSDFLLNVVNHAPSPDGWVEIKILPGLKLIQDGNNCIRLQFRMTHPGQGLPA  1064

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
             ALI+DM  GG RWTTQEG+ L+LS+KL+  MNG V YVRE  KCYFLIDL+ KT+K
Sbjct  1065  ALIQDMFEGGNRWTTQEGLCLNLSRKLLNRMNGQVQYVREHDKCYFLIDLELKTRK  1120



>ref|XP_007025187.1| Phytochrome E isoform 1 [Theobroma cacao]
 gb|EOY27809.1| Phytochrome E isoform 1 [Theobroma cacao]
Length=1127

 Score =   256 bits (655),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD G I D   +EL  EEF++GNV+DAV+SQVMI L E+NLQL H+IP++IK   +YG
Sbjct  945   EDMDLGSIEDS--MELSMEEFLLGNVLDAVISQVMILLGERNLQLFHEIPEEIKRQSLYG  1002

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+I+LQLVLSDFLLS+V HAPSPDGWVEIR+SPGLKLIQDGNEF+ +QFRMTHPG+GLPS
Sbjct  1003  DRIRLQLVLSDFLLSVVHHAPSPDGWVEIRISPGLKLIQDGNEFVRLQFRMTHPGKGLPS  1062

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              LI+D+   G + TTQEG+ L+LS+KL+  MNGHVHYVRE  KCYFLIDL+ +T+K R +
Sbjct  1063  TLIQDVFEEGNQPTTQEGLGLNLSRKLLNKMNGHVHYVREHSKCYFLIDLEIRTRKGRQK  1122

Query  219   ESSMD  205
              S  +
Sbjct  1123  ASQAE  1127



>ref|XP_007214557.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
 gb|EMJ15756.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
Length=1130

 Score =   256 bits (655),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+M+   I +G+ V+L   EFV+GN++DA+VSQ MI L+EKNLQL H+IP+++KSL ++G
Sbjct  945   EDMNMRSIEEGS-VKLNMGEFVLGNILDAIVSQSMISLREKNLQLFHEIPEEVKSLSLHG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V HAPSPDGWVEI++ PGLKLIQDGN  I +QFRMTHPGQGLP+
Sbjct  1004  DQIRLQLVLSDFLLNVVNHAPSPDGWVEIKILPGLKLIQDGNNCIRLQFRMTHPGQGLPA  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALI DM  GG RWTTQEG+ L+LS+KL+  MNG V YVRE  KCYFLIDL+ KT+K R R
Sbjct  1064  ALIRDMFEGGNRWTTQEGLGLNLSRKLLNRMNGQVQYVREHDKCYFLIDLELKTRKERQR  1123



>ref|XP_007214556.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
 gb|EMJ15755.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
Length=1129

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+M+   I +G  V+L   EFV+GN++DA+VSQ MI L+EKNLQL H+IP+++KSL ++G
Sbjct  945   EDMNMRSIEEG--VKLNMGEFVLGNILDAIVSQSMISLREKNLQLFHEIPEEVKSLSLHG  1002

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V HAPSPDGWVEI++ PGLKLIQDGN  I +QFRMTHPGQGLP+
Sbjct  1003  DQIRLQLVLSDFLLNVVNHAPSPDGWVEIKILPGLKLIQDGNNCIRLQFRMTHPGQGLPA  1062

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             ALI DM  GG RWTTQEG+ L+LS+KL+  MNG V YVRE  KCYFLIDL+ KT+K R R
Sbjct  1063  ALIRDMFEGGNRWTTQEGLGLNLSRKLLNRMNGQVQYVREHDKCYFLIDLELKTRKERQR  1122



>ref|XP_007138490.1| hypothetical protein PHAVU_009G213400g [Phaseolus vulgaris]
 gb|ESW10484.1| hypothetical protein PHAVU_009G213400g [Phaseolus vulgaris]
Length=1121

 Score =   254 bits (648),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ + G I +G  ++L  EEFV+GN++DA+VSQVM+ ++EKNLQL H+IPD+IK L +YG
Sbjct  933   EDTNLGSINEGT-LQLNMEEFVLGNILDAIVSQVMMLIREKNLQLFHEIPDEIKVLSLYG  991

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQ+VLSDFLL++V H PSP+GWVEI++SPGLK+IQDGNEFIH++FRMTH GQG+PS
Sbjct  992   DQIRLQVVLSDFLLNVVNHTPSPNGWVEIKISPGLKIIQDGNEFIHLKFRMTHSGQGIPS  1051

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              ++ DM  GG +W TQEG+ L++S+K++  M+GHVHYVREQ KCYFLIDL+ +T+K R +
Sbjct  1052  NVLHDMFEGGNQWNTQEGLGLYMSRKILSRMSGHVHYVREQNKCYFLIDLEIRTRKERQK  1111



>ref|XP_008225375.1| PREDICTED: phytochrome E isoform X2 [Prunus mume]
Length=1135

 Score =   253 bits (647),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+M+   I +G+ V+L   EFV+GN++DA+VSQ MI L+ KNLQL H+IP+++KSL ++G
Sbjct  945   EDMNMRSIEEGS-VKLNMGEFVLGNILDAIVSQSMISLRAKNLQLFHEIPEEVKSLSLHG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V HAPSPDGWVEI++ PGLKLIQDGN  I +QFRMTHPGQGLP+
Sbjct  1004  DQIRLQLVLSDFLLNVVNHAPSPDGWVEIKILPGLKLIQDGNNCIRLQFRMTHPGQGLPA  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
             ALI+DM  GG RWTTQEG+ L+LS+KL+  MNG V YVRE  KCYFLIDL+ KT+K
Sbjct  1064  ALIQDMFEGGNRWTTQEGLCLNLSRKLLNRMNGQVQYVREHDKCYFLIDLELKTRK  1119



>gb|KDP21198.1| hypothetical protein JCGZ_21669 [Jatropha curcas]
Length=1126

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   +  GN +ELK EEF++GNV+DA++SQVMI L+E+NLQL H+IP++IK+L +YG
Sbjct  940   EDMDLARLEKGN-IELKMEEFLLGNVLDAIISQVMILLRERNLQLFHEIPEEIKTLSLYG  998

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQL+LSD LLS+V HAP PDGWVEI+VSPGL LI+DGNEF+ +Q RMTHPG+GLPS
Sbjct  999   DQIRLQLILSDILLSVVHHAPVPDGWVEIKVSPGLTLIKDGNEFMRLQIRMTHPGKGLPS  1058

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             AL+EDM  GG +++TQEG+ L+LSQKL+  MNGHV Y RE  KCYFLIDL+ +++  R +
Sbjct  1059  ALVEDMFAGGNQYSTQEGLGLNLSQKLLSQMNGHVRYAREHNKCYFLIDLELRSKNGRQK  1118



>ref|XP_010052113.1| PREDICTED: phytochrome E isoform X1 [Eucalyptus grandis]
 gb|KCW75976.1| hypothetical protein EUGRSUZ_D00342 [Eucalyptus grandis]
Length=1106

 Score =   251 bits (642),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 153/190 (81%), Gaps = 3/190 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD G + DG+ VEL  EEF++G+V+DA++SQVMIPL+E+NLQL H+IP+++K+L ++G
Sbjct  917   EDMDFGSLYDGS-VELNAEEFILGSVLDAIISQVMIPLRERNLQLFHEIPEEMKNLSLFG  975

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D ++LQLVLSDFLL++VRHA SPDGWVEI++ PGLKLIQDG+EF+ IQ RM H GQGLPS
Sbjct  976   DPVRLQLVLSDFLLNVVRHASSPDGWVEIKILPGLKLIQDGSEFMRIQIRMVHAGQGLPS  1035

Query  399   ALIEDMVRGGTRW--TTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             ALI+DM  G  RW  +TQEG+ L+LS+KL+  MNG VHY+RE ++CYF+ DLD KT + R
Sbjct  1036  ALIDDMFNGENRWSTSTQEGLGLNLSRKLLNKMNGQVHYIRESERCYFVFDLDLKTHRER  1095

Query  225   SRESSMDTKA  196
                 S   +A
Sbjct  1096  DTRCSNQKQA  1105



>ref|XP_010052114.1| PREDICTED: phytochrome E isoform X2 [Eucalyptus grandis]
Length=1105

 Score =   251 bits (640),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD G + DG  VEL  EEF++G+V+DA++SQVMIPL+E+NLQL H+IP+++K+L ++G
Sbjct  917   EDMDFGSLYDG--VELNAEEFILGSVLDAIISQVMIPLRERNLQLFHEIPEEMKNLSLFG  974

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D ++LQLVLSDFLL++VRHA SPDGWVEI++ PGLKLIQDG+EF+ IQ RM H GQGLPS
Sbjct  975   DPVRLQLVLSDFLLNVVRHASSPDGWVEIKILPGLKLIQDGSEFMRIQIRMVHAGQGLPS  1034

Query  399   ALIEDMVRGGTRW--TTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             ALI+DM  G  RW  +TQEG+ L+LS+KL+  MNG VHY+RE ++CYF+ DLD KT + R
Sbjct  1035  ALIDDMFNGENRWSTSTQEGLGLNLSRKLLNKMNGQVHYIRESERCYFVFDLDLKTHRER  1094

Query  225   SRESSMDTKA  196
                 S   +A
Sbjct  1095  DTRCSNQKQA  1104



>gb|EYU43280.1| hypothetical protein MIMGU_mgv1a000521mg [Erythranthe guttata]
Length=1098

 Score =   248 bits (633),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++ D G + +G R+ELK EEF++ NV++A+VSQ MI LKEK+L+L+HDIP+QIK+L +YG
Sbjct  922   DDTDFGNLENG-RMELKEEEFMLANVVNAIVSQAMILLKEKSLRLIHDIPEQIKTLSVYG  980

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQL LSDFLLS+V +A SP GWVEI+VS GL LIQDGNEF+ +QFRMTHPGQGLP 
Sbjct  981   DQIKLQLALSDFLLSVVDYARSPAGWVEIKVSVGLNLIQDGNEFVRLQFRMTHPGQGLPE  1040

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             ALIEDM R    WTTQEG+ L++S+ ++ MMNG+V Y+REQ KCYFL+D++ K++K R
Sbjct  1041  ALIEDMSRVNNHWTTQEGLALNISRNILSMMNGNVRYIREQNKCYFLVDVELKSRKSR  1098



>ref|XP_002519749.1| phytochrome B, putative [Ricinus communis]
 gb|EEF42722.1| phytochrome B, putative [Ricinus communis]
Length=1131

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 149/186 (80%), Gaps = 2/186 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E++D   + +G ++ELK EEF + NV+DA+VSQ+M+ L+E+++QL H+IP++IK++ +YG
Sbjct  940   EDIDLAKLEEG-KIELKVEEFFLVNVLDAIVSQIMLLLRERSIQLFHEIPEEIKTVSVYG  998

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLLS+VRHAPSPDGWVEI+VS GLKL+QD +EF+ +Q RMTHPGQGLPS
Sbjct  999   DQIRLQLVLSDFLLSVVRHAPSPDGWVEIKVSSGLKLMQDSHEFLRVQIRMTHPGQGLPS  1058

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             AL EDM   G  WTTQEG+ L LS+KL+  MNGHVHY RE  KC+FLIDL+ K  K R +
Sbjct  1059  ALTEDMFEEGNCWTTQEGLALKLSRKLLHQMNGHVHYTREHNKCFFLIDLELKL-KNRQK  1117

Query  219   ESSMDT  202
                 DT
Sbjct  1118  GGQADT  1123



>ref|XP_004161142.1| PREDICTED: phytochrome E-like [Cucumis sativus]
Length=220

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = -3

Query  759  ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
            E+MD   + +G +VE+  ++F++G+V+DA++ Q+MI ++E+N+QL H+IP++IK+L + G
Sbjct  33   EDMDFRSL-EGGQVEINRQDFLLGSVLDAIICQIMIVVRERNIQLFHEIPEEIKTLTLCG  91

Query  579  DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
            DQIKLQ+VLSDFLL+IV++AP  DGWVEI++S GLKLIQDGNE IH+Q RM+HPGQGLP 
Sbjct  92   DQIKLQMVLSDFLLNIVQYAPVLDGWVEIKISSGLKLIQDGNEHIHLQIRMSHPGQGLPH  151

Query  399  ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR-S  223
             LI+DMV GG +WT+++G+ L+LS++L+  +NG+V YVREQ KCYFLIDL+ K ++ R S
Sbjct  152  ELIQDMVGGGQQWTSEQGLALNLSRRLLNKLNGNVRYVREQTKCYFLIDLELKLRRLRGS  211

Query  222  RESSMDTKA  196
             E++   + 
Sbjct  212  TEATTSQRT  220



>ref|XP_009352111.1| PREDICTED: phytochrome E-like [Pyrus x bretschneideri]
Length=1130

 Score =   247 bits (630),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I +G+ V+L  EEF++G+V+D ++SQ M+ L+EKNLQL H+IP++IKSL ++G
Sbjct  942   DDIDVKSIAEGS-VKLNMEEFMLGSVVDVIISQSMLSLREKNLQLFHEIPEEIKSLSLHG  1000

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V HAPS +GWVEI++SPGLKLIQDGN +I +QFRMTHPGQGLP+
Sbjct  1001  DQIRLQLVLSDFLLNVVNHAPSSNGWVEIKISPGLKLIQDGNNYIRLQFRMTHPGQGLPT  1060

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             AL++DM  GG RWTTQEG+ L+LS+K++  MNG V YVRE  KCYFL++++ K +K R R
Sbjct  1061  ALVQDMFEGGNRWTTQEGLGLNLSRKILNRMNGQVQYVREHDKCYFLVNIELKHKKERQR  1120



>gb|KHG11315.1| Phytochrome E [Gossypium arboreum]
Length=1127

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = -3

Query  732   DGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVL  553
             D   +EL  EEFV+GNV+DAVVSQVMI LKE+NLQL H+ P +IK+L +YGD+I+LQLVL
Sbjct  951   DEGSMELSMEEFVLGNVLDAVVSQVMILLKERNLQLFHETPKEIKALSLYGDRIRLQLVL  1010

Query  552   SDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRG  373
             SDFLL++V HAPSPDGWVEI++S GLKL++DGNEF+ +QFRMTHPG+GLPS LI++M+  
Sbjct  1011  SDFLLNMVHHAPSPDGWVEIKISRGLKLLRDGNEFLRLQFRMTHPGKGLPSTLIQEMLES  1070

Query  372   GTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRES  214
             G  WTTQEG+ L++S+KL+  MNGHV YVRE  KCYFLIDL+ KT K R + S
Sbjct  1071  GNSWTTQEGLGLNMSRKLLNRMNGHVQYVREHNKCYFLIDLEIKT-KGRQKAS  1122



>gb|KJB69756.1| hypothetical protein B456_011G040900 [Gossypium raimondii]
 gb|KJB69757.1| hypothetical protein B456_011G040900 [Gossypium raimondii]
 gb|KJB69758.1| hypothetical protein B456_011G040900 [Gossypium raimondii]
Length=1127

 Score =   246 bits (627),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD     +G  +EL  EEFV+GNV+DAVVSQVMI +KE+NLQL H+ P +I +L +YG
Sbjct  943   EDMDFRSNDEG--MELSMEEFVLGNVLDAVVSQVMILIKERNLQLFHETPKEIMALSLYG  1000

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+I+LQLVLSDFLL++V HAPSPDGWVEI++SPGLKL++DGNEF+ +QFRMTHPG+GLPS
Sbjct  1001  DRIRLQLVLSDFLLNMVHHAPSPDGWVEIKISPGLKLLRDGNEFLRLQFRMTHPGKGLPS  1060

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              LI++M+  G  WTTQEG+ L++S+KL+  MNGHV YVRE  KCYFL+DL+ KT K R +
Sbjct  1061  TLIQEMLESGNSWTTQEGLGLNMSRKLLNRMNGHVQYVREHNKCYFLVDLEIKT-KGRQK  1119

Query  219   ES  214
              S
Sbjct  1120  AS  1121



>ref|XP_008371559.1| PREDICTED: phytochrome E-like [Malus domestica]
Length=1130

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E++D   I +G+ V+L  EEF +G+V+DA++SQ M+ L+EKNLQL H+IP++IKSL ++G
Sbjct  942   EDIDVKSIAEGS-VKLNMEEFXLGSVVDAIISQSMLLLREKNLQLFHEIPEEIKSLSLHG  1000

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V H PS +GWVEI++SPGLKLIQDGN +I +QFRMTHPGQGLP+
Sbjct  1001  DQIRLQLVLSDFLLNVVNHTPSSNGWVEIKISPGLKLIQDGNNYIRLQFRMTHPGQGLPT  1060

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              L++DM  GG RWTTQEG+ L+LS+K++  MNG V YVRE  KCYFL++++ K +K R R
Sbjct  1061  TLVQDMFEGGNRWTTQEGLGLNLSRKILNRMNGQVQYVREHDKCYFLVNIELKHKKERQR  1120



>ref|XP_008383527.1| PREDICTED: phytochrome E-like [Malus domestica]
Length=1132

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 148/190 (78%), Gaps = 5/190 (3%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   + +G+  +L  EEF++GNV+D ++ Q M+ L+EKNLQLLH+IP++IKSL + G
Sbjct  942   EDMDVRSVAEGS-AKLNMEEFMLGNVLDVIICQSMLSLREKNLQLLHEIPEEIKSLSLQG  1000

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V HAPSP+GWVEI++SPG KLIQD N +I +Q RMTHPGQGLP+
Sbjct  1001  DQIRLQLVLSDFLLNVVSHAPSPNGWVEIKISPGXKLIQDNNNYIRLQIRMTHPGQGLPA  1060

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              LI+DM  GG RWTTQEG  L+LS+KL+  MNG V YVRE  KCYFL+D++ + +K R R
Sbjct  1061  VLIQDMFEGGNRWTTQEGFGLNLSRKLLNRMNGKVQYVREHNKCYFLVDIELQMKKERQR  1120

Query  219   ----ESSMDT  202
                 E+ M T
Sbjct  1121  LPVSEADMST  1130



>ref|XP_006449616.1| hypothetical protein CICLE_v10014092mg [Citrus clementina]
 gb|ESR62856.1| hypothetical protein CICLE_v10014092mg [Citrus clementina]
Length=1130

 Score =   243 bits (619),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             + MD   I +GN +EL  EEF++GN++DAVVSQVM+ L+++NLQLLHDIP++IK+L +YG
Sbjct  952   DGMDLRCIEEGN-MELNLEEFLLGNILDAVVSQVMVFLRDRNLQLLHDIPEEIKALSLYG  1010

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+I+LQLVLSDFL  +VRHAPSPDGWVEI+V PGL+LI+D ++F+H+QFR+THPG+G+PS
Sbjct  1011  DRIRLQLVLSDFLHCVVRHAPSPDGWVEIKVLPGLRLIKDADQFVHVQFRLTHPGEGIPS  1070

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              LIEDM  G  +WTT EG+ L LS+KL+ MMNG V YVRE  KCYF+IDL+ KT+
Sbjct  1071  HLIEDMYNGRNQWTTPEGLGLKLSRKLLIMMNGRVRYVRENSKCYFVIDLELKTR  1125



>gb|KDO78033.1| hypothetical protein CISIN_1g001210mg [Citrus sinensis]
Length=1093

 Score =   242 bits (618),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             + MD   I +GN +ELK+EEF++GN++DAVVSQVM+ L++KNL LLHDIP++IK+L + G
Sbjct  915   DGMDLRCIEEGN-MELKSEEFLLGNILDAVVSQVMVLLRDKNLHLLHDIPEEIKALSLNG  973

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+I+LQLVLSDFL  +VRHAPSPDGWVEI+V PGLKLI+D ++F+H+QFR+THPG+G+PS
Sbjct  974   DRIRLQLVLSDFLHCVVRHAPSPDGWVEIKVLPGLKLIKDADQFVHVQFRLTHPGEGIPS  1033

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              LIEDM  G  +WTT EG+ L LS+KL+ MMNG V YVRE  KCYF+IDL+ KT+
Sbjct  1034  HLIEDMYNGRNQWTTPEGLGLKLSRKLLIMMNGRVRYVRENSKCYFVIDLELKTR  1088



>ref|XP_006467542.1| PREDICTED: phytochrome E-like isoform X2 [Citrus sinensis]
Length=1093

 Score =   242 bits (618),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             + MD   I +GN +ELK+EEF++GN++DAVVSQVM+ L++KNL LLHDIP++IK+L + G
Sbjct  915   DGMDLRCIEEGN-MELKSEEFLLGNILDAVVSQVMVLLRDKNLHLLHDIPEEIKALSLNG  973

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+I+LQLVLSDFL  +VRHAPSPDGWVEI+V PGLKLI+D ++F+H+QFR+THPG+G+PS
Sbjct  974   DRIRLQLVLSDFLHCVVRHAPSPDGWVEIKVLPGLKLIKDADQFVHVQFRLTHPGEGIPS  1033

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              LIEDM  G  +WTT EG+ L LS+KL+ MMNG V YVRE  KCYF+IDL+ KT+
Sbjct  1034  HLIEDMYNGRNQWTTPEGLGLKLSRKLLIMMNGRVRYVRENSKCYFVIDLELKTR  1088



>gb|KHN04123.1| Phytochrome E [Glycine soja]
Length=1063

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = -3

Query  741   GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
             G ++ + ++L  EEFV+GN++DA+VSQVM+ ++EKNLQL H+IPD+IK L +YGDQI+LQ
Sbjct  880   GSINEDTLQLNVEEFVLGNILDAIVSQVMMLIREKNLQLFHEIPDEIKMLSLYGDQIRLQ  939

Query  561   LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
             +VLSDFLL++V H  SP+GWVEI+VSP LK+IQDG+EFIH+QFR+ H GQG+PS +I +M
Sbjct  940   VVLSDFLLNVVSHTASPNGWVEIKVSPTLKIIQDGDEFIHLQFRIAHSGQGIPSNVIHEM  999

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             V GG +WTTQEG+ L++S+K++R M+GHVHY R Q  CYFLIDL+ +T+K R R
Sbjct  1000  VEGGNQWTTQEGLGLYMSRKILRRMSGHVHYQRGQDMCYFLIDLEIRTRKERQR  1053



>gb|KDO78034.1| hypothetical protein CISIN_1g001210mg [Citrus sinensis]
Length=1123

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             + MD   I +GN +ELK+EEF++GN++DAVVSQVM+ L++KNL LLHDIP++IK+L + G
Sbjct  945   DGMDLRCIEEGN-MELKSEEFLLGNILDAVVSQVMVLLRDKNLHLLHDIPEEIKALSLNG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+I+LQLVLSDFL  +VRHAPSPDGWVEI+V PGLKLI+D ++F+H+QFR+THPG+G+PS
Sbjct  1004  DRIRLQLVLSDFLHCVVRHAPSPDGWVEIKVLPGLKLIKDADQFVHVQFRLTHPGEGIPS  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              LIEDM  G  +WTT EG+ L LS+KL+ MMNG V YVRE  KCYF+IDL+ KT+
Sbjct  1064  HLIEDMYNGRNQWTTPEGLGLKLSRKLLIMMNGRVRYVRENSKCYFVIDLELKTR  1118



>ref|XP_006467541.1| PREDICTED: phytochrome E-like isoform X1 [Citrus sinensis]
Length=1123

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             + MD   I +GN +ELK+EEF++GN++DAVVSQVM+ L++KNL LLHDIP++IK+L + G
Sbjct  945   DGMDLRCIEEGN-MELKSEEFLLGNILDAVVSQVMVLLRDKNLHLLHDIPEEIKALSLNG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+I+LQLVLSDFL  +VRHAPSPDGWVEI+V PGLKLI+D ++F+H+QFR+THPG+G+PS
Sbjct  1004  DRIRLQLVLSDFLHCVVRHAPSPDGWVEIKVLPGLKLIKDADQFVHVQFRLTHPGEGIPS  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              LIEDM  G  +WTT EG+ L LS+KL+ MMNG V YVRE  KCYF+IDL+ KT+
Sbjct  1064  HLIEDMYNGRNQWTTPEGLGLKLSRKLLIMMNGRVRYVRENSKCYFVIDLELKTR  1118



>ref|XP_004488313.1| PREDICTED: phytochrome E-like isoform X1 [Cicer arietinum]
Length=1139

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G+  +L  EEF++GN++DAVVSQVM+ +K K+LQL H+IPD+IK+L +YG
Sbjct  949   EDTDLESINEGSTWQLNMEEFLLGNILDAVVSQVMMLIKGKDLQLFHEIPDEIKTLSLYG  1008

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQ+VLSD LL+IV H PSP+GW+EI++S GLK+IQDGNEFIH++FRMTH G+GLPS
Sbjct  1009  DQIRLQVVLSDILLNIVTHTPSPNGWIEIKISHGLKIIQDGNEFIHLKFRMTHSGRGLPS  1068

Query  399   ALIEDMVR-GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRS  223
             +++ DM   GG +W+TQEG+ L++S+K++  MNG VHYVREQ KCYFLIDL+ +T+K R 
Sbjct  1069  SVLHDMFEGGGNQWSTQEGLGLYMSRKILSRMNGDVHYVREQNKCYFLIDLELRTRKERP  1128

Query  222   R  220
             R
Sbjct  1129  R  1129



>ref|NP_001276186.1| phytochrome E-like [Glycine max]
 gb|AEX08379.1| phytochrome E2 [Glycine max]
Length=1121

 Score =   240 bits (613),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+   G I + + ++L  EEFV+GN++DA+VSQVM+ ++EKNLQL H+IPD+IK L +YG
Sbjct  932   EDTHLGSINEDSTLQLNVEEFVLGNILDAIVSQVMMLIREKNLQLFHEIPDEIKMLSLYG  991

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQ+VLSDFLL++V H  SP+GWVEI+VSP LK+IQDG+EFIH+QFR+ H GQG+PS
Sbjct  992   DQIRLQVVLSDFLLNVVSHTASPNGWVEIKVSPTLKIIQDGDEFIHLQFRIAHSGQGIPS  1051

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              +I +MV GG +WTTQEG+ L++S+K++R M+GHV Y R Q  CYFLIDL+ +T+K R R
Sbjct  1052  NVIHEMVEGGNQWTTQEGLGLYMSRKILRRMSGHVRYQRGQDMCYFLIDLEIRTRKERQR  1111



>ref|XP_008358619.1| PREDICTED: phytochrome E-like [Malus domestica]
Length=1132

 Score =   240 bits (613),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 147/190 (77%), Gaps = 5/190 (3%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   + +G+  +L  EEF++GNV+D ++ Q M+ L+EKNLQLLH+IP++IKSL + G
Sbjct  942   EDMDVRSVAEGS-AKLNMEEFMLGNVLDVIICQSMLSLREKNLQLLHEIPEEIKSLSLQG  1000

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDFLL++V HA SP+GWVEI++SPG KLIQD N +I +Q RMTHPGQGLP+
Sbjct  1001  DQIRLQLVLSDFLLNVVSHAXSPNGWVEIKISPGXKLIQDNNNYIRLQIRMTHPGQGLPA  1060

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              LI+DM  GG RWTTQEG  L+LS+KL+  MNG V YVRE  KCYFL+D++ + +K R R
Sbjct  1061  VLIQDMFEGGNRWTTQEGFGLNLSRKLLNRMNGKVQYVREHNKCYFLVDIELQMKKERQR  1120

Query  219   ----ESSMDT  202
                 E+ M T
Sbjct  1121  LPVSEADMST  1130



>ref|XP_010100997.1| Phytochrome E [Morus notabilis]
 gb|EXB86588.1| Phytochrome E [Morus notabilis]
Length=1123

 Score =   240 bits (612),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = -3

Query  750   DSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQI  571
             D G I +G+ +ELK EEF + NV+DA+VSQ MI L+EKNLQL H+IP+ IKSL +YGD I
Sbjct  937   DLGNIEEGS-LELKMEEFRLRNVLDAIVSQAMILLREKNLQLFHEIPEDIKSLYLYGDHI  995

Query  570   KLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALI  391
             +LQLVLSDFLL++V HAP+ DGWVE+ +SPGLKLIQD NEFI +QFR++HPG+GLP+AL+
Sbjct  996   RLQLVLSDFLLNVVHHAPASDGWVELEISPGLKLIQDDNEFIRLQFRISHPGEGLPAALV  1055

Query  390   EDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRESS  211
             +DM  GG + TTQEG+ L+LS+KL+  MNG V YVRE  +CYFLID+ FK +K R R  S
Sbjct  1056  QDMFEGGKQLTTQEGLGLNLSRKLLSRMNGQVKYVREHSRCYFLIDIGFKMRKERQRGGS  1115



>emb|CAN62723.1| hypothetical protein VITISV_030984 [Vitis vinifera]
Length=1162

 Score =   240 bits (612),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D G I +G+ +EL  EEF++GNV+DAVVSQVM+ LKEK LQL+ +IP++IK+LP+ GD
Sbjct  940   DIDMGIIEEGSSMELNVEEFLLGNVLDAVVSQVMMLLKEKKLQLVCEIPEEIKTLPLSGD  999

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QIKLQ VLSDFL +IV HAPS DGW+EI++S GLK+IQD NEFIH+QFRMTH GQGLP  
Sbjct  1000  QIKLQQVLSDFLHNIVHHAPSSDGWIEIKISTGLKMIQDFNEFIHLQFRMTHIGQGLPPD  1059

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             LI+DM  GG +W TQEG+ L+LS+KL+  MNG V YVRE  KCYFL+D+D K ++ R +
Sbjct  1060  LIQDMFEGGDQWNTQEGLGLNLSRKLLSAMNGRVQYVREHGKCYFLVDIDLKNRRAREK  1118



>ref|XP_003546574.1| PREDICTED: phytochrome E-like [Glycine max]
Length=1121

 Score =   239 bits (611),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -3

Query  741   GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
             G ++ + ++L  EEFV+GN++DA+VSQVM+ ++EKNLQL H+IPD+IK L +YGDQI+LQ
Sbjct  938   GSINEDTLQLNVEEFVLGNILDAIVSQVMMLIREKNLQLFHEIPDEIKMLSLYGDQIRLQ  997

Query  561   LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
             +VLSDFLL++V H  SP+GWVEI+VSP LK+IQDG+EFIH+QFR+ H GQG+PS +I +M
Sbjct  998   VVLSDFLLNVVSHTASPNGWVEIKVSPTLKIIQDGDEFIHLQFRIAHSGQGIPSNVIHEM  1057

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             V GG +WTTQEG+ L++S+K++R M+GHV Y R Q  CYFLIDL+ +T+K R R
Sbjct  1058  VEGGNQWTTQEGLGLYMSRKILRRMSGHVRYQRGQDMCYFLIDLEIRTRKERQR  1111



>ref|XP_006467543.1| PREDICTED: phytochrome E-like isoform X3 [Citrus sinensis]
Length=1078

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             ++  + +ELK+EEF++GN++DAVVSQVM+ L++KNL LLHDIP++IK+L + GD+I+LQL
Sbjct  906   LLSRSNMELKSEEFLLGNILDAVVSQVMVLLRDKNLHLLHDIPEEIKALSLNGDRIRLQL  965

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VLSDFL  +VRHAPSPDGWVEI+V PGLKLI+D ++F+H+QFR+THPG+G+PS LIEDM 
Sbjct  966   VLSDFLHCVVRHAPSPDGWVEIKVLPGLKLIKDADQFVHVQFRLTHPGEGIPSHLIEDMY  1025

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              G  +WTT EG+ L LS+KL+ MMNG V YVRE  KCYF+IDL+ KT+
Sbjct  1026  NGRNQWTTPEGLGLKLSRKLLIMMNGRVRYVRENSKCYFVIDLELKTR  1073



>emb|CBI30813.3| unnamed protein product [Vitis vinifera]
Length=877

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -3

Query  741  GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
            GI++   +EL  EEF++GNV+DAVVSQVM+ LKEK LQL+ +IP++IK+LP+ GDQIKLQ
Sbjct  697  GIIEEGSMELNVEEFLLGNVLDAVVSQVMMLLKEKKLQLVCEIPEEIKTLPLSGDQIKLQ  756

Query  561  LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
             VLSDFL +IV HAPS DGW+EI++S GLK+IQD NEF+H+QFRMTH GQGLP  LI+DM
Sbjct  757  QVLSDFLHNIVHHAPSSDGWIEIKISTGLKMIQDFNEFVHLQFRMTHIGQGLPPDLIQDM  816

Query  381  VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              GG +W TQEG+ L+LS+KL+  MNG V YVRE  KCYFL+D+D K ++ R +
Sbjct  817  FEGGDQWNTQEGLGLNLSRKLLSAMNGRVQYVREHGKCYFLVDIDLKNRRAREK  870



>ref|XP_002271671.1| PREDICTED: phytochrome E [Vitis vinifera]
 gb|ACC60968.1| phytochrome E [Vitis vinifera]
Length=1124

 Score =   238 bits (606),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -3

Query  741   GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
             GI++   +EL  EEF++GNV+DAVVSQVM+ LKEK LQL+ +IP++IK+LP+ GDQIKLQ
Sbjct  944   GIIEEGSMELNVEEFLLGNVLDAVVSQVMMLLKEKKLQLVCEIPEEIKTLPLSGDQIKLQ  1003

Query  561   LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
              VLSDFL +IV HAPS DGW+EI++S GLK+IQD NEF+H+QFRMTH GQGLP  LI+DM
Sbjct  1004  QVLSDFLHNIVHHAPSSDGWIEIKISTGLKMIQDFNEFVHLQFRMTHIGQGLPPDLIQDM  1063

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
               GG +W TQEG+ L+LS+KL+  MNG V YVRE  KCYFL+D+D K ++ R +
Sbjct  1064  FEGGDQWNTQEGLGLNLSRKLLSAMNGRVQYVREHGKCYFLVDIDLKNRRAREK  1117



>ref|XP_003595571.1| Phytochrome E [Medicago truncatula]
 gb|ABD33241.1| Bacteriophytochrome [Medicago truncatula]
 gb|AES65822.1| phytochrome protein [Medicago truncatula]
Length=1122

 Score =   238 bits (606),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E++D G I +G   +L  +EF++GN++DAVVSQVM+ +K K+LQ+ H+I D+I++L +YG
Sbjct  932   EDIDLGSINEGTW-KLNMKEFLLGNILDAVVSQVMMLIKGKDLQMFHEISDKIQTLSLYG  990

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQ+VLSD L +IV H PSP+GW+E++++PGLK+IQDGNEFIH++FRMTH GQGLPS
Sbjct  991   DQIRLQMVLSDILHNIVSHTPSPNGWIEMKITPGLKIIQDGNEFIHLKFRMTHSGQGLPS  1050

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             +++ DM  G  +WTTQEG+ L +S+K++  MNG VHYVREQ KCYFLIDL+ +T+K R R
Sbjct  1051  SILHDMFYGENQWTTQEGLGLFMSRKILSRMNGDVHYVREQNKCYFLIDLELRTRKERQR  1110

Query  219   ESSMDT  202
                 +T
Sbjct  1111  NLKTET  1116



>ref|XP_004488314.1| PREDICTED: phytochrome E-like isoform X2 [Cicer arietinum]
Length=1138

 Score =   237 bits (605),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G   +L  EEF++GN++DAVVSQVM+ +K K+LQL H+IPD+IK+L +YG
Sbjct  949   EDTDLESINEGTW-QLNMEEFLLGNILDAVVSQVMMLIKGKDLQLFHEIPDEIKTLSLYG  1007

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQ+VLSD LL+IV H PSP+GW+EI++S GLK+IQDGNEFIH++FRMTH G+GLPS
Sbjct  1008  DQIRLQVVLSDILLNIVTHTPSPNGWIEIKISHGLKIIQDGNEFIHLKFRMTHSGRGLPS  1067

Query  399   ALIEDMVR-GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRS  223
             +++ DM   GG +W+TQEG+ L++S+K++  MNG VHYVREQ KCYFLIDL+ +T+K R 
Sbjct  1068  SVLHDMFEGGGNQWSTQEGLGLYMSRKILSRMNGDVHYVREQNKCYFLIDLELRTRKERP  1127

Query  222   R  220
             R
Sbjct  1128  R  1128



>ref|NP_001273774.1| phytochrome E-like [Glycine max]
 gb|AEX08378.1| phytochrome E1 [Glycine max]
Length=1120

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ + G I +G  ++L  EEFV+GN++DA+VSQVM+ ++EKNLQL H+IPD+IK L +YG
Sbjct  933   EDTNLGSINEGT-LQLNMEEFVLGNILDAIVSQVMMLIREKNLQLFHEIPDEIKMLSLYG  991

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQ+VLSDFLL++V H  SP+GWVEI++SPGL L QDGNEFIH++F M H GQG+PS
Sbjct  992   DQIRLQVVLSDFLLNVVSHTASPNGWVEIKISPGLTL-QDGNEFIHLKFSMAHSGQGIPS  1050

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              ++ DM  GG +WTTQEG+ L++S+K++  ++GHV YVREQ KCYFLIDL+ + +K R R
Sbjct  1051  NVLHDMFEGGNQWTTQEGLGLYMSRKILSRISGHVQYVREQNKCYFLIDLEIRKRKERKR  1110

Query  219   ESSMDT  202
                 +T
Sbjct  1111  NLHAET  1116



>gb|ACC60972.1| phytochrome E [Vitis riparia]
Length=1124

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -3

Query  741   GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
             GI++   +EL  EEF++GNV+DAVVSQVM+ LKEK LQL+ +IP++IK+LP+ GDQIKLQ
Sbjct  944   GIIEEGSMELNVEEFLLGNVLDAVVSQVMMLLKEKKLQLVCEIPEEIKTLPLSGDQIKLQ  1003

Query  561   LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
              VLSDFL +IV HAPS DGW+EI++S GLK+IQD NEFIH+QFRMTH GQGLP  LI+DM
Sbjct  1004  QVLSDFLHNIVHHAPSSDGWIEIKISTGLKMIQDFNEFIHLQFRMTHIGQGLPPDLIQDM  1063

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
               GG +W TQEG+ L+LS+KL+  MNG V YVRE  KCYFL+++D K ++ R +
Sbjct  1064  FEGGDQWNTQEGLGLNLSRKLLSAMNGRVQYVREHGKCYFLVEIDLKNRRAREK  1117



>gb|KHN41345.1| Phytochrome E [Glycine soja]
Length=1099

 Score =   236 bits (602),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ + G I +G  ++L  EEFV+GN++DA+VSQVM+ ++EKNLQL H+IPD+IK L +YG
Sbjct  912   EDTNLGSINEGT-LQLNMEEFVLGNILDAIVSQVMMLIREKNLQLFHEIPDEIKMLSLYG  970

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQ+VLSDFLL++V H  SP+GWVEI++SPGL L QDGNEFIH++F M H GQG+PS
Sbjct  971   DQIRLQVVLSDFLLNVVSHTASPNGWVEIKISPGLTL-QDGNEFIHLKFSMAHSGQGIPS  1029

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              ++ DM  GG +WTTQEG+ L++S+K++  ++GHV YVREQ KCYFLIDL+ + +K R R
Sbjct  1030  NVLHDMFEGGNQWTTQEGLGLYMSRKILSRISGHVQYVREQNKCYFLIDLEIRKRKERKR  1089

Query  219   ESSMDT  202
                 +T
Sbjct  1090  NLHAET  1095



>ref|XP_004295419.1| PREDICTED: phytochrome E-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1162

 Score =   236 bits (601),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ENMD+  I  G+ V L  EEF++G+V+DA+VSQ MI L+++N+Q LH++P++IKSL ++G
Sbjct  973   ENMDTRSIEQGSVV-LNMEEFLLGSVLDAIVSQSMISLRQRNVQFLHEVPNEIKSLYLHG  1031

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+IKLQLVLSDFLL++V HA SP+GWVEIR+SPGLKLI+DGN +I +QFRMT  GQGLP+
Sbjct  1032  DRIKLQLVLSDFLLNVVLHA-SPNGWVEIRISPGLKLIKDGNSYIRLQFRMTLSGQGLPT  1090

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             ALIEDM+  G RWTTQEG+ L+LS+KL+  MNG V YVRE  KCYFLID++  T+K R
Sbjct  1091  ALIEDMLDDGNRWTTQEGLGLNLSRKLLSRMNGRVQYVREHDKCYFLIDIELGTRKER  1148



>ref|XP_004288913.2| PREDICTED: phytochrome E-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1148

 Score =   235 bits (599),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ENMD+  I  G+ V L  EEF++G+++D +VSQ MI L+++N+QL H+IP++IKSL ++G
Sbjct  959   ENMDTRSIEQGSVV-LNMEEFLLGSLLDVIVSQAMISLRQRNVQLFHEIPNEIKSLYLHG  1017

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQLVLSDFLL++V HA SPD WVEIR+SPGLKLI+DGN +I +QFRMT PGQGLP+
Sbjct  1018  DQIKLQLVLSDFLLNVVHHA-SPDSWVEIRISPGLKLIKDGNSYIRLQFRMTLPGQGLPT  1076

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             ALIED    G RWTTQEG+ L++S+KL+  MNG V YVRE  KCYFLID++ +T+K R
Sbjct  1077  ALIEDTFDDGIRWTTQEGLGLNMSRKLLCRMNGRVQYVREHDKCYFLIDIELRTRKER  1134



>ref|XP_011460392.1| PREDICTED: phytochrome E-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1161

 Score =   235 bits (599),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 146/178 (82%), Gaps = 3/178 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ENMD+  I  G  V L  EEF++G+V+DA+VSQ MI L+++N+Q LH++P++IKSL ++G
Sbjct  973   ENMDTRSIEQG--VVLNMEEFLLGSVLDAIVSQSMISLRQRNVQFLHEVPNEIKSLYLHG  1030

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+IKLQLVLSDFLL++V HA SP+GWVEIR+SPGLKLI+DGN +I +QFRMT  GQGLP+
Sbjct  1031  DRIKLQLVLSDFLLNVVLHA-SPNGWVEIRISPGLKLIKDGNSYIRLQFRMTLSGQGLPT  1089

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             ALIEDM+  G RWTTQEG+ L+LS+KL+  MNG V YVRE  KCYFLID++  T+K R
Sbjct  1090  ALIEDMLDDGNRWTTQEGLGLNLSRKLLSRMNGRVQYVREHDKCYFLIDIELGTRKER  1147



>ref|XP_011459626.1| PREDICTED: phytochrome E-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1147

 Score =   234 bits (597),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 3/178 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ENMD+  I  G  V L  EEF++G+++D +VSQ MI L+++N+QL H+IP++IKSL ++G
Sbjct  959   ENMDTRSIEQG--VVLNMEEFLLGSLLDVIVSQAMISLRQRNVQLFHEIPNEIKSLYLHG  1016

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQLVLSDFLL++V HA SPD WVEIR+SPGLKLI+DGN +I +QFRMT PGQGLP+
Sbjct  1017  DQIKLQLVLSDFLLNVVHHA-SPDSWVEIRISPGLKLIKDGNSYIRLQFRMTLPGQGLPT  1075

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             ALIED    G RWTTQEG+ L++S+KL+  MNG V YVRE  KCYFLID++ +T+K R
Sbjct  1076  ALIEDTFDDGIRWTTQEGLGLNMSRKLLCRMNGRVQYVREHDKCYFLIDIELRTRKER  1133



>ref|XP_009353857.1| PREDICTED: phytochrome E-like [Pyrus x bretschneideri]
 ref|XP_009360823.1| PREDICTED: phytochrome E-like [Pyrus x bretschneideri]
Length=1134

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 144/190 (76%), Gaps = 5/190 (3%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD     +G+  +L  EEF++GNV+D ++ Q M+ L+EKNLQL H+IP++IKSL + G
Sbjct  945   EDMDVRSRAEGS-TKLNMEEFMLGNVLDVIICQSMLSLREKNLQLFHEIPEEIKSLSLQG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQI+LQLVLSDF L++V HAPSP+GWVEI++SPGLKLIQD N  I +Q RMTHPGQGLP+
Sbjct  1004  DQIRLQLVLSDFWLNVVNHAPSPNGWVEIKISPGLKLIQDDNNDIRLQIRMTHPGQGLPA  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              LI+DM  GG RWTT EG  L+LS+KL+  MNG V YVRE  KCYF++D++ K +K R R
Sbjct  1064  VLIQDMFEGGNRWTTPEGFGLNLSRKLLNRMNGKVQYVREHNKCYFVVDIELKMKKQRQR  1123

Query  219   ----ESSMDT  202
                 E+ M T
Sbjct  1124  LPVSEAEMST  1133



>ref|XP_004147430.1| PREDICTED: phytochrome E-like [Cucumis sativus]
Length=1134

 Score =   229 bits (583),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   + +G +VE+  ++F++G+V+DA++ Q+MI ++E+N+QL H+IP++IK+L + G
Sbjct  947   EDMDFRSL-EGGQVEINRQDFLLGSVLDAIICQIMIVVRERNIQLFHEIPEEIKTLTLCG  1005

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQ+VLSDFLL+IV++AP  DGWVEI++S GLKLIQDGNE IH+Q RM+HPGQGLP 
Sbjct  1006  DQIKLQMVLSDFLLNIVQYAPVLDGWVEIKISSGLKLIQDGNEHIHLQIRMSHPGQGLPH  1065

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              LI+DMV GG +WT+++G+ L+LS++L+  +NG+V YVREQ KCYFLIDL+ K ++ R  
Sbjct  1066  ELIQDMVGGGQQWTSEQGLALNLSRRLLNKLNGNVRYVREQTKCYFLIDLELKLRRLRGS  1125

Query  219   ESSMDTK  199
               +  ++
Sbjct  1126  TEATTSQ  1132



>ref|XP_008443902.1| PREDICTED: LOW QUALITY PROTEIN: phytochrome E [Cucumis melo]
Length=1132

 Score =   229 bits (583),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   + +G +VE+  ++F++G+V+DA++ Q+MI ++E+N+QL H+IP++IK+L + G
Sbjct  945   EDMDFRRLEEG-QVEINRQDFLLGSVLDAIICQIMIVVRERNIQLFHEIPEEIKTLTLCG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQIKLQ+VLSDFLL+IV++AP  DGWVEI++S GLKLIQDGNE IH+Q RM+HPGQGLP 
Sbjct  1004  DQIKLQMVLSDFLLNIVQYAPVQDGWVEIKISSGLKLIQDGNEHIHLQIRMSHPGQGLPH  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
              LI+DMV GG +WT+++G+ L+LS++L+  +NG+V YVREQ KCYFLIDL+ K ++ R
Sbjct  1064  ELIQDMVGGGQQWTSEQGLALNLSRRLLNKLNGNVRYVREQTKCYFLIDLELKLRRSR  1121



>ref|XP_011085288.1| PREDICTED: phytochrome E [Sesamum indicum]
Length=1120

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 137/173 (79%), Gaps = 1/173 (1%)
 Frame = -3

Query  744   GGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKL  565
             G + +GN +ELK EEF++ NVI+A++SQ M  L+EK LQL+HDIP+QIK+L +YGDQIKL
Sbjct  949   GSLEEGN-MELKVEEFLLVNVINAILSQAMNLLREKKLQLIHDIPEQIKTLRVYGDQIKL  1007

Query  564   QLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIED  385
             QL LS+ LL+IV +APSPDGWVEI VS GLKLIQD NEF+H+QFRM+HPG+G+PSALIE+
Sbjct  1008  QLALSNLLLTIVDYAPSPDGWVEINVSHGLKLIQDRNEFVHLQFRMSHPGEGIPSALIEE  1067

Query  384   MVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
             M        TQEG+ L+LSQK+V MMNG V Y+ ++ KC FL+DL  K  K R
Sbjct  1068  MFGAKNHSATQEGLALNLSQKIVSMMNGSVRYISDESKCCFLVDLQLKLWKSR  1120



>gb|ACE79200.1| phytochrome B-3 [Glycine max]
Length=1100

 Score =   204 bits (518),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  922   DVDLESIEDGS-LELEKGEFLLGNVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  980

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  981   QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVRPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1040

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L +S+K++++MNG V Y+RE ++CYF + L+     P +R 
Sbjct  1041  LIQDMF-NNSRWGTQEGLGLSMSRKILKLMNGEVQYIREAERCYFYVLLEL----PVTRR  1095

Query  216   SS  211
             SS
Sbjct  1096  SS  1097



>gb|ACJ61499.1| phytochrome B [Glycine max]
Length=1100

 Score =   204 bits (518),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  922   DVDLESIEDGS-LELEKGEFLLGNVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  980

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  981   QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVRPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1040

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L +S+K++++MNG V Y+RE ++CYF + L+     P +R 
Sbjct  1041  LIQDMF-NNSRWGTQEGLGLSMSRKILKLMNGEVQYIREAERCYFYVLLEL----PVTRR  1095

Query  216   SS  211
             SS
Sbjct  1096  SS  1097



>gb|KHN12867.1| Phytochrome B [Glycine soja]
Length=1097

 Score =   203 bits (517),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  919   DVDLESIEDGS-LELEKGEFLLGNVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  977

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  978   QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVRPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1037

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L +S+K++++MNG V Y+RE ++CYF + L+     P +R 
Sbjct  1038  LIQDMF-NNSRWGTQEGLGLSMSRKILKLMNGEVQYIREAERCYFYVLLEL----PVTRR  1092

Query  216   SS  211
             SS
Sbjct  1093  SS  1094



>ref|NP_001240097.1| phytochrome B-like [Glycine max]
 gb|ACE79198.2| phytochrome B-1 [Glycine max]
Length=1137

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  959   DVDLESIEDGS-LELEKGEFLLGNVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  1017

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  1018  QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVRPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1077

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L +S+K++++MNG V Y+RE ++CYF + L+     P +R 
Sbjct  1078  LIQDMF-NNSRWGTQEGLGLSMSRKILKLMNGEVQYIREAERCYFYVLLEL----PVTRR  1132

Query  216   SS  211
             SS
Sbjct  1133  SS  1134



>gb|AEA41043.1| phytochrome B [Amphicarpaea edgeworthii]
Length=1105

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 137/182 (75%), Gaps = 5/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I D   +EL+  EF++GNVI+AVVSQV++ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  926   DIDLESIEDRYSLELEKGEFLLGNVINAVVSQVLLLLRERNLQLIRDIPEEIKTLAVYGD  985

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  986   QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVRPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1045

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L +S+K++++MNG V Y+RE ++CYF + L+     P +R 
Sbjct  1046  LIQDMF-NNSRWGTQEGLGLSMSRKILKLMNGEVQYIREAERCYFYVLLEL----PVTRR  1100

Query  216   SS  211
             SS
Sbjct  1101  SS  1102



>sp|P42499.1|PHYB_SOYBN RecName: Full=Phytochrome B [Glycine max]
 gb|AAA34000.1| phytochrome B [Glycine max]
Length=1156

 Score =   202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQV++ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  978   DVDLESIEDGS-LELEKGEFLLGNVINAVVSQVILLLRERNLQLIRDIPEEIKTLAVYGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  1037  QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVRPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1096

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L +S+K++++MNG V Y+RE ++CYF + L+     P +R 
Sbjct  1097  LIQDMF-NNSRWGTQEGLGLSMSRKILKLMNGEVQYIREAERCYFYVLLEL----PVTRR  1151

Query  216   SS  211
             SS
Sbjct  1152  SS  1153



>dbj|BAF44083.1| phytochrome b [Lotus japonicus]
Length=1143

 Score =   201 bits (511),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  964   DVDLESIEDGS-LELERGEFLLGNVINAVVSQVMVLLRERNLQLIRDIPEEIKTLAVYGD  1022

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFL ++VR+APSPDGWVEI V P +K I DG   +H +FR+  PG+GLPS 
Sbjct  1023  QLRIQQVLADFLSNVVRYAPSPDGWVEIHVYPKIKQISDGLTLLHAEFRLVCPGEGLPSE  1082

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             L++DM    +RW TQEG+ L +S+K++++MNG V Y+RE ++CYF + L+     P +R 
Sbjct  1083  LVQDMFH-NSRWVTQEGLGLCMSRKILKLMNGEVQYIREAERCYFFVLLEL----PVTRR  1137

Query  216   SS  211
             SS
Sbjct  1138  SS  1139



>ref|XP_007147366.1| hypothetical protein PHAVU_006G118200g [Phaseolus vulgaris]
 gb|ESW19360.1| hypothetical protein PHAVU_006G118200g [Phaseolus vulgaris]
Length=1132

 Score =   201 bits (510),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 136/179 (76%), Gaps = 2/179 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+ LQL+ DIP++IK+L +YGD
Sbjct  953   DVDLESIEDGS-LELEKGEFLLGNVINAVVSQVMLLLRERTLQLIRDIPEEIKALAVYGD  1011

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  1012  QLRIQQVLTDFLLNIVRYAPSPDGWVEIHVHPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1071

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             LI+DM    +RW +QEG+ L +S+K++++MNG V Y+RE ++CYF + L+    +  SR
Sbjct  1072  LIQDMF-NNSRWVSQEGLGLSMSRKILKVMNGEVQYIREAERCYFFVLLELPVTRRNSR  1129



>ref|XP_006841448.1| hypothetical protein AMTR_s00003p00079190 [Amborella trichopoda]
 gb|ERN03123.1| hypothetical protein AMTR_s00003p00079190 [Amborella trichopoda]
Length=1124

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 128/160 (80%), Gaps = 1/160 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL   EF++GNV+DAVVSQVMI L+EK+LQL+  IP++IK++ I+GDQ++LQ V
Sbjct  953   IEEGYLELDISEFLLGNVMDAVVSQVMILLREKDLQLIRAIPEEIKTMSIFGDQVRLQQV  1012

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL+IVR APSP+GWVEI V P LKLI DG   +H++FRM  PG+GLPS L++DM  
Sbjct  1013  LADFLLNIVRFAPSPEGWVEIEVKPYLKLISDGMGIVHLEFRMACPGEGLPSDLVQDMFH  1072

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLI  256
               +RW TQEG+ L++ +K++++MNG V Y+RE ++CYFLI
Sbjct  1073  -RSRWVTQEGLGLNMCRKILKLMNGEVQYIRESERCYFLI  1111



>gb|ACE79199.2| phytochrome B-2 [Glycine max]
Length=1149

 Score =   200 bits (508),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 138/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  971   DVDIESIEDGS-LELEKGEFLLGNVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  1029

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  1030  QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVHPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1089

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI++M    + W TQEG+ L +S+K++++MNG V Y+RE Q+CYF + L+     P +R 
Sbjct  1090  LIQNMF-NNSGWGTQEGLGLSMSRKILKLMNGEVQYIREAQRCYFYVLLEL----PVTRR  1144

Query  216   SS  211
             SS
Sbjct  1145  SS  1146



>ref|XP_003546314.1| PREDICTED: phytochrome B-like isoformX1 [Glycine max]
 ref|XP_006597696.1| PREDICTED: phytochrome B-like isoform X2 [Glycine max]
Length=1149

 Score =   200 bits (508),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 138/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++GNVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  971   DVDIESIEDGS-LELEKGEFLLGNVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  1029

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VLSDFLL+IVR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  1030  QLRIQQVLSDFLLNIVRYAPSPDGWVEIHVHPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1089

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI++M    + W TQEG+ L +S+K++++MNG V Y+RE Q+CYF + L+     P +R 
Sbjct  1090  LIQNMF-NNSGWGTQEGLGLSMSRKILKLMNGEVQYIREAQRCYFYVLLEL----PVTRR  1144

Query  216   SS  211
             SS
Sbjct  1145  SS  1146



>gb|KDP27911.1| hypothetical protein JCGZ_18991 [Jatropha curcas]
Length=1143

 Score =   199 bits (506),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF IGNVIDAVVSQVM+ L+E+NLQL+ DIP+++KSL +YGD
Sbjct  964   DVDLESIEDGS-LELEKAEFFIGNVIDAVVSQVMLLLRERNLQLIRDIPEEVKSLAVYGD  1022

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR APS +GWVEI V P LK   DG   +H++FRM  PG+GLP  
Sbjct  1023  QVRIQQVLADFLLNMVRCAPSSEGWVEIHVCPKLKQTSDGLSVVHMEFRMVCPGEGLPPE  1082

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             L++DM     RWTTQEG+ L + +K++++M G V Y+RE ++CYFL+ LD 
Sbjct  1083  LVQDMFH-SCRWTTQEGLGLSMCRKILKLMQGEVQYIRESERCYFLVILDL  1132



>ref|XP_008438960.1| PREDICTED: phytochrome B [Cucumis melo]
Length=1132

 Score =   199 bits (506),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   I DG  +EL+  EF++G+VI+AVVSQVMI L+E+NLQL+ DIP+++K++ +YG
Sbjct  952   EDMDLECIDDGT-MELEKGEFLLGSVINAVVSQVMILLRERNLQLIRDIPEEVKTMAVYG  1010

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+APSP+GWVEIRV P LK   +G    H +FR+  PG+GLP 
Sbjct  1011  DQVRIQQVLADFLLNMVRYAPSPEGWVEIRVCPLLKQNSEGITLAHTEFRIVCPGEGLPP  1070

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM   G RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+ 
Sbjct  1071  ELVQDMFHSG-RWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLITLEL  1121



>emb|CBI22877.3| unnamed protein product [Vitis vinifera]
Length=982

 Score =   197 bits (502),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -3

Query  756  NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
            ++D   I DG+ +EL+  EF++G+VI+AVVSQVMI L+E++LQL+ DIP+++K+L +YGD
Sbjct  803  DVDLDSIEDGS-LELERAEFLLGSVINAVVSQVMILLRERDLQLIRDIPEEVKTLAVYGD  861

Query  576  QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
            Q+++Q VL+DFLL++VR+APSPDGW+EI+V P LK I +  + +HI+FRM  PG+GLP  
Sbjct  862  QVRIQQVLADFLLNMVRYAPSPDGWIEIQVHPRLKQISEEVKLMHIEFRMVCPGEGLPPN  921

Query  396  LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
            LI+DM    +RW TQEG+ L + +K+++++NG V Y+RE ++CYFLI ++     PR   
Sbjct  922  LIQDMFH-SSRWMTQEGLGLSMCRKILKLINGEVQYIRESERCYFLISIELPV--PRRGS  978

Query  216  SSMD  205
             S+D
Sbjct  979  KSVD  982



>ref|XP_004165483.1| PREDICTED: phytochrome B-like [Cucumis sativus]
 gb|KGN57169.1| hypothetical protein Csa_3G166340 [Cucumis sativus]
Length=1132

 Score =   199 bits (505),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   I DG  +EL+  EF++G+VI+AVVSQVMI L+E++LQL+ DIP+++K++ +YG
Sbjct  952   EDMDLECIDDGT-MELEKGEFLLGSVINAVVSQVMILLRERSLQLIRDIPEEVKTMAVYG  1010

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+APSP+GWVEIRV P LK   DG    H +FR+  PG+GLP 
Sbjct  1011  DQVRIQQVLADFLLNMVRYAPSPEGWVEIRVCPLLKQNSDGITLAHTEFRIVCPGEGLPP  1070

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM   G RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+ 
Sbjct  1071  ELVQDMFHSG-RWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLITLEL  1121



>gb|EYU45495.1| hypothetical protein MIMGU_mgv1a000516mg [Erythranthe guttata]
Length=1101

 Score =   198 bits (504),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG  +EL+T EFV+G+VIDAVVSQVM+ L+E++LQL+ DIP+++K+L +YG
Sbjct  920   KDVDLENIEDGF-LELETAEFVLGSVIDAVVSQVMLLLRERDLQLIRDIPEEVKTLVVYG  978

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLLS+VR+APSPDGWVEI++ P +K + +G   +HI+FR+  PG+G+P 
Sbjct  979   DQVRVQQVLADFLLSMVRYAPSPDGWVEIQLRPSVKEVSEGRTTMHIEFRIVSPGEGIPP  1038

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM    +RW TQEG+ L + +K++++M G V Y+RE ++CYFLI LD 
Sbjct  1039  ELVQDMFH-SSRWVTQEGLGLSMCRKILKLMKGEVQYIRESERCYFLIVLDL  1089



>gb|ACC60970.1| phytochrome B [Vitis riparia]
Length=1129

 Score =   198 bits (503),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++G+VI+AVVSQVMI L+E++LQL+ DIP+++K+L +YGD
Sbjct  950   DVDLDSIEDGS-LELERAEFLLGSVINAVVSQVMILLRERDLQLIRDIPEEVKTLAVYGD  1008

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGW+EI+V P LK I +  + +HI+FRM  PG+GLP  
Sbjct  1009  QVRIQQVLADFLLNMVRYAPSPDGWIEIQVRPRLKQISEEVKLMHIEFRMVCPGEGLPPN  1068

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L + +K+++++NG V Y+RE ++CYFLI ++     PR   
Sbjct  1069  LIQDMFH-SSRWMTQEGLGLSMCRKILKLINGEVQYIRESERCYFLISIELPI--PRRGS  1125

Query  216   SSMD  205
              S+D
Sbjct  1126  KSVD  1129



>dbj|BAH47482.1| phytochrome E [Cardamine resedifolia]
Length=1116

 Score =   197 bits (502),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF + N++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLENILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTRDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>ref|XP_002278263.1| PREDICTED: phytochrome B [Vitis vinifera]
Length=1129

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++G+VI+AVVSQVMI L+E++LQL+ DIP+++K+L +YGD
Sbjct  950   DVDLDSIEDGS-LELERAEFLLGSVINAVVSQVMILLRERDLQLIRDIPEEVKTLAVYGD  1008

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGW+EI+V P LK I +  + +HI+FRM  PG+GLP  
Sbjct  1009  QVRIQQVLADFLLNMVRYAPSPDGWIEIQVHPRLKQISEEVKLMHIEFRMVCPGEGLPPN  1068

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW TQEG+ L + +K+++++NG V Y+RE ++CYFLI ++     PR   
Sbjct  1069  LIQDMFH-SSRWMTQEGLGLSMCRKILKLINGEVQYIRESERCYFLISIELPV--PRRGS  1125

Query  216   SSMD  205
              S+D
Sbjct  1126  KSVD  1129



>gb|ACU21557.1| phytochrome B [Medicago sativa]
Length=1141

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             +D   + L+ +EF++ NVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGDQ++ Q V
Sbjct  974   IDDGSLALEKQEFLLENVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGDQLRFQQV  1033

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFL+++VR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  LI+DM  
Sbjct  1034  LADFLMNVVRYAPSPDGWVEIHVFPRIKQISDGLTLLHAEFRMVCPGEGLPPELIQDMFH  1093

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
               ++W TQEG+ L +S+K++++MNG V YVRE ++CYFL+ L+ 
Sbjct  1094  -NSKWVTQEGLGLSMSRKIIKLMNGEVQYVREAERCYFLVVLEL  1136



>gb|ABN07956.1| GAF; Heavy metal sensor kinase [Medicago truncatula]
Length=1152

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = -3

Query  720   VELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFL  541
             +EL+  EF++ NVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGDQ+++Q VL+DFL
Sbjct  984   LELEKREFLLENVINAVVSQVMLLLRERNLQLIRDIPEEIKALAVYGDQLRIQQVLADFL  1043

Query  540   LSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGTRW  361
             +++VR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  LI+DM    ++W
Sbjct  1044  MNVVRYAPSPDGWVEIHVFPRIKQISDGLTLLHAEFRMVCPGEGLPPELIQDMFH-NSKW  1102

Query  360   TTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRES  214
              TQEG+ L +S+K++++MNG V YVRE ++CYFL+ L+     P +R S
Sbjct  1103  VTQEGLGLSMSRKIIKLMNGEVQYVREAERCYFLVVLEL----PVTRRS  1147



>emb|CAA05294.1| phytochrome B1 [Solanum lycopersicum]
Length=462

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = -3

Query  756  NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
            ++D   I DG+ + L+ E+F +G+VIDAVVSQVM+ L+EK +QL+ DIP++IK+L ++GD
Sbjct  283  DVDLENIEDGS-LTLEKEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGD  341

Query  576  QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
            Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +  I DG   +HI+ R+  PG+GLP  
Sbjct  342  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDGATVVHIELRIICPGEGLPPE  401

Query  396  LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLI--DLDFKTQKPRS  223
            L++DM    +RW TQEG+ L + +K++++MNG + Y+RE ++CYF+I  DL    + P+S
Sbjct  402  LVQDMFH-SSRWVTQEGLGLSMCRKMLKLMNGEIQYIRESERCYFMIILDLPMTRKGPKS  460



>ref|XP_003594734.1| Phytochrome b1 [Medicago truncatula]
 gb|AES64985.1| phytochrome protein B [Medicago truncatula]
Length=1198

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = -3

Query  720   VELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFL  541
             +EL+  EF++ NVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGDQ+++Q VL+DFL
Sbjct  984   LELEKREFLLENVINAVVSQVMLLLRERNLQLIRDIPEEIKALAVYGDQLRIQQVLADFL  1043

Query  540   LSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGTRW  361
             +++VR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  LI+DM    ++W
Sbjct  1044  MNVVRYAPSPDGWVEIHVFPRIKQISDGLTLLHAEFRMVCPGEGLPPELIQDMFH-NSKW  1102

Query  360   TTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRES  214
              TQEG+ L +S+K++++MNG V YVRE ++CYFL+ L+     P +R S
Sbjct  1103  VTQEGLGLSMSRKIIKLMNGEVQYVREAERCYFLVVLEL----PVTRRS  1147



>emb|CAA05296.1| phytochrome B1 [Solanum lycopersicum]
Length=493

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = -3

Query  756  NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
            ++D   I DG+ + L+ E+F +G+VIDAVVSQVM+ L+EK +QL+ DIP++IK+L ++GD
Sbjct  314  DVDLENIEDGS-LTLEKEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGD  372

Query  576  QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
            Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +  I DG   +HI+ R+  PG+GLP  
Sbjct  373  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDGATVVHIELRIICPGEGLPPE  432

Query  396  LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLI--DLDFKTQKPRS  223
            L++DM    +RW TQEG+ L + +K++++MNG + Y+RE ++CYF+I  DL    + P+S
Sbjct  433  LVQDMFH-SSRWVTQEGLGLSMCRKMLKLMNGEIQYIRESERCYFMIILDLPMTRKGPKS  491



>ref|XP_006285990.1| hypothetical protein CARUB_v10007527mg [Capsella rubella]
 gb|EOA18888.1| hypothetical protein CARUB_v10007527mg [Capsella rubella]
Length=1116

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +G +++L+TEEF + +++D ++SQVMI L+E+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEG-KLQLETEEFRVESILDTIISQVMIMLRERNSQLRVEVAEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD W+ I VSP  +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADILRNIVNHAPFPDSWIGINVSPVHELARDNAHYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM   G RW T +G+ L LS+KL+  MNG V YVRE+++C+F +DL FKT
Sbjct  1047  EMLSDMFETGDRWVTPDGLGLKLSRKLLEQMNGRVSYVREEERCFFQVDLQFKT  1100



>gb|AAF14344.1|AF069305_1 phytochrome B [Pisum sativum]
Length=1121

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = -3

Query  741   GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
              I DG+ +EL+ +EF++ NVI+AVVSQVM+ L+++ LQL+ DIP++IK+L +YGDQ+++Q
Sbjct  947   SIEDGS-LELEKQEFLLENVINAVVSQVMLLLRDRKLQLIRDIPEEIKALAVYGDQLRIQ  1005

Query  561   LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
              VL+DFL+++VR+APSPDGWVEI V P +K I +G   +H +FRM  PG+GLP  LI+DM
Sbjct  1006  QVLADFLMNVVRYAPSPDGWVEIHVFPRIKQISEGLTLLHAEFRMVCPGEGLPPELIQDM  1065

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRESS  211
                 +RW TQEG+ L +S+K++++MNG V YVRE ++CYFL+ L+     P +R SS
Sbjct  1066  FH-NSRWVTQEGLGLSMSRKIIKLMNGEVQYVREAERCYFLVLLEL----PVTRRSS  1117



>ref|XP_004486544.1| PREDICTED: phytochrome B-like [Cicer arietinum]
Length=1138

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 136/182 (75%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++ NVI+AVVSQVM+ L+E+ LQL+ DIP++IK+L +Y D
Sbjct  959   DIDLESIEDGS-LELEKREFLLENVINAVVSQVMLLLRERKLQLIRDIPEEIKTLAVYAD  1017

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFL+++VR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  
Sbjct  1018  QLRIQQVLADFLMNMVRYAPSPDGWVEIHVCPRIKQISDGLTLLHAEFRMVCPGEGLPPE  1077

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    +RW T EG+ L +S+K++++MNG V YVRE ++CYFL+ L+     P +R 
Sbjct  1078  LIQDMFH-NSRWVTHEGLGLSMSRKIIKLMNGEVQYVREAERCYFLVLLEL----PVTRR  1132

Query  216   SS  211
             SS
Sbjct  1133  SS  1134



>dbj|BAH47475.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF + +++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEDILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>dbj|BAH47478.1| phytochrome E [Cardamine nipponica]
 dbj|BAH47479.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF + +++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEDILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>ref|XP_002519230.1| phytochrome B, putative [Ricinus communis]
 gb|EEF43094.1| phytochrome B, putative [Ricinus communis]
Length=1141

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 136/184 (74%), Gaps = 4/184 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++G+VI+AVVSQVM+ L+E+NLQL+ DIPD+IK+L +YGD
Sbjct  962   DVDLESIEDGS-LELEKGEFLLGSVINAVVSQVMLLLRERNLQLIRDIPDEIKTLAVYGD  1020

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR APS DGWVEI V P LK I +G   +H +FRM  PG+GLP  
Sbjct  1021  QVRIQQVLADFLLNMVRCAPSSDGWVEIHVHPTLKQITEGLTVMHTEFRMVCPGEGLPPE  1080

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             L++DM    +RWT+QEG+ L + +K++++M G V Y+RE ++CYFL+ LD     PR   
Sbjct  1081  LVQDMFH-SSRWTSQEGLGLSMCRKILKLMQGEVQYIRESERCYFLVVLDLPI--PRRGS  1137

Query  216   SSMD  205
              S D
Sbjct  1138  KSAD  1141



>dbj|BAH47481.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF + +++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEDILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>dbj|BAH47480.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF + +++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEDILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>dbj|BAH47476.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF + +++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEDILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>gb|ACC60966.1| phytochrome B [Vitis vinifera]
Length=1129

 Score =   196 bits (498),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 136/171 (80%), Gaps = 2/171 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++G+VI+AVVSQVMI L+E++LQL+ DIP+++K+L +YGD
Sbjct  950   DVDLDSIEDGS-LELERAEFLLGSVINAVVSQVMILLRERDLQLIRDIPEEVKTLAVYGD  1008

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGW+EI+V P LK I +  + +HI+FRM  PG+GLP  
Sbjct  1009  QVRIQQVLADFLLNMVRYAPSPDGWIEIQVCPRLKQISEEVKLMHIEFRMVCPGEGLPPN  1068

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             LI+DM    +RW TQEG+ L + +K+++++NG V Y+RE ++CYFLI ++ 
Sbjct  1069  LIQDMFH-SSRWMTQEGLGLSMCRKILKLINGEVQYIRESERCYFLISIEL  1118



>gb|ACU21558.1| phytochrome B [Medicago sativa]
Length=1061

 Score =   196 bits (497),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             +D   + L+ +EF++ NVI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGDQ++ Q  
Sbjct  894   IDDGSLALEKQEFLLENVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGDQLRFQQA  953

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFL+++VR+APSPDGWVEI V P +K I DG   +H +FRM  PG+GLP  LI+DM  
Sbjct  954   LADFLMNVVRYAPSPDGWVEIHVFPRIKQISDGLTLLHAEFRMVCPGEGLPPELIQDMFH  1013

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
               ++W TQEG+ L +S+K++++MNG V YVRE ++CYFL+ L+    +
Sbjct  1014  -NSKWVTQEGLGLSMSRKIIKLMNGEVQYVREAERCYFLVVLELPVTR  1060



>gb|AAA34093.1| phytochrome B, partial [Nicotiana tabacum]
Length=677

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 138/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756  NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
            ++D   I DG+ + L+ EEF +G+VIDAVVSQVM+ L+E+++QL+ DIP++IK+L ++GD
Sbjct  498  DVDLENIEDGS-LTLEKEEFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGD  556

Query  576  QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
            Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +K I D    +HI+FR+  PG+GLP  
Sbjct  557  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPE  616

Query  396  LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
            L++DM    +RW T+EG+ L + +K++++MNG + Y+RE ++CYFLI LD     P +R 
Sbjct  617  LVQDMFH-SSRWVTKEGLGLSMCRKILKLMNGDIQYIRESERCYFLIILDL----PMTRR  671

Query  216  SS  211
             S
Sbjct  672  GS  673



>dbj|BAH47477.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   196 bits (497),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF + +++D+++SQVMI LKE+N QL  ++ ++IK+LP YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEDILDSIISQVMIMLKERNSQLRVEVTEEIKTLPFYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>ref|XP_004134246.1| PREDICTED: phytochrome B-like [Cucumis sativus]
Length=1132

 Score =   195 bits (496),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   I DG  +EL+  EF++ +VI+AVVSQVMI L+E++LQL+ DIP+++K++ +YG
Sbjct  952   EDMDLECIDDGT-MELEKGEFLLRSVINAVVSQVMILLRERSLQLIRDIPEEVKTMAVYG  1010

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+APSP+GWVEIRV P LK   DG    H +FR+  PG+GLP 
Sbjct  1011  DQVRIQQVLADFLLNMVRYAPSPEGWVEIRVCPLLKQNSDGITLAHTEFRIVCPGEGLPP  1070

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM   G RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+ 
Sbjct  1071  ELVQDMFHSG-RWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLITLEL  1121



>ref|XP_007035807.1| Phytochrome B isoform 1 [Theobroma cacao]
 gb|EOY06733.1| Phytochrome B isoform 1 [Theobroma cacao]
Length=1138

 Score =   195 bits (496),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 135/184 (73%), Gaps = 4/184 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  +F +G+VI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  959   DVDVESIEDGS-MELERADFYLGSVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  1017

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q ++Q VL+DFLL++VRHAPS +GWVEI V P LK I DG   +  +FRM  PG+GLP  
Sbjct  1018  QARIQQVLADFLLNMVRHAPSAEGWVEIHVRPNLKRISDGLTIVRTEFRMVCPGEGLPPE  1077

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             L++DM    +RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+     PR   
Sbjct  1078  LVQDMFH-SSRWMTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLIILELPV--PRRGS  1134

Query  216   SSMD  205
              S+D
Sbjct  1135  KSVD  1138



>gb|AHZ63957.1| phytochrome [Podocarpus rubens]
Length=1132

 Score =   195 bits (496),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+MD   I DG  VEL T EF++G VIDAVVSQ MI L+EK LQL+ +IP ++K++  YG
Sbjct  951   EDMDLDSIEDGF-VELDTSEFILGAVIDAVVSQAMITLREKGLQLIREIPSEVKTMCFYG  1009

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ++LQ +L+DFLL+ VR  PSP+GWV I+V P LK + +G   +H++FR+THPG GLPS
Sbjct  1010  DQVRLQQILADFLLNAVRFTPSPEGWVAIKVLPTLKQLGNGIHVVHLKFRITHPGPGLPS  1069

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM     RW+ QEGV L + +KL+++MNG V Y+RE   CYFL++L+ 
Sbjct  1070  ELVQDMF-DRKRWSMQEGVGLSMCRKLLKLMNGDVQYIRESGTCYFLVNLEL  1120



>dbj|BAH47474.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF +  ++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEYILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTRDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>dbj|BAH47471.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF +  ++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGADLKSIEEGN-LKLETEEFRLEYILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTRDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>dbj|BAH47472.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF +  ++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEYILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTRDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>ref|XP_008368328.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368329.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368330.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368331.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368332.1| PREDICTED: phytochrome B [Malus domestica]
Length=1120

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             +D   +EL+   F++G+VI+AVVSQVM+ L+E++LQL+ DIP++IK+L +YGDQ+++Q V
Sbjct  947   IDDGSLELEKTGFLLGSVINAVVSQVMLLLRERDLQLIRDIPEEIKTLAVYGDQVRIQQV  1006

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APSP+GWVEI V P LK + DG   +H +FR+  PG+GLP  L++DM  
Sbjct  1007  LADFLLNMVRYAPSPEGWVEIHVLPSLKKVPDGITLVHTEFRLACPGEGLPPQLVQDMFH  1066

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRESSMD  205
               ++W TQEG+ L +  K++++MNG V YVRE ++CYFLI L+     PR   +S+D
Sbjct  1067  -SSQWMTQEGLGLSMCTKILKLMNGEVQYVRESERCYFLITLELPM--PRRPTNSID  1120



>dbj|BAH47473.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +GN ++L+TEEF +  ++D+++SQVMI LKE+N QL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEGN-LKLETEEFRLEYILDSIISQVMIMLKERNSQLRVEVTEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I +SPG +L +D   +IH+QFRMTHPG+GLPS
Sbjct  987   DRVKLQLILADLLCNIVNHAPFPDSWVGINISPGHELARDNGRYIHLQFRMTHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+FL+DL  KT 
Sbjct  1047  EMVSDMFDTRDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFLVDLQVKTS  1101



>ref|XP_008223364.1| PREDICTED: phytochrome B [Prunus mume]
Length=1119

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +EL+  EF +G+VI+AVVSQVM+ L+E++LQL+ DIP++IK+L + G
Sbjct  940   KDVDLDSIEDGS-LELEKSEFFLGSVINAVVSQVMLLLRERDLQLIRDIPEEIKTLAVCG  998

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+APSP+GWVEI V P LK + DG   +H +FR+  PG GLP 
Sbjct  999   DQVRIQQVLADFLLNMVRYAPSPEGWVEIHVLPSLKKVPDGVTLLHTEFRLVCPGDGLPP  1058

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              L++DM    ++W TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+F    PRS 
Sbjct  1059  QLVQDMFH-SSQWMTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLIILEFPM--PRST  1115

Query  219   ES  214
             +S
Sbjct  1116  KS  1117



>ref|XP_011071377.1| PREDICTED: phytochrome B [Sesamum indicum]
Length=1146

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 134/175 (77%), Gaps = 2/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +EL+  EFV+G+VIDAVVSQVM+ L+E+ LQL+ DIP+++K+L +YG
Sbjct  966   KDVDLESIEDGS-LELEMVEFVLGSVIDAVVSQVMLLLRERGLQLIRDIPEEVKTLAVYG  1024

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLLS+VR AP P+GWVEI++ P LK + +G   +HI+FR+  PG+GLP 
Sbjct  1025  DQVRIQQVLADFLLSMVRCAPPPEGWVEIQLRPSLKEVSEGVTIVHIEFRIVCPGEGLPP  1084

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              L++DM    +RW TQEG+ L + ++++++M G V Y+RE ++CYFLI LD   Q
Sbjct  1085  ELVQDMFH-SSRWATQEGLGLSMCRRILKLMKGEVQYIRESERCYFLIVLDLPVQ  1138



>gb|KJB72840.1| hypothetical protein B456_011G200200 [Gossypium raimondii]
 gb|KJB72841.1| hypothetical protein B456_011G200200 [Gossypium raimondii]
Length=1144

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF +G+VI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  965   DVDLESIEDGS-MELEKAEFFLGSVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  1023

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q ++Q VL+DFLL++VR+AP+ +GWVEI V P LK I +G   +H +FRM  PG+GLP  
Sbjct  1024  QARIQQVLADFLLNMVRYAPTGEGWVEIHVRPSLKQISEGVTIVHTEFRMVCPGEGLPPE  1083

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L++DM    +RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+    +  S+
Sbjct  1084  LVQDMFH-SSRWMTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLITLELPVPQSGSK  1141



>gb|KJB72839.1| hypothetical protein B456_011G200200 [Gossypium raimondii]
Length=1196

 Score =   193 bits (491),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF +G+VI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YGD
Sbjct  1017  DVDLESIEDGS-MELEKAEFFLGSVINAVVSQVMLLLRERNLQLIRDIPEEIKTLAVYGD  1075

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q ++Q VL+DFLL++VR+AP+ +GWVEI V P LK I +G   +H +FRM  PG+GLP  
Sbjct  1076  QARIQQVLADFLLNMVRYAPTGEGWVEIHVRPSLKQISEGVTIVHTEFRMVCPGEGLPPE  1135

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L++DM    +RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+    +  S+
Sbjct  1136  LVQDMFH-SSRWMTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLITLELPVPQSGSK  1193



>sp|P29130.2|PHYB_TOBAC RecName: Full=Phytochrome B [Nicotiana tabacum]
 gb|AAA34092.1| type II phytochrome [Nicotiana tabacum]
Length=1132

 Score =   192 bits (489),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 138/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L+ EEF +G+VIDAVVSQVM+ L+E+++QL+ DIP++IK+L ++GD
Sbjct  953   DVDLENIEDGS-LTLEKEEFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGD  1011

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +K I D    +HI+FR+  PG+GLP  
Sbjct  1012  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPE  1071

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             L++DM    +RW T+EG+ L + +K++++MNG + Y+RE ++CYFLI LD     P +R 
Sbjct  1072  LVQDMFH-SSRWVTKEGLGLSMCRKILKLMNGDIQYIRESERCYFLIILDL----PMTRR  1126

Query  216   SS  211
              S
Sbjct  1127  GS  1128



>ref|XP_009606016.1| PREDICTED: phytochrome B [Nicotiana tomentosiformis]
 ref|XP_009606018.1| PREDICTED: phytochrome B [Nicotiana tomentosiformis]
Length=1131

 Score =   192 bits (489),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L+ EEF +G+VIDAVVSQVM+ L+E+++QL+ DIP++IK+L ++GD
Sbjct  952   DVDLENIEDGS-LTLEKEEFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGD  1010

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +K I D    +HI+FR+  PG+GLP  
Sbjct  1011  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPE  1070

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L++DM    +RW T+EG+ L + +K++++MNG + Y+RE ++CYFLI LD    +  S+
Sbjct  1071  LVQDMFH-SSRWVTKEGLGLSMCRKILKLMNGDIQYIRESERCYFLIILDLPMHRRGSK  1128



>ref|XP_009789287.1| PREDICTED: phytochrome B [Nicotiana sylvestris]
 ref|XP_009789288.1| PREDICTED: phytochrome B [Nicotiana sylvestris]
Length=1133

 Score =   192 bits (488),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L+ EEF +G+VIDAVVSQVM+ L+E+++QL+ DIP++IK+L ++GD
Sbjct  954   DVDLENIEDGS-LTLEKEEFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGD  1012

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +K I D    +HI+FR+  PG+GLP  
Sbjct  1013  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPE  1072

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             L++DM    +RW T+EG+ L + +K++++MNG + Y+RE ++CYFLI LD 
Sbjct  1073  LVQDMFH-SSRWVTKEGLGLSMCRKILKLMNGEIQYIRESERCYFLIILDL  1122



>gb|AHZ89696.1| phytochrome B [Dimocarpus longan]
Length=1155

 Score =   192 bits (487),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +EL+  EF +G+VI+AVVSQVM+ L+E+NLQL+ DIP++IKSL ++G
Sbjct  974   KDVDLESIEDGS-LELEKAEFFLGSVINAVVSQVMMLLRERNLQLIRDIPEEIKSLAVFG  1032

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ ++Q VL+DFLL++VR+AP+ +GWVEI V P +K I DG   +H +FRM  PG+GLP 
Sbjct  1033  DQARIQQVLADFLLNMVRYAPTTEGWVEIHVRPTVKQISDGLTVVHTEFRMVCPGEGLPP  1092

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM   G+RW TQEG+ L + + ++++MNG V Y+RE ++CYFLI L+ 
Sbjct  1093  ELVQDMFH-GSRWVTQEGLGLSMCRMILKLMNGEVQYIRESERCYFLIILEL  1143



>ref|XP_011019938.1| PREDICTED: phytochrome B isoform X2 [Populus euphratica]
Length=1140

 Score =   192 bits (487),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  962   IENGLLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLVVYGDQARIQQV  1021

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H++F++  PG+GLP  L++DM  
Sbjct  1022  LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHMEFKIVCPGEGLPPELVQDMFH  1081

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+  T
Sbjct  1082  -SSRWVTQEGLGLSICRKILKLMNGEVQYIRESERCYFLVILEVPT  1126



>ref|XP_011019931.1| PREDICTED: phytochrome B isoform X1 [Populus euphratica]
Length=1142

 Score =   192 bits (487),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  964   IENGLLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLVVYGDQARIQQV  1023

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H++F++  PG+GLP  L++DM  
Sbjct  1024  LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHMEFKIVCPGEGLPPELVQDMFH  1083

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+  T
Sbjct  1084  -SSRWVTQEGLGLSICRKILKLMNGEVQYIRESERCYFLVILEVPT  1128



>gb|AEK06067.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06068.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06069.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06071.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06072.1| phytochrome B2, partial [Populus balsamifera]
Length=1103

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  929   IENGSLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLAVYGDQARIQQV  988

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H +F++  PG+GLP  L++DM  
Sbjct  989   LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHTEFKIVCPGEGLPPELVQDMFH  1048

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1049  -SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVVLE  1090



>gb|AEK06070.1| phytochrome B2, partial [Populus balsamifera]
Length=1103

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  929   IENGSLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLAVYGDQARIQQV  988

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H +F++  PG+GLP  L++DM  
Sbjct  989   LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHTEFKIVCPGEGLPPELVQDMFH  1048

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1049  -SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVVLE  1090



>gb|AEK06073.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06074.1| phytochrome B2, partial [Populus balsamifera]
Length=1103

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  929   IENGSLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLAVYGDQARIQQV  988

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H +F++  PG+GLP  L++DM  
Sbjct  989   LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHTEFKIVCPGEGLPPELVQDMFH  1048

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1049  -SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVVLE  1090



>gb|AEK06060.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06061.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06062.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06063.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06064.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06065.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06066.1| phytochrome B2, partial [Populus balsamifera]
Length=1103

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  929   IENGSLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLAVYGDQARIQQV  988

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H +F++  PG+GLP  L++DM  
Sbjct  989   LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHTEFKIVCPGEGLPPELVQDMFH  1048

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1049  -SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVVLE  1090



>gb|AEK06057.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06058.1| phytochrome B2, partial [Populus balsamifera]
 gb|AEK06059.1| phytochrome B2, partial [Populus balsamifera]
Length=1103

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  929   IENGSLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLAVYGDQARIQQV  988

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H +F++  PG+GLP  L++DM  
Sbjct  989   LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHTEFKIVCPGEGLPPELVQDMFH  1048

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1049  -SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVVLE  1090



>ref|XP_002314949.2| hypothetical protein POPTR_0010s15600g [Populus trichocarpa]
 gb|EEF01120.2| hypothetical protein POPTR_0010s15600g [Populus trichocarpa]
Length=1134

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  960   IENGSLELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLAVYGDQARIQQV  1019

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H +F++  PG+GLP  L++DM  
Sbjct  1020  LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHTEFKIVCPGEGLPPELVQDMFH  1079

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1080  -SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVVLE  1121



>ref|XP_007227356.1| hypothetical protein PRUPE_ppa000510mg [Prunus persica]
 gb|EMJ28555.1| hypothetical protein PRUPE_ppa000510mg [Prunus persica]
Length=1119

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +EL+  EF +G+VI+AVVSQVM+ L+E++LQL+ DIP++IK+L + G
Sbjct  940   KDVDLDSIEDGS-LELEKSEFFLGSVINAVVSQVMLLLRERDLQLIRDIPEEIKTLAVCG  998

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+APSP+GWVEI V P LK + DG   +  +FR+  PG GLP 
Sbjct  999   DQVRIQQVLADFLLNMVRYAPSPEGWVEIHVLPSLKKVPDGVTLVRTEFRLVCPGDGLPP  1058

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              L++DM    ++W TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+F    PRS 
Sbjct  1059  QLVQDMFH-SSQWMTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLIILEFPM--PRST  1115

Query  219   ES  214
             +S
Sbjct  1116  KS  1117



>sp|P34094.2|PHYB_SOLTU RecName: Full=Phytochrome B [Solanum tuberosum]
 emb|CAA74908.1| phytochrome B [Solanum tuberosum]
Length=1130

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L+ E+F +G+VIDAVVSQVM+ L+EK +QL+ DIP++IK+L ++GD
Sbjct  951   DIDLENIEDGS-LTLEKEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGD  1009

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +  I DG   +HI+ R+  PG+GLP  
Sbjct  1010  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDGVTVVHIELRIICPGEGLPPE  1069

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLI--DLDFKTQKPRS  223
             L++DM    +RW TQEG+ L + +K++++MNG + Y+RE ++CYFLI  DL    + P+S
Sbjct  1070  LVQDMFH-SSRWVTQEGLGLSMCRKMLKLMNGEIQYIRESERCYFLIILDLPMTRKGPKS  1128



>emb|CAA74992.1| phytochrome B [Nicotiana plumbaginifolia]
Length=1135

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L  EEF +G+VIDAVVSQVM+ L+E+++QL+ DIP++IK+L ++GD
Sbjct  956   DVDLENIEDGS-LTLDKEEFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGD  1014

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +K I D    +HI+FR+  PG+GLP  
Sbjct  1015  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPE  1074

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             L++DM     RW T+EG+ L + +K++++MNG + Y+RE ++CYFLI LD 
Sbjct  1075  LVQDMFH-SNRWVTKEGLGLSMCRKILKLMNGEIQYIRESERCYFLIILDL  1124



>ref|XP_011010461.1| PREDICTED: phytochrome B isoform X1 [Populus euphratica]
Length=1134

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF++G+VI+AVVSQ M  L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  960   IENGSLELEKAEFLLGSVINAVVSQAMPLLRERNLQLLRDIPEEIKTLAVYGDQARIQQV  1019

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APS  GWVEI V P LK I DG   +H +F++  PG+GLP  L++DM  
Sbjct  1020  LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGQTLVHTEFKIVCPGEGLPPELVQDMFH  1079

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
               +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+  T  PR
Sbjct  1080  -SSRWVTQEGLGLSICRKILKLMNGEVQYIRESERCYFLVVLEVPT--PR  1126



>ref|XP_010318997.1| PREDICTED: phytochrome B1 [Solanum lycopersicum]
 sp|Q9ZS62.1|PHYB1_SOLLC RecName: Full=Phytochrome B1 [Solanum lycopersicum]
 emb|CAA05293.1| phytochrome B1 [Solanum lycopersicum]
Length=1131

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L+ E+F +G+VIDAVVSQVM+ L+EK +QL+ DIP++IK+L ++GD
Sbjct  952   DVDLENIEDGS-LTLEKEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGD  1010

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +  I DG   +HI+ R+  PG+GLP  
Sbjct  1011  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDGATVVHIELRIICPGEGLPPE  1070

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLI--DLDFKTQKPRS  223
             L++DM    +RW TQEG+ L + +K++++MNG + Y+RE ++CYF+I  DL    + P+S
Sbjct  1071  LVQDMFH-SSRWVTQEGLGLSMCRKMLKLMNGEIQYIRESERCYFMIILDLPMTRKGPKS  1129



>ref|XP_009372122.1| PREDICTED: phytochrome B-like [Pyrus x bretschneideri]
Length=1120

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             +D   +EL+  EF++G VI+AVVSQVM+ ++E++LQL+ DIP++IK+L +YGDQ+++Q +
Sbjct  947   IDNGSLELEKAEFLLGGVINAVVSQVMLLMRERDLQLIRDIPEEIKTLAVYGDQVRIQQI  1006

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APSP+GWVEI V P LK + DG   +  +FR+  PG+GLP  L++DM  
Sbjct  1007  LADFLLNMVRYAPSPEGWVEIHVLPILKKVPDGITLVRTEFRLVCPGEGLPPQLVQDMFH  1066

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRESSMD  205
               ++W TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+     PR   +S+D
Sbjct  1067  -SSQWMTQEGLGLSMCRKILKLMNGDVQYIRESERCYFLITLELPM--PRRPTNSID  1120



>ref|XP_009336299.1| PREDICTED: phytochrome B-like [Pyrus x bretschneideri]
Length=1120

 Score =   190 bits (483),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             +D   +EL+  EF++G VI+AVVSQVM+ ++E++LQL+ DIP++IK+L +YGDQ+++Q +
Sbjct  947   IDNGSLELEKAEFLLGGVINAVVSQVMLLMRERDLQLIRDIPEEIKTLAVYGDQVRIQQI  1006

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APSP+GWVEI V P LK + DG   +  +FR+  PG+GLP  L++DM  
Sbjct  1007  LADFLLNMVRYAPSPEGWVEIHVLPILKKVPDGITLVRTEFRLVCPGEGLPPQLVQDMFH  1066

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRESSMD  205
               ++W TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+     PR   +S+D
Sbjct  1067  -SSQWMTQEGLGLSMCRKILKLMNGDVQYIRESERCYFLITLELPM--PRRPTNSID  1120



>gb|ACV87354.1| phytochrome B [Aquilegia formosa]
Length=1132

 Score =   190 bits (483),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 134/174 (77%), Gaps = 2/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +EL+  +F++G+VI+AVVSQVMI L+E+ LQL+ DIP++IK+L +  
Sbjct  952   KDVDLQNIEDGS-LELERCDFLLGSVINAVVSQVMILLRERGLQLIRDIPEEIKTLAVSS  1010

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+AP PDGWVEI+V P LK   DG E +H++FRM  PG+GLP 
Sbjct  1011  DQVRIQQVLADFLLNMVRYAPMPDGWVEIQVRPNLKQSSDGIELVHLEFRMVCPGEGLPP  1070

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              L++DM    +RW TQEG+ L + +K++++MNG V Y+RE ++C+F+I L+  T
Sbjct  1071  ELVQDMFH-SSRWATQEGLGLSMCRKILKLMNGEVQYIRESERCFFIIILELPT  1123



>emb|CDX78827.1| BnaA01g08940D [Brassica napus]
Length=1080

 Score =   189 bits (481),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++++TEEF + +V+D ++SQVMI L+E+  QL  ++  +IK+LP+YG
Sbjct  898   EDTDLKSIEEG-KLQMETEEFRLESVLDTIISQVMIMLRERKSQLRVEVSQEIKTLPLYG  956

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I++SPG KL  D N +IH+QFRM HPG+GLPS
Sbjct  957   DRVKLQLILADLLRNIVNHAPFPDSWVGIKISPGHKLAHDNNPYIHLQFRMIHPGKGLPS  1016

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+F +DL  KT+
Sbjct  1017  EMLSDMFETREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFQVDLQVKTR  1071



>ref|XP_004295077.1| PREDICTED: phytochrome B-like [Fragaria vesca subsp. vesca]
Length=1136

 Score =   189 bits (481),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +EL+ E+F++G+VI+AVVSQVM+ L+E+NLQL+ DIP+++K+L +YG
Sbjct  955   KDVDLASIEDGS-LELEKEDFLLGSVINAVVSQVMLLLRERNLQLIRDIPEEVKTLAVYG  1013

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+APS +GWVEI V P L  I DG+  +H +FR+  PG+GLP 
Sbjct  1014  DQVRIQQVLADFLLNMVRYAPSDEGWVEIHVRPILTTISDGHSMVHTEFRLVCPGEGLPP  1073

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM    ++W TQEG+ L + +K++++M G V Y+RE ++CYFL+ L+ 
Sbjct  1074  QLVQDMFH-SSQWLTQEGLGLSMCRKILKLMGGDVQYIRESERCYFLVILEL  1124



>gb|AAQ11872.1| phytochrome B [Stellaria longipes]
Length=1128

 Score =   189 bits (481),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             VD +  EL   EF++GN+I+AVVSQVMIPL+E+ LQL+ DIP++IK+L + GDQI++Q +
Sbjct  955   VDESPFELVKTEFMLGNIINAVVSQVMIPLRERELQLIRDIPEEIKTLAVCGDQIRIQQI  1014

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L++FL+++VR+APSPDGWVEI V P LK + DG    +I++R+  PG+GLP  L++DM  
Sbjct  1015  LAEFLVNMVRYAPSPDGWVEIHVLPRLKQVADGATVAYIEYRLVSPGEGLPPDLVQDMFH  1074

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFK  241
               +RWTTQEG+ L + +K++++MNG V Y+RE ++ YF + L+ +
Sbjct  1075  -NSRWTTQEGLGLSMCRKILKLMNGEVQYIRESERSYFFVILELR  1118



>ref|XP_006358209.1| PREDICTED: phytochrome B [Solanum tuberosum]
Length=1130

 Score =   189 bits (481),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L+ E+F +G+VIDAVVSQVM+ L+EK +QL+ DIP++IK+L ++GD
Sbjct  951   DVDLENIEDGS-LTLEKEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGD  1009

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +  I DG   +HI  R+  PG+GLP  
Sbjct  1010  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDGVTVVHIDLRIICPGEGLPPE  1069

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             L++DM    +RW TQEG+ L + +K++++MNG + Y+RE ++CYFLI LD 
Sbjct  1070  LVQDMFH-SSRWVTQEGLGLSMCRKMLKLMNGEIQYIRESERCYFLIILDL  1119



>ref|XP_009131404.1| PREDICTED: phytochrome E [Brassica rapa]
Length=1114

 Score =   189 bits (480),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++++TEEF + +V+D ++SQVMI L+E+  QL  ++  +IK+LP+YG
Sbjct  932   EDTDLKSIEEG-KLQMETEEFRLESVLDTIISQVMIMLRERKSQLRVEVSQEIKTLPLYG  990

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I++SPG KL  D N +IH+QFRM HPG+GLPS
Sbjct  991   DRVKLQLILADLLRNIVNHAPFPDSWVGIKISPGHKLAHDNNPYIHLQFRMIHPGKGLPS  1050

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+F +DL  KT+
Sbjct  1051  EMLSDMFETREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFQVDLQVKTR  1105



>emb|CDO98760.1| unnamed protein product [Coffea canephora]
Length=881

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 136/179 (76%), Gaps = 4/179 (2%)
 Frame = -3

Query  756  NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
            N+D+  + DG+ +EL+  EF++G+VIDAVVSQVM+ L+E+ LQL+ DIP++IK+L +YGD
Sbjct  704  NLDN--LEDGS-LELEKSEFLLGSVIDAVVSQVMLLLRERGLQLIRDIPEEIKTLAVYGD  760

Query  576  QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
            Q+++Q VL+DFLL++VR+APS  GWVEI++ P LK I  G   +HI+FR+  PG+GLP  
Sbjct  761  QVRVQQVLADFLLNMVRYAPSSGGWVEIQLKPSLKQISIGINILHIEFRIVCPGEGLPPE  820

Query  396  LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
            L++DM    +RW TQEG+ L + +K++++M+G V Y+RE ++ YFLI L+   Q+  S+
Sbjct  821  LVQDMFH-SSRWVTQEGLGLSMCRKILKLMDGEVQYIRESERSYFLITLELPMQRRGSK  878



>dbj|BAM36555.1| phytochrome B [Fragaria x ananassa]
Length=1136

 Score =   189 bits (480),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +EL+ E+F++G+VI+AVVSQVM+ L+E+NLQL+ DIP+++K+L +YG
Sbjct  955   KDVDLASIEDGS-LELEKEDFLLGSVINAVVSQVMLLLRERNLQLIRDIPEEVKTLAVYG  1013

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VR+APS +GWVEI V P L  I DG+  +H +FR+  PG+GLP 
Sbjct  1014  DQVRIQQVLADFLLNMVRYAPSDEGWVEIHVRPILTTISDGHSMVHTEFRLVCPGEGLPP  1073

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM    ++W TQEG+ L + +K++++M G V Y+RE ++CYFL+ L+ 
Sbjct  1074  QLVQDMFH-SSQWLTQEGLGLSMCRKILKLMGGDVQYIRESERCYFLVILEL  1124



>gb|KDO71942.1| hypothetical protein CISIN_1g037299mg [Citrus sinensis]
Length=1111

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 135/184 (73%), Gaps = 4/184 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +E +  EF++G+VI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YG
Sbjct  930   KDVDLESIEDGS-LEFEKAEFLLGSVINAVVSQVMMLLRERNLQLIRDIPEEIKTLAVYG  988

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ ++Q VL+DFLL++VR++PS +GWVEI V P LK   +G   +H +FRM  PG+GLP 
Sbjct  989   DQARIQQVLADFLLNMVRYSPSAEGWVEIHVRPTLKQSSEGQTIVHNEFRMVCPGEGLPP  1048

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              L++DM    +RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI   F+   PR  
Sbjct  1049  ELVQDMFH-SSRWMTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLI--IFELPMPRRG  1105

Query  219   ESSM  208
               S+
Sbjct  1106  SKSI  1109



>emb|CDY61670.1| BnaC01g40810D [Brassica napus]
Length=1116

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++++TEEF + +V+D ++SQVMI L+E+  QL  ++  +IK+LP+YG
Sbjct  929   EDTDLKSIEEG-KLQMETEEFRLESVLDTIISQVMIMLRERKSQLRVEVSQEIKTLPLYG  987

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP PD WV I++SPG KL +D + +IH+QFRM HPG+GLPS
Sbjct  988   DRVKLQLILADLLRNIVNHAPFPDSWVGIKISPGHKLARDNDRYIHLQFRMIHPGKGLPS  1047

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ  235
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+F +DL  KT+
Sbjct  1048  EMLSDMFETREGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFQVDLQVKTR  1102



>ref|XP_006488839.1| PREDICTED: phytochrome B-like isoform X1 [Citrus sinensis]
Length=1137

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 135/184 (73%), Gaps = 4/184 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I DG+ +E +  EF++G+VI+AVVSQVM+ L+E+NLQL+ DIP++IK+L +YG
Sbjct  956   KDVDLESIEDGS-LEFEKAEFLLGSVINAVVSQVMMLLRERNLQLIRDIPEEIKTLAVYG  1014

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ ++Q VL+DFLL++VR++PS +GWVEI V P LK   +G   +H +FRM  PG+GLP 
Sbjct  1015  DQARIQQVLADFLLNMVRYSPSAEGWVEIHVRPTLKQSSEGQTIVHNEFRMVCPGEGLPP  1074

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              L++DM    +RW TQEG+ L + +K++++MNG V Y+RE ++CYFLI   F+   PR  
Sbjct  1075  ELVQDMFH-SSRWMTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLI--IFELPMPRRG  1131

Query  219   ESSM  208
               S+
Sbjct  1132  SKSI  1135



>ref|NP_001274786.1| phytochrome B [Solanum tuberosum]
 gb|ABC72086.1| phytochrome B [Solanum tuberosum]
Length=1130

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ + L+ E+F +G+VIDAVVSQVM+ L+EK +QL+ DIP++IK+L ++GD
Sbjct  951   DVDLENIEDGS-LTLEKEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGD  1009

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VR+APSPDGWVEI++ P +  I DG   +HI+ R+  PG+GLP  
Sbjct  1010  QVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDGVTGVHIELRIICPGEGLPPE  1069

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLI--DLDFKTQKPRS  223
             L++DM    +RW TQEG+ L   +K++++MNG + Y+RE ++CYFLI  DL    + P+S
Sbjct  1070  LVQDMFH-SSRWVTQEGLGLSTCRKMLKLMNGEIQYIRESERCYFLIVLDLPMTRKGPKS  1128



>ref|XP_010671734.1| PREDICTED: phytochrome B isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1130

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 130/171 (76%), Gaps = 4/171 (2%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             N+D   I D + + L   EF++G+VI+AVVSQVMI L+E+ LQL+ DIP++IK+L I GD
Sbjct  953   NLD---IFDDSTMMLDKAEFMLGSVINAVVSQVMILLRERGLQLIRDIPEEIKTLAICGD  1009

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q +L++FL+++VR+APSPDGWVEI V P LK I DG   ++I FR+  PG+GLP  
Sbjct  1010  QVRIQQILAEFLVNMVRYAPSPDGWVEIHVQPRLKQISDGQNVVYIDFRLVCPGEGLPPD  1069

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             L++DM R  ++W TQEG+ L + +K++++MNG V Y+RE ++ YFLI L+F
Sbjct  1070  LVQDMFR-NSKWATQEGIGLSMCRKILKLMNGEVQYIRESERSYFLIILEF  1119



>ref|XP_008360243.1| PREDICTED: phytochrome B-like isoform X1 [Malus domestica]
Length=1120

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             +D   ++L+  EF++G VI+AVVSQVM+ ++E++LQL+ DIP++IK+L +YGDQ+++Q V
Sbjct  947   IDNGSLQLEKAEFLLGGVINAVVSQVMLLMRERDLQLIRDIPEEIKTLAVYGDQVRIQQV  1006

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL++VR+APSP+GWVEI V P LK + DG   +  +FR+  PG+GLP  L++DM  
Sbjct  1007  LADFLLNMVRYAPSPEGWVEIHVLPILKKVPDGITLVXTEFRLVCPGEGLPPQLVQDMFH  1066

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRESSMD  205
               ++W TQEG+ L + +K++++MNG V Y+RE ++CYFLI L+     PR   +S D
Sbjct  1067  -SSQWMTQEGLGLSMCRKILKLMNGDVQYIRESERCYFLITLELPM--PRRPTNSSD  1120



>gb|AHZ63956.1| phytochrome [Taiwania cryptomerioides]
Length=1148

 Score =   188 bits (477),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++MD   I +G  +EL T EFV+G V+DAVVSQ MI L+EK LQL+ +IP ++K++  YG
Sbjct  967   DDMDLDSIENGY-LELDTAEFVLGTVMDAVVSQGMIILREKGLQLIREIPSEVKTMCFYG  1025

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ++LQ +L+DFLL+ VR  PSP+GWV I+V P +K +  G   +H++FR+THPG GLP+
Sbjct  1026  DQVRLQQILADFLLNAVRFTPSPEGWVAIKVLPTIKQLGSGIHVVHLEFRITHPGPGLPA  1085

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              LI+DM     RWT QEGV L + +KL+++M+G V Y+RE  KCYFL++L+ 
Sbjct  1086  ELIQDMF-DRKRWTMQEGVGLSMCRKLLKLMDGDVQYMRESAKCYFLVNLEL  1136



>ref|XP_008808701.1| PREDICTED: phytochrome B-like [Phoenix dactylifera]
Length=1112

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 127/174 (73%), Gaps = 2/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ +   I DG+ + L   EF++G+VI+AV+SQVMI L+E+ LQL+ DIP++IK + +YG
Sbjct  938   EDTNLQSIEDGS-LMLDKGEFLLGSVINAVISQVMILLRERGLQLIRDIPEEIKIISVYG  996

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL++VRHAPSPDGWVEI V P LK   DG E +  QFR+  PG GLP 
Sbjct  997   DQVRIQQVLADFLLNMVRHAPSPDGWVEIHVRPSLKQNSDGKEVVFFQFRIVCPGDGLPP  1056

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              L++D+     RW TQEG+ L +S+K++++M G V Y RE ++C+FLI ++  T
Sbjct  1057  ELVQDLFHDA-RWVTQEGIGLSVSRKILKLMKGEVQYTRETERCFFLISMELPT  1109



>ref|XP_010065155.1| PREDICTED: phytochrome B [Eucalyptus grandis]
 gb|KCW87973.1| hypothetical protein EUGRSUZ_A00380 [Eucalyptus grandis]
Length=1125

 Score =   187 bits (474),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 128/171 (75%), Gaps = 2/171 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             + D   I DG+ +EL+  EF +G+V++AVVSQVMI L+E+ LQL+ DIPD+IK+L + GD
Sbjct  947   DADLRSIEDGS-LELEKAEFFLGSVMNAVVSQVMILLRERGLQLIRDIPDEIKTLAVCGD  1005

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q VL+DFLL++VRHAPSP+GWVEI V P LK    G   +H +FR+  PG+GLP  
Sbjct  1006  QLRIQQVLADFLLNMVRHAPSPEGWVEIHVRPSLKQTDGGLTLVHNEFRIVCPGEGLPPE  1065

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             L++DM    +RW T+EG+ L + +K++R+M+G V Y+RE ++CYF+I L+ 
Sbjct  1066  LVQDMFH-SSRWMTEEGLGLSMCRKILRLMSGEVQYIRESERCYFIITLEL  1115



>gb|ACN40636.1| unknown [Picea sitchensis]
Length=1132

 Score =   187 bits (474),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 133/184 (72%), Gaps = 3/184 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++MD   + DG  +EL T EF++G VIDAVVSQ MI L+EK LQL+ +IP ++K++ +YG
Sbjct  951   DDMDLDSLEDG-YMELDTAEFILGTVIDAVVSQGMIILREKGLQLIREIPGEVKTMHLYG  1009

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ++LQ +L+DFLL+ +R  PSP+GWV I+V P LK +      + ++FR+THPG GLP+
Sbjct  1010  DQVRLQQILADFLLNALRFTPSPEGWVAIKVLPTLKQLSGALHVVLLEFRITHPGPGLPA  1069

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              L++D+    +RWTTQEGV L + +KL+++MNG V YVRE  KCYFL++++    + R  
Sbjct  1070  ELVQDLF-DRSRWTTQEGVGLSMCRKLLKLMNGDVQYVRESGKCYFLVNVELPLAQ-RED  1127

Query  219   ESSM  208
              SSM
Sbjct  1128  ASSM  1131



>gb|AHZ63958.1| phytochrome [Pinus parviflora]
Length=1132

 Score =   187 bits (474),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -3

Query  720   VELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFL  541
             +EL T EF++G VIDAVVSQ MI L+E+ LQL+ +IP ++K++ +YGDQ++LQ +L+DFL
Sbjct  963   MELDTAEFILGTVIDAVVSQGMIVLREQGLQLIREIPGEVKTMRLYGDQVRLQQILADFL  1022

Query  540   LSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGTRW  361
             L+ +R  PSP+GWV I+V P LK +  G   +H++FR+THPG GLP+ L++D+    +RW
Sbjct  1023  LNALRFTPSPEGWVAIKVLPTLKQLGGGLHVVHLEFRITHPGPGLPAELVQDLF-DRSRW  1081

Query  360   TTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              TQEGV L + +KL+++MNG V Y+RE  KCYFL++++F
Sbjct  1082  ATQEGVGLSMCRKLLKLMNGDVQYIRESGKCYFLVNVEF  1120



>gb|AJE63445.1| phytochrome P [Picea abies]
Length=1132

 Score =   186 bits (473),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 133/184 (72%), Gaps = 3/184 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++MD   + DG  +EL T EF++G VIDAVVSQ MI L+EK LQL+ +IP ++K++ +YG
Sbjct  951   DDMDLDSLEDG-YMELDTAEFILGTVIDAVVSQGMIVLREKGLQLIREIPGEVKTMHLYG  1009

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ++LQ +L+DFLL+ +R  PSP+GWV I+V P LK +      + ++FR+THPG GLP+
Sbjct  1010  DQVRLQQILADFLLNALRFTPSPEGWVAIKVLPTLKQLSGALHVVLLEFRITHPGPGLPA  1069

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
              L++D+    +RWTTQEGV L + +KL+++MNG V Y+RE  KCYFL++++    + R  
Sbjct  1070  ELVQDLF-DRSRWTTQEGVGLSMCRKLLKLMNGDVQYIRESGKCYFLVNVELPLAQ-RED  1127

Query  219   ESSM  208
              SSM
Sbjct  1128  ASSM  1131



>ref|XP_008781148.1| PREDICTED: phytochrome B [Phoenix dactylifera]
Length=1132

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 126/167 (75%), Gaps = 2/167 (1%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ + L   EF++G+VI+AVVSQVMI L+E+ LQL+ DIP++IK + +YGDQ+++Q 
Sbjct  959   IEDGSLI-LDKGEFLLGSVINAVVSQVMILLRERGLQLIRDIPEEIKIISVYGDQVRIQQ  1017

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL+DFLL++VRHAPSPDGWVEI+V P LK   DG E +  QFR+  PG GLP+ L++DM 
Sbjct  1018  VLADFLLNMVRHAPSPDGWVEIQVRPSLKQNADGTEVVLFQFRIVCPGDGLPAELVQDMF  1077

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
                + W TQEG+ L + +K++++M G V Y+RE ++CYFLI ++  +
Sbjct  1078  HNSS-WVTQEGLGLSICRKILKLMKGEVQYIRESERCYFLIFMELPS  1123



>ref|XP_010938231.1| PREDICTED: LOW QUALITY PROTEIN: phytochrome B-like [Elaeis guineensis]
Length=1121

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 130/181 (72%), Gaps = 3/181 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ +   I DG+ + L   EF++G+VI+AVVSQVMI L+EK LQL+ DIP++IK + +YG
Sbjct  941   EDTNLQSIEDGS-LMLHKGEFLLGSVINAVVSQVMILLREKGLQLIRDIPEEIKMISVYG  999

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL+++RHAPSPDGWVEI V P LK   DG E +  Q R+  PG GL  
Sbjct  1000  DQVRIQQVLADFLLNMMRHAPSPDGWVEIHVRPSLKQNSDGTEVVFFQVRIVCPGDGLSP  1059

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT-QKPRS  223
              L++D+    +RW TQEG+ L +S+K++++M G V Y+RE ++CYFLI ++  T Q   S
Sbjct  1060  ELVQDLFH-NSRWVTQEGICLSISRKILKLMKGVVQYIRESERCYFLISMELPTCQSXES  1118

Query  222   R  220
             R
Sbjct  1119  R  1119



>ref|XP_002868009.1| hypothetical protein ARALYDRAFT_914880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44268.1| hypothetical protein ARALYDRAFT_914880 [Arabidopsis lyrata subsp. 
lyrata]
Length=1116

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +G +++L+TEEF + N++D ++SQVMI L+E NLQL  ++ ++IK+LP+YG
Sbjct  928   EGTDLKSIEEG-KLQLETEEFRLENILDTIISQVMILLREGNLQLRVEVAEEIKTLPLYG  986

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP P+ WV I +S G +L +D + +IH+QFRM HPG+GLPS
Sbjct  987   DRVKLQLILADLLRNIVNHAPFPNSWVAIYISRGQELSRDNSHYIHLQFRMIHPGKGLPS  1046

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+F +DL  KT
Sbjct  1047  EMLSDMFETRDGWDTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFQVDLQVKT  1100



>ref|XP_010109967.1| Phytochrome B [Morus notabilis]
 gb|EXC24963.1| Phytochrome B [Morus notabilis]
Length=1172

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 137/184 (74%), Gaps = 8/184 (4%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF++G+VI+AVVSQV   L+E+NLQL+ DIP++IK+L +YGD
Sbjct  986   DVDLDSIEDGS-LELEKAEFLLGSVINAVVSQVTTLLRERNLQLIRDIPEEIKTLAVYGD  1044

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFR-----MTHPGQ  412
             Q+++Q VL++FLL++VR+APSP+GWVEI V P LK + DG+  +H +FR     M  PG+
Sbjct  1045  QVRIQQVLAEFLLNMVRYAPSPEGWVEILVRPSLK-VHDGHTLLHTEFRQVCGGMVCPGE  1103

Query  411   GLPSALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
             GLP  L++DM    +RW TQEG+ L + +K++++M+G V Y+RE ++CYFLI L+   ++
Sbjct  1104  GLPPELVQDMFH-SSRWMTQEGLGLSMCRKILKLMDGDVQYIRESERCYFLIILELPIRR  1162

Query  231   PRSR  220
               S+
Sbjct  1163  RGSK  1166



>sp|Q41046.1|PHY_PINSY RecName: Full=Phytochrome [Pinus sylvestris]
 emb|CAA65510.1| phytochrome [Pinus sylvestris]
Length=1131

 Score =   185 bits (469),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++MD   + DG  +EL T EF++G VIDAVVSQ MI L+EK LQL+ +IP ++K++ +YG
Sbjct  950   DDMDLESLEDGY-MELDTAEFILGTVIDAVVSQGMIVLREKGLQLIREIPGEVKTMRLYG  1008

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++K+Q +L+DFLL+++R  PSP+GWV I+V P LK +  G   +H++FR+THPG GLP+
Sbjct  1009  DEVKIQQILADFLLNVLRFTPSPEGWVAIKVFPTLKQLGGGLHVVHLEFRITHPGLGLPA  1068

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++D+    ++W TQEGV L + +KL+++MNG V Y+RE   CYFL++++F
Sbjct  1069  ELVQDLF-DRSQWATQEGVGLSMCRKLLKLMNGDVRYIRESGICYFLVNVEF  1119



>emb|CAA54075.1| phytochrome E [Arabidopsis thaliana]
 emb|CAB53654.1| phytochrome E [Arabidopsis thaliana]
 emb|CAB78815.1| phytochrome E [Arabidopsis thaliana]
Length=1112

 Score =   184 bits (468),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++L+TEEF + N++D ++SQVMI L+E+N QL  ++ ++IK+LP+ G
Sbjct  924   ESTDLKSIEEG-KLQLETEEFRLENILDTIISQVMIILRERNSQLRVEVAEEIKTLPLNG  982

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP P+ WV I +SPG +L +D   +IH+QFRM HPG+GLPS
Sbjct  983   DRVKLQLILADLLRNIVNHAPFPNSWVGISISPGQELSRDNGRYIHLQFRMIHPGKGLPS  1042

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+F +DL  KT
Sbjct  1043  EMLSDMFETRDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFQVDLQVKT  1096



>ref|NP_193547.4| phytochrome E [Arabidopsis thaliana]
 sp|P42498.2|PHYE_ARATH RecName: Full=Phytochrome E [Arabidopsis thaliana]
 gb|AEE84000.1| phytochrome E [Arabidopsis thaliana]
Length=1112

 Score =   184 bits (468),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++L+TEEF + N++D ++SQVMI L+E+N QL  ++ ++IK+LP+ G
Sbjct  924   ESTDLKSIEEG-KLQLETEEFRLENILDTIISQVMIILRERNSQLRVEVAEEIKTLPLNG  982

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L +IV HAP P+ WV I +SPG +L +D   +IH+QFRM HPG+GLPS
Sbjct  983   DRVKLQLILADLLRNIVNHAPFPNSWVGISISPGQELSRDNGRYIHLQFRMIHPGKGLPS  1042

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE ++C+F +DL  KT
Sbjct  1043  EMLSDMFETRDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERCFFQVDLQVKT  1096



>gb|AGU91425.1| phytochrome B, partial [Chrysanthemum boreale]
Length=1106

 Score =   184 bits (466),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I +G+ +EL+  +F++GNVIDAVVSQVM+ L+++ +QL+ DIP+ IK+L +YG
Sbjct  931   KDVDMENIQEGH-LELEKHDFLLGNVIDAVVSQVMLILRDRGVQLIRDIPEDIKTLTVYG  989

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ ++Q VL++FLL++VRH+PSP+GWVEI+V   LK I DG   +HI FRM  PG GLP 
Sbjct  990   DQTRVQQVLTNFLLNMVRHSPSPNGWVEIQVRSTLKQIFDGMTIVHIDFRMVCPGNGLPP  1049

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM    ++WTT+EG+ L + +K++++MNG V Y+RE ++CYF I L+ 
Sbjct  1050  ELVQDMFH-SSQWTTEEGLGLSMCRKILKLMNGDVQYIRESERCYFHIVLEL  1100



>dbj|BAM67033.1| phytochrome b [Chrysanthemum seticuspe f. boreale]
Length=1130

 Score =   184 bits (466),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             +++D   I +G+ +EL+  +F++GNVIDAVVSQVM+ L+++ +QL+ DIP+ IK+L +YG
Sbjct  955   KDVDMENIQEGH-LELEKHDFLLGNVIDAVVSQVMLILRDRGVQLIRDIPEDIKTLTVYG  1013

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ ++Q VL++FLL++VRH+PSP+GWVEI+V   LK I DG   +HI FRM  PG GLP 
Sbjct  1014  DQTRVQQVLTNFLLNMVRHSPSPNGWVEIQVRSTLKQIFDGMTIVHIDFRMVCPGNGLPP  1073

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L++DM    ++WTT+EG+ L + +K++++MNG V Y+RE ++CYF I L+ 
Sbjct  1074  ELVQDMFH-SSQWTTEEGLGLSMCRKILKLMNGDVQYIRESERCYFHIVLEL  1124



>dbj|BAP76066.1| putative PHYP [Cryptomeria japonica]
Length=1059

 Score =   183 bits (465),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++MD   I +G  +EL   EFV+G V+DAVVSQ MI L+EK LQL+ +IP ++K++ +YG
Sbjct  879   DDMDLDSIENGY-MELDVAEFVLGTVMDAVVSQGMIILREKGLQLIREIPSEVKTMCLYG  937

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ++LQ +L+DFLL+ VR+ PSP+GWV I+V P LK + +G   +H++FR+THPG GLP+
Sbjct  938   DQVRLQQILADFLLNAVRYTPSPEGWVTIKVLPTLKQLGNGIH-VHLEFRITHPGPGLPA  996

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              LI+DM     RWT QEGV L + +KL+++M+G V YVRE + CYFL++L+ 
Sbjct  997   ELIQDMF-DRKRWTMQEGVGLSMCRKLLKLMDGDVQYVRESRTCYFLVNLEL  1047



>gb|AHZ63960.1| phytochrome [Welwitschia mirabilis]
Length=1145

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -3

Query  720   VELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFL  541
             +EL T EF +GNVIDAVVSQ MI  +EK LQL+ DIP  +K + +YGDQI+LQ +LSDF 
Sbjct  976   MELDTVEFALGNVIDAVVSQGMIVQREKGLQLIRDIPGDVKMMCLYGDQIRLQQILSDFF  1035

Query  540   LSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGTRW  361
             L+ +   PS DGWV I+VSP  K +  G   +H++FR+THPG GLP  L++D+    TRW
Sbjct  1036  LNAIHFTPSSDGWVAIKVSPSTKQLGGGLRAVHLEFRITHPGPGLPDELVQDLFE-RTRW  1094

Query  360   TTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             +TQEGV L + +KL+ +MNG V Y+RE  KCYFL++L+ 
Sbjct  1095  STQEGVGLSMCRKLLLLMNGEVQYIREPDKCYFLVNLEL  1133



>ref|XP_010267948.1| PREDICTED: phytochrome B [Nelumbo nucifera]
Length=1128

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ +EL   EF++GNVI+A+VSQVM  L+E+++QL+ DIP++IK L +YGDQ+++Q 
Sbjct  955   IEDGS-LELDKVEFLVGNVINAIVSQVMFLLRERSVQLIRDIPEEIKILAVYGDQVRIQQ  1013

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             +L+DFLL++VR+AP+P+GWVEI V P L    DG E + ++FR+  PG+GLPS +++DM 
Sbjct  1014  ILADFLLNMVRYAPTPEGWVEIHVWPRLGQSSDGRELVQLEFRIVCPGEGLPSDVVQDMF  1073

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
                ++W TQEG+ L + +K++++MNG V Y RE ++CYFLI  + 
Sbjct  1074  -NNSQWVTQEGLGLSMCRKILKLMNGEVQYSRESERCYFLIKFEL  1117



>ref|XP_010921452.1| PREDICTED: LOW QUALITY PROTEIN: phytochrome B [Elaeis guineensis]
Length=1134

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = -3

Query  702   EFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFLLSIVRH  523
             EF++G++I+AVVSQVMI L+E+ LQL+ DIP+++K + + GDQ+++Q VL+DFLL++VRH
Sbjct  972   EFLLGSIINAVVSQVMILLRERGLQLIRDIPEEVKIISVCGDQVRIQQVLADFLLNMVRH  1031

Query  522   APSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGTRWTTQEGV  343
             APSPDGWVEI+V P LK   DG E +  QFR+  PG GLP  L++DM    +RW TQEG+
Sbjct  1032  APSPDGWVEIQVKPSLKQNSDGTEVVLFQFRIVCPGDGLPPELVQDMFH-NSRWVTQEGL  1090

Query  342   VLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L + +K++++M G V Y+RE ++CYFLI ++ 
Sbjct  1091  GLSICRKILKLMKGEVQYIRESERCYFLIFMEL  1123



>ref|XP_009391516.1| PREDICTED: phytochrome B [Musa acuminata subsp. malaccensis]
Length=1180

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 129/183 (70%), Gaps = 9/183 (5%)
 Frame = -3

Query  738   IVDGN-------RVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             I DGN        + L+  EF++G++++AVVSQVMI L+++ LQL+ DIP++IK + +YG
Sbjct  999   ITDGNLQSIEDGSLALEKSEFLLGSIVNAVVSQVMILLRQRGLQLIRDIPEEIKVISVYG  1058

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ+++Q VL+DFLL+++ HAPSP+GWVEI+V P LK   DG E + + FR+  PG GLP 
Sbjct  1059  DQLRIQQVLADFLLNMIHHAPSPEGWVEIQVRPSLKHNSDGTEMVLLHFRIVCPGDGLPP  1118

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT-QKPRS  223
              L++DM    + W T+EG+ L   +KL+++MNG V YVRE  KCYFL+ ++  T  + +S
Sbjct  1119  ELVQDMFH-NSWWVTEEGLGLSTCRKLLKLMNGEVQYVRESVKCYFLVSIELPTSSRAQS  1177

Query  222   RES  214
             R S
Sbjct  1178  RGS  1180



>gb|AFY06994.1| phytochrome B, partial [Vaccinium myrtillus]
Length=149

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -3

Query  660  VMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSP  481
            VM+ L+E+ LQL+ DIP++IK+LP+YGDQ+++Q VL+DFLL++VR+APSPDGWVEI+V P
Sbjct  1    VMMLLRERGLQLIRDIPEEIKTLPVYGDQMRVQQVLADFLLNMVRYAPSPDGWVEIQVQP  60

Query  480  GLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNG  301
             LK I      +HI+FR+  PG GLP  L++DM    +RW TQEG+ L + +K++++MNG
Sbjct  61   RLKHISGETTMVHIEFRIVCPGDGLPPELVQDMFH-SSRWVTQEGLGLSMCRKILKLMNG  119

Query  300  HVHYVREQQKCYFLIDLDF  244
             V Y+RE ++CYFLI L+ 
Sbjct  120  EVQYIRESERCYFLIILEL  138



>ref|XP_010445296.1| PREDICTED: phytochrome E [Camelina sativa]
Length=1109

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++L+TEEF + +++D ++SQVMI L+E+N QL  ++ ++IK+LP+YG
Sbjct  921   ESTDLKSIEEG-KLQLETEEFRVESILDTIISQVMIMLRERNSQLRVEVAEEIKTLPLYG  979

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+ KLQL+L+D + +IV HAP PD W+ I+VS G +L  + + +IH+ FRM HPG+GLPS
Sbjct  980   DRSKLQLILADLMRNIVNHAPFPDSWIGIKVSRGHELTHENDHYIHVLFRMIHPGKGLPS  1039

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM   G  W T +G+ L LS+KL+  MNG V YVRE ++C+F +D+  KT
Sbjct  1040  EILSDMFETGDGWVTPDGLGLKLSRKLLERMNGRVSYVREDERCFFQVDIQVKT  1093



>ref|XP_006406774.1| hypothetical protein EUTSA_v100199781mg, partial [Eutrema salsugineum]
 gb|ESQ48227.1| hypothetical protein EUTSA_v100199781mg, partial [Eutrema salsugineum]
Length=202

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = -3

Query  756  NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
            +MD  GI DG+  +L+  EF +G+VI+A+VSQ M  LKE+ LQL+ DIP++IKS+ +YGD
Sbjct  13   DMDLEGIEDGS-FKLERVEFFLGSVINAIVSQAMFLLKERGLQLIRDIPEEIKSIAVYGD  71

Query  576  QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
            Q ++Q +L++FLLSI+R+APS + WVEI ++   K + DG   I  +FRM  PG+GLP  
Sbjct  72   QTRIQQLLAEFLLSIIRYAPSQE-WVEIHLNQVSKQMADGFSAIRTEFRMACPGEGLPPE  130

Query  396  LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRS  223
            L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+      R+
Sbjct  131  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPVPLKRA  187



>ref|XP_009757538.1| PREDICTED: phytochrome B-like, partial [Nicotiana sylvestris]
Length=449

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 119/163 (73%), Gaps = 1/163 (1%)
 Frame = -3

Query  735  VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
            ++   +EL+  EF + +VIDAVVSQVM+ L+E+ +QL+ DIP++IK+L +YGDQ+++Q +
Sbjct  276  IENGSLELEKAEFFLASVIDAVVSQVMLLLRERGVQLIRDIPEEIKTLRVYGDQVRIQQI  335

Query  555  LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             +DFL  +  +APSP+GWVE+ + P +K I +G   + I+FR+  PG+GLP  LI+DM  
Sbjct  336  FADFLQIMASYAPSPEGWVEVHLRPSMKQISNGVTIVRIEFRIVCPGEGLPPELIQDMFH  395

Query  375  GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
              ++W TQEG+ L + +K + +MNG V Y+R+ ++C+FLI L+
Sbjct  396  -NSKWVTQEGLGLSMCRKTLNLMNGEVQYIRQSERCFFLIILE  437



>ref|XP_010449501.1| PREDICTED: phytochrome E isoform X1 [Camelina sativa]
Length=1112

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++L+TEEF + +++D ++SQVMI L+E+N QL  ++ ++IK+LP+YG
Sbjct  931   ESTDLKSIEEG-KLQLETEEFRVESILDTIISQVMIVLRERNSQLRVEVAEEIKTLPLYG  989

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+ KLQL+L+D + +IV HAP PD W+ I+VS   +L  + + +IH+ FRM HPG+GLPS
Sbjct  990   DRSKLQLILADLMRNIVNHAPYPDSWIGIKVSRRHELTHENDHYIHLLFRMIHPGKGLPS  1049

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM   G  W T +G+ L LS+KL+  MNG V YVRE ++C+F +D+  KT
Sbjct  1050  EILSDMFETGDGWVTPDGLGLKLSRKLLERMNGRVSYVREDERCFFQVDIQVKT  1103



>ref|XP_010449502.1| PREDICTED: phytochrome E isoform X2 [Camelina sativa]
Length=1112

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++L+TEEF + +++D ++SQVMI L+E+N QL  ++ ++IK+LP+YG
Sbjct  931   ESTDLKSIEEG-KLQLETEEFRVESILDTIISQVMIVLRERNSQLRVEVAEEIKTLPLYG  989

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+ KLQL+L+D + +IV HAP PD W+ I+VS   +L  + + +IH+ FRM HPG+GLPS
Sbjct  990   DRSKLQLILADLMRNIVNHAPYPDSWIGIKVSRRHELTHENDHYIHLLFRMIHPGKGLPS  1049

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM   G  W T +G+ L LS+KL+  MNG V YVRE ++C+F +D+  KT
Sbjct  1050  EILSDMFETGDGWVTPDGLGLKLSRKLLERMNGRVSYVREDERCFFQVDIQVKT  1103



>gb|AHZ63959.1| phytochrome [Gnetum montanum]
Length=1172

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 122/168 (73%), Gaps = 1/168 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL T++FV+G VIDAVVSQ MI ++EK LQL+ DIPD++K+L +YGDQ++LQ +
Sbjct  998   IENGYMELDTQQFVLGTVIDAVVSQGMIGVREKGLQLIRDIPDEVKTLCLYGDQLRLQQI  1057

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             LS F L+ +   PS +GW+ I +S   K + D    I I+FR+THPG GLP+ L++D+  
Sbjct  1058  LSKFFLNAIECTPSSEGWIGINISLTTKQLCDVLCTIQIEFRLTHPGPGLPTELVQDLF-  1116

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQK  232
               TRWTTQEG+ L++ +KL+ +MNG V Y+RE  KCYFL++++  + +
Sbjct  1117  DRTRWTTQEGIGLNICRKLLLLMNGEVQYIRESDKCYFLVNVELPSAQ  1164



>ref|XP_006414145.1| hypothetical protein EUTSA_v10024375mg [Eutrema salsugineum]
 gb|ESQ55598.1| hypothetical protein EUTSA_v10024375mg [Eutrema salsugineum]
Length=874

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 125/179 (70%), Gaps = 3/179 (2%)
 Frame = -3

Query  726  NRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSD  547
            ++ +L+ EEF + +++D ++SQVMI LKE+N QL  ++ ++I++LP+YGD+IKLQL+L+D
Sbjct  696  SKWQLEIEEFRLESILDTIISQVMIMLKERNSQLKVEVAEEIRTLPLYGDRIKLQLILAD  755

Query  546  FLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGT  367
             L +IV HAP PD W+ I +SPG KL  D + +IH+QFR+ HPG+GLPS ++ DM     
Sbjct  756  LLRNIVNHAPFPDSWIGINISPGHKLASDTDHYIHLQFRIIHPGKGLPSEMLGDMFETRD  815

Query  366  RWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ---KPRSRESSMDTK  199
             W T +G+ L LS+KL+  MNG V Y+RE +  +F +DL  KT+   + R +E+    K
Sbjct  816  GWVTPDGLGLKLSRKLLEQMNGSVSYIREDKHSFFQVDLQVKTRLGVETRGKEAGSSIK  874



>ref|XP_010434577.1| PREDICTED: phytochrome E-like isoform X2 [Camelina sativa]
Length=1129

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++L+TEEF +  V+D ++SQVMI L+E+N QL  ++ ++IK+LP+YG
Sbjct  941   ESTDLKSIEEG-KLQLETEEFRVETVLDTIISQVMIMLRERNSQLRVEVAEEIKTLPLYG  999

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+ KLQL+L+D + +IV HAP PD W+ I+VS G +L  + + +IH+ FRM HPG+GLPS
Sbjct  1000  DRSKLQLILADLMRNIVNHAPFPDSWIGIKVSRGHELTHENDHYIHLLFRMIHPGKGLPS  1059

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM   G  W T +G+ L LS+KL+  MNG V YVRE ++ +F +D+  KT
Sbjct  1060  NILSDMFETGDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERSFFQVDIQVKT  1113



>ref|XP_010434576.1| PREDICTED: phytochrome E-like isoform X1 [Camelina sativa]
Length=1120

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E+ D   I +G +++L+TEEF +  V+D ++SQVMI L+E+N QL  ++ ++IK+LP+YG
Sbjct  932   ESTDLKSIEEG-KLQLETEEFRVETVLDTIISQVMIMLRERNSQLRVEVAEEIKTLPLYG  990

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D+ KLQL+L+D + +IV HAP PD W+ I+VS G +L  + + +IH+ FRM HPG+GLPS
Sbjct  991   DRSKLQLILADLMRNIVNHAPFPDSWIGIKVSRGHELTHENDHYIHLLFRMIHPGKGLPS  1050

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKT  238
              ++ DM   G  W T +G+ L LS+KL+  MNG V YVRE ++ +F +D+  KT
Sbjct  1051  NILSDMFETGDGWVTPDGLGLKLSRKLLEQMNGRVSYVREDERSFFQVDIQVKT  1104



>ref|XP_011100755.1| PREDICTED: phytochrome B-like [Sesamum indicum]
Length=1145

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 122/163 (75%), Gaps = 3/163 (2%)
 Frame = -3

Query  732   DGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVL  553
             DG+ +EL+  EFV+G+VIDAVVSQVM+ L+E+ LQL+ DIP+++K+L +YGDQ+++Q +L
Sbjct  983   DGS-MELEKVEFVLGSVIDAVVSQVMLLLRERGLQLVRDIPEEVKTLVVYGDQVRIQQIL  1041

Query  552   SDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRG  373
             +DFL ++V HAPSP GWVE+++ P LK I DG    H +FR+  PG+GLP  L++D    
Sbjct  1042  ADFLRNMVHHAPSP-GWVEMQLKPSLKQISDGITVAHNEFRIICPGEGLPPQLVQDTFH-  1099

Query  372   GTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
               RW TQEG+ L +S+K +++MNG V Y+ E + CYFLI L+ 
Sbjct  1100  SNRWVTQEGLALSMSRKFLKLMNGEVQYIIESESCYFLIILEL  1142



>gb|AAG25725.1|AF309806_1 phytochrome B1 [Populus trichocarpa]
Length=1151

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF+ G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  962   IENGLLELEKAEFLFGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLVVYGDQARIQQV  1021

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFR--MTHPGQGLPSALIEDM  382
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H++F+  + +    LP  L++DM
Sbjct  1022  LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHMEFKYALLNSFACLPPELVQDM  1081

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
                 +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1082  FH-SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVILE  1125



>ref|XP_002312330.2| Phytochrome B family protein [Populus trichocarpa]
 gb|EEE89697.2| Phytochrome B family protein [Populus trichocarpa]
Length=1142

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF+ G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q V
Sbjct  962   IENGLLELEKAEFLFGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLVVYGDQARIQQV  1021

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFR--MTHPGQGLPSALIEDM  382
             L+DFLL++VR+APS  GWVEI V P LK I DG+  +H++F+  + +    LP  L++DM
Sbjct  1022  LADFLLNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHMEFKYALLNSFACLPPELVQDM  1081

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
                 +RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1082  FH-SSRWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVILE  1125



>prf||1709211A phytochrome [Selaginella martensii]
Length=267

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -3

Query  759  ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
            ++MD   I DG  +EL T EF++G V+DAV+SQ MI  KEKNLQL+ + P +IK++ +YG
Sbjct  81   DDMDLESIEDGY-LELDTTEFMMGTVMDAVISQGMITSKEKNLQLIRETPKEIKAMFLYG  139

Query  579  DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
            DQ++LQ VL+DFLL+ +R  PS + WV I+V+   K +      +H++FR+THPG GLP 
Sbjct  140  DQVRLQQVLADFLLNAIRFTPSSENWVGIKVATSRKRLGGVVHVMHLEFRITHPGVGLPE  199

Query  399  ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
             L+++M   G R  TQEG+ L + +KLV++MNG V Y+RE  K YFL+ L+ 
Sbjct  200  ELVQEMFDRG-RGMTQEGLGLSMCRKLVKLMNGEVEYIREAGKNYFLVSLEL  250



>gb|ABB13338.1| phytochrome B [Hordeum vulgare subsp. spontaneum]
Length=753

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = -3

Query  738  IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
            I DG+ V L+  E  +GNV++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  579  IEDGSLV-LEKGEISLGNVMNAVVSQVMILLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  637

Query  558  VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
            VLSDFLLS+VR AP+ +GWVEI+V P +K   DG E +   FR   PG+GLP  +++DM 
Sbjct  638  VLSDFLLSMVRFAPTENGWVEIQVRPNVKQNSDGTETMLFLFRFACPGEGLPPDIVQDMF  697

Query  378  RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRES  214
                RWTTQEG+ L + +K++++M G V Y+RE ++ +FLI L+    +PR  E+
Sbjct  698  -SNARWTTQEGIGLSVCRKILKLMGGEVQYIRESERSFFLIVLELP--QPRRSET  749



>dbj|BAP91202.1| phytochrome B CDS [Hordeum bulbosum]
Length=1168

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 124/175 (71%), Gaps = 4/175 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +GNV++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  994   IEDGSLV-LEKGEFSLGNVMNAVVSQVMILLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1052

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VLSDFLLS+VR AP+ +GWVEI+V P +K   DG E +   FR   PG+GLP  +++DM 
Sbjct  1053  VLSDFLLSMVRFAPTENGWVEIQVRPNVKQNSDGTETMLFLFRFACPGEGLPPDIVQDMF  1112

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRES  214
                 RWTTQEG+ L + +K++++M G V Y+RE ++ +FLI L+    +PR  E+
Sbjct  1113  -SNARWTTQEGIGLSVCRKILKLMGGEVQYIRESERSFFLIVLELP--QPRRSET  1164



>gb|KFK28490.1| phytochrome e [Arabis alpina]
Length=1117

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             E  D   I +G ++++K+ EF IG+++D V+SQVM  L+E+N QL  ++ ++IK+LP+YG
Sbjct  929   EGTDVKSIEEG-KLQMKSVEFRIGSILDTVISQVMTMLRERNSQLRVEVVEEIKTLPLYG  987

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             D++KLQL+L+D L ++V H+P PD WV I+VS G +     + +IH+QFRM HPG+GLPS
Sbjct  988   DKVKLQLILADLLRNMVNHSPFPDSWVGIKVSLGQEYSIVNDRYIHLQFRMIHPGKGLPS  1047

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQ---KP  229
              ++ DM      W T +G+ L LS+KL+  MNG V YVRE + C+F +DL  KT+   + 
Sbjct  1048  EMLSDMFETRDVWVTPDGLGLKLSRKLLEQMNGRVSYVREDEHCFFQVDLQVKTKLGVET  1107

Query  228   RSRESSMDTK  199
             R  E+S   K
Sbjct  1108  RGTEASSSKK  1117



>ref|XP_003558068.1| PREDICTED: phytochrome B [Brachypodium distachyon]
Length=1181

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 126/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +GNV++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  1007  IEDGSLV-LEKGEFSLGNVMNAVVSQVMILLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1065

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VLSDFLLS+VR AP+ +GWVEI+V P +K   DG E +   FR   PG+GLP  +++DM 
Sbjct  1066  VLSDFLLSMVRFAPTENGWVEIQVRPNVKQNSDGTETMLFLFRFACPGEGLPPDIVQDMF  1125

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +FLI L+  +  +  SRE S
Sbjct  1126  -SNSRWTTQEGIGLSVCRKILKLMGGEVQYIRESERSFFLIVLELPQPLQAESRERS  1181



>emb|CDX82382.1| BnaA03g34390D [Brassica napus]
Length=184

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 119/170 (70%), Gaps = 3/170 (2%)
 Frame = -3

Query  753  MDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQ  574
            MD   + DG+  EL  EEF +G+VI+AVVSQ M  L+E+ LQL+ DIP++IKS+ +YGDQ
Sbjct  1    MDLERLEDGS-FELVREEFYLGSVINAVVSQAMFLLRERGLQLIRDIPEEIKSIAVYGDQ  59

Query  573  IKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSAL  394
             + Q +L++FLLSI+R+APS + WVEI +S   K +  G+  I  + RM  PG+GLP  L
Sbjct  60   TRTQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMAGGSSTIRTELRMACPGEGLPPEL  118

Query  393  IEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
            + DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+ 
Sbjct  119  VRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILEL  167



>gb|AEK26584.1| phytochrome B1 [Populus tremula]
Length=1128

 Score =   173 bits (438),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 119/160 (74%), Gaps = 3/160 (2%)
 Frame = -3

Query  720   VELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFL  541
             +EL+  EF++G+VI+AVVSQ M+ L+E+NLQLL DIP++IK+L +YGDQ ++Q VL+DFL
Sbjct  967   LELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLVVYGDQARIQQVLADFL  1026

Query  540   LSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQF--RMTHPGQGLPSALIEDMVRGGT  367
             L++VR+APS  GWVEI V P LK I DG+  +H++F          LP  L++DM    +
Sbjct  1027  LNMVRYAPSSAGWVEIHVCPTLKQISDGHTLVHMEFXXXXXXXXXXLPPELVQDMFH-SS  1085

Query  366   RWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLD  247
             RW TQEG+ L + +K++++MNG V Y+RE ++CYFL+ L+
Sbjct  1086  RWVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVILE  1125



>ref|XP_006355734.1| PREDICTED: phytochrome B-like [Solanum tuberosum]
Length=1125

 Score =   173 bits (438),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 128/186 (69%), Gaps = 6/186 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF + +VIDAVVSQVM+ L+E+ +QL+ DIPD+IK+L +YGD
Sbjct  946   DVDLDNIEDGS-LELEKGEFFLASVIDAVVSQVMLLLRERGVQLIRDIPDEIKTLRVYGD  1004

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q V +DFL  +  + PS  GWVE+ + P +  I DG   +HI+FR+  PG+GLP  
Sbjct  1005  QVRIQQVFADFLQIMASYTPSRQGWVEVHLQPSINQISDGATMVHIEFRIVCPGEGLPHE  1064

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             LI+DM    ++W TQ+G+ L + ++++++MNG V Y+RE ++C+FLI L    Q P  + 
Sbjct  1065  LIQDMFH-NSQWVTQQGLGLSMCRRILQLMNGQVQYIRESERCFFLIIL----QLPMPQS  1119

Query  216   SSMDTK  199
              SM  +
Sbjct  1120  DSMSVR  1125



>gb|ACN27021.1| unknown [Zea mays]
Length=237

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = -3

Query  741  GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
             I DG+ V L+  EF +G+V++AVVSQ M  L+E++LQL+ DIPD+IK    YGDQ ++Q
Sbjct  59   SIEDGSLV-LEKSEFSLGDVMNAVVSQTMSLLRERDLQLIRDIPDEIKDASAYGDQFRIQ  117

Query  561  LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
             VL+DFLLS+ + APS +GWVEI+V P +K   DG +     FR   PG+GLP+ +++DM
Sbjct  118  QVLADFLLSMAQSAPSENGWVEIQVRPNVKQNYDGTDTELFIFRFACPGEGLPADIVQDM  177

Query  381  VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPR  226
                ++W+TQEGV L   +K++++M G V Y+RE ++ +FLI L+    +PR
Sbjct  178  F-SNSQWSTQEGVGLSTCRKILKLMGGEVQYIRESERSFFLIVLELP--QPR  226



>gb|AHZ63982.1| phytochrome [Pellia neesiana]
Length=1126

 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++MD   I DG  +EL T EF++G V+DAV+SQ MI  +EK LQL+ + P +IK++ ++G
Sbjct  945   DDMDLESIEDG-YLELNTSEFMMGTVMDAVISQGMITSREKGLQLIRETPREIKTMCLFG  1003

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ++LQ VL+DFLL+ VR  PS +GWV I+V P    +  G   +H++FR+THPG GLP 
Sbjct  1004  DQVRLQQVLADFLLNAVRFTPSSEGWVGIKVVPSRHRLGGGLHVVHLEFRVTHPGAGLPE  1063

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L+++M   G R  TQEG+ L + +KLV++MNG V Y+RE  KCYFL++++ 
Sbjct  1064  ELVQEMFDRG-RGMTQEGLGLSMCRKLVKLMNGDVQYIREAGKCYFLVNVEL  1114



>ref|XP_009591321.1| PREDICTED: phytochrome B-like [Nicotiana tomentosiformis]
Length=1136

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 120/164 (73%), Gaps = 1/164 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL+  EF + +VIDAVVSQVM+ L+E+ +QL+ DIP++IK+L +YGDQ+++Q V
Sbjct  963   IENGSLELEKAEFFLSSVIDAVVSQVMLLLRERGVQLIRDIPEEIKTLRVYGDQVRIQQV  1022

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
              +DFL  +  +APSP+GWVE+ + P +K I +G   +HI+ R+  PG+GLP  LI+DM  
Sbjct  1023  FADFLQIMASYAPSPEGWVEVHLQPSMKQISNGVTIVHIESRIVCPGEGLPPELIQDMFH  1082

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
               ++W TQEG+ L + +K++ +MNG V Y+R+ ++C+FLI L+ 
Sbjct  1083  -NSQWVTQEGLRLSMCRKILNLMNGEVQYIRQSERCFFLIILEL  1125



>dbj|BAJ96486.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1168

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +GNV++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  994   IEDGSLV-LEKGEFSLGNVMNAVVSQVMILLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1052

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VLS FLLS+VR AP+ +GWVEI+V P +K   DG E +   FR   PG+GLP  +++DM 
Sbjct  1053  VLSHFLLSMVRFAPTENGWVEIQVRPNVKQNSDGTETMLFLFRFACPGEGLPPDIVQDMF  1112

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRES  214
                 RWTTQEG+ L + +K++++M G V Y+RE ++ +FLI L+    +PR  E+
Sbjct  1113  -SNARWTTQEGIGLSVCRKILKLMGGEVQYIRESERSFFLIVLELP--QPRRSET  1164



>gb|AAW56586.1| phytochrome B [Arabidopsis thaliana]
Length=1168

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 128/179 (72%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  978   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   KL+ DG   I  +FRM  PG+GLP  
Sbjct  1037  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKLMADGFAAIRTEFRMACPGEGLPPE  1095

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1096  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1151



>gb|EEC75099.1| hypothetical protein OsI_11260 [Oryza sativa Indica Group]
Length=924

 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738  IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
            I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  750  IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  808

Query  558  VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
            VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  809  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  868

Query  378  RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
               +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  869  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  924



>gb|AAX76779.1| putative phytochrome B [Triticum aestivum]
Length=1166

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +GNV++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  992   IEDGSLV-LEKGEFSLGNVMNAVVSQVMILLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1050

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VLSDFLLS+VR AP+ +GWVEI+V P +K   DG E +   FR   PG+GLP  +++DM 
Sbjct  1051  VLSDFLLSMVRFAPTENGWVEIQVRPNVKQNSDGTETMLFLFRFACPGEGLPPDIVQDMF  1110

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
                 RWTTQEG+ L + +K++++M G   Y+RE ++ +FLI L+ 
Sbjct  1111  -SNARWTTQEGIGLSVCRKILKLMGGEEQYIRESERSFFLIVLEL  1154



>sp|P93527.2|PHYB_SORBI RecName: Full=Phytochrome B [Sorghum bicolor]
 gb|AAB41398.2| phytochrome B [Sorghum bicolor]
Length=1178

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 122/173 (71%), Gaps = 2/173 (1%)
 Frame = -3

Query  741   GIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQ  562
              I DG+ V L+  EF  G+V++AVVSQ M+ L+E++LQL+ DIPD+IK    YGDQ ++Q
Sbjct  1003  SIEDGSLV-LEKSEFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQFRIQ  1061

Query  561   LVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDM  382
              VL+DFLLS+VR APS +GWVEI+V P +K   DG +     FR T+PG+GLP+ +++DM
Sbjct  1062  QVLADFLLSMVRSAPSENGWVEIQVRPNVKQNSDGTDTELFIFRFTYPGEGLPADIVQDM  1121

Query  381   VRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRS  223
                 ++W+TQEGV L   +K++++M G V Y+RE ++ +FLI L+    +P +
Sbjct  1122  F-SNSQWSTQEGVGLSTCRKILKLMGGEVQYIRESERSFFLIVLELPQPRPAA  1173



>ref|XP_010529136.1| PREDICTED: phytochrome E [Tarenaya hassleriana]
Length=1120

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = -3

Query  717   ELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFLL  538
             ++K EEF +G V+D V+SQV   + EKNLQL  ++P+ IK+LP+YGD++ LQL+L+DFL 
Sbjct  946   KMKVEEFFLGRVLDTVISQVKELMDEKNLQLELEVPEWIKALPLYGDRVWLQLILTDFLR  1005

Query  537   SIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVRGGTRWT  358
             + V H P PDGWV+I++S     + D + +I +QFRM HPG+G+PS  + DM  GG   +
Sbjct  1006  NSVNHTPFPDGWVKIKISS----VGDSDHYISLQFRMIHPGKGIPSETVSDMFEGGGDIS  1061

Query  357   TQ-EGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRESSMDTKA  196
             +  +G+ L+ S+KL+  MNG V+YVREQ  CYF +DL  +T K    ++ M T+A
Sbjct  1062  SSPDGLGLNFSRKLLERMNGRVNYVREQDTCYFCVDLQLRTAK--EEDTDMRTEA  1114



>ref|XP_010321412.1| PREDICTED: phytochrome B isoform X1 [Solanum lycopersicum]
 gb|AAD50631.1|AF122901_1 phytochrome B2 [Solanum lycopersicum]
Length=1121

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 123/169 (73%), Gaps = 2/169 (1%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             ++D   I DG+ +EL+  EF + +VIDAVVSQVM+ L+E+ +QL+ DIPD+IK+L +YGD
Sbjct  948   DIDLDNIEDGS-LELEKGEFFLASVIDAVVSQVMLLLRERGVQLIRDIPDEIKTLRVYGD  1006

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             Q+++Q V +DFL  +  +AP  +GWVE+ + P +K I DG   +HI+FR+  PG+GLP  
Sbjct  1007  QVRIQQVFADFLQIMASYAPPREGWVEVHLRPSIKQISDGVTIVHIEFRIVCPGEGLPPE  1066

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDL  250
             LI+DM    + W TQ+G+ L + ++++++MNG V Y+RE ++C+FLI L
Sbjct  1067  LIQDMFH-NSLWVTQQGLGLSMCRRILQLMNGQVQYIRESERCFFLIIL  1114



>gb|AAW56590.1| phytochrome B [Arabidopsis thaliana]
Length=1168

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 129/185 (70%), Gaps = 5/185 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  978   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1037  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1095

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSRE  217
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R 
Sbjct  1096  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKRP  1152

Query  216   SSMDT  202
              S  T
Sbjct  1153  LSTAT  1157



>ref|XP_006296857.1| hypothetical protein CARUB_v10012844mg [Capsella rubella]
 gb|EOA29755.1| hypothetical protein CARUB_v10012844mg [Capsella rubella]
Length=1162

 Score =   170 bits (430),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 126/179 (70%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+  ELK  EF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ +YGD
Sbjct  972   DMDLESIEDGS-FELKRAEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIAVYGD  1030

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1031  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFTAIRTEFRMACPGEGLPPE  1089

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1090  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELP--GPRKR  1145



>gb|AHZ63978.1| phytochrome [Scapania nemorea]
Length=1126

 Score =   170 bits (430),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 116/164 (71%), Gaps = 1/164 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL T EF++G VIDAV+SQ MI  +EK LQL+ + P +IK++ ++GDQ +LQ V
Sbjct  952   IEAGYLELDTAEFMMGTVIDAVISQGMITSREKGLQLVRETPREIKTMCLFGDQTRLQQV  1011

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL+ +R  PS +GWV I+V P  + +  G   +H++FR+THPG GLP  L ++M  
Sbjct  1012  LADFLLNAIRFTPSSEGWVGIKVVPSRRRLGGGLHVVHLEFRITHPGTGLPEELFQEMFD  1071

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              G R  TQEG+ L + +KLV++MNG V Y+RE  KCYFL++++ 
Sbjct  1072  RG-RGMTQEGLGLSMCRKLVKLMNGDVQYIREAGKCYFLVNVEL  1114



>ref|XP_006651316.1| PREDICTED: phytochrome B-like, partial [Oryza brachyantha]
Length=1117

 Score =   170 bits (430),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  943   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1001

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1002  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEVVQDMF  1061

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  +  +  SRE+S
Sbjct  1062  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPHQAASRETS  1117



>sp|A2XFW2.2|PHYB_ORYSI RecName: Full=Phytochrome B [Oryza sativa Indica Group]
Length=1171

 Score =   169 bits (429),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFPFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|EEE58928.1| hypothetical protein OsJ_10581 [Oryza sativa Japonica Group]
Length=1128

 Score =   169 bits (429),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  954   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1012

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1013  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1072

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1073  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1128



>emb|CAA40795.2| phytochrome B [Oryza sativa Indica Group]
Length=1171

 Score =   169 bits (429),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFPFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30993.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVKPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31025.1| phytochrome b, partial [Oryza nivara]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31023.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31046.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31026.1| phytochrome b, partial [Oryza nivara]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30971.1| phytochrome b, partial [Oryza sativa Indica Group]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AHZ63972.1| phytochrome [Isoetes tegetiformans]
Length=1127

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = -3

Query  759   ENMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYG  580
             ++MD   I DG  +EL T EF++G+V+DAVVSQ MI  +EK LQL+ + P +IKS+ ++G
Sbjct  946   DDMDLESIEDG-YLELDTAEFMMGSVMDAVVSQGMITSREKGLQLIRETPKEIKSMCLFG  1004

Query  579   DQIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPS  400
             DQ++LQ VL+DFLL+ VR  PS +GWV I+V P  K +  G   ++++FR+THPG GLP 
Sbjct  1005  DQVRLQQVLADFLLNAVRFTPSAEGWVGIKVLPSRKRLGGGVHVMNLEFRITHPGPGLPE  1064

Query  399   ALIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              L+++M   G R  TQEG+ L + +KLV++MNG V Y+RE  K YFL++++ 
Sbjct  1065  ELVQEMFDSG-RGMTQEGLGLSMCRKLVKLMNGDVQYIREAGKSYFLVNVEL  1115



>gb|AFK30985.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31020.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31054.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>ref|NP_001049910.2| Os03g0309200 [Oryza sativa Japonica Group]
 dbj|BAF11824.2| Os03g0309200, partial [Oryza sativa Japonica Group]
Length=1120

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  946   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1004

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1005  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1064

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1065  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1120



>gb|AFK31044.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31040.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30983.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30981.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31010.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31012.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31013.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31014.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31016.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31019.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31048.1| phytochrome b, partial [Oryza rufipogon]
 gb|AFK31052.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AHZ63979.1| phytochrome [Porella pinnata]
Length=1126

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 117/164 (71%), Gaps = 1/164 (1%)
 Frame = -3

Query  735   VDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLV  556
             ++   +EL T EF++G V+DAV+SQ MI  +EK LQL+ + P +IK++ ++GDQ++LQ V
Sbjct  952   IEAGYLELDTAEFLMGTVMDAVISQGMITSREKGLQLIRETPREIKTMCLFGDQVRLQQV  1011

Query  555   LSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMVR  376
             L+DFLL+ VR  PS +GWV I+V P  + +  G   +H++FR+THPG GLP  L+++M  
Sbjct  1012  LADFLLNAVRFTPSSEGWVGIKVVPTRRRLGGGLHVVHLEFRVTHPGAGLPEELVQEMFD  1071

Query  375   GGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF  244
              G R  TQEG+ L + +KL ++MNG V Y+RE  KCYFL++++ 
Sbjct  1072  RG-RSMTQEGLGLSMCRKLAKLMNGDVQYIREAGKCYFLVNVEL  1114



>ref|XP_010414753.1| PREDICTED: phytochrome B-like isoform X3 [Camelina sativa]
Length=1166

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 126/179 (70%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+  ELK  EF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ +YGD
Sbjct  976   DMDLESIEDGS-FELKGAEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSVAVYGD  1034

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +LS+FLLSI+R+APS + WVEI +S   K + +G   I  ++RM  PG+GLP  
Sbjct  1035  QIRIQQLLSEFLLSIIRYAPSQE-WVEIHLSQVSKQMANGFATIRTEYRMACPGEGLPPE  1093

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + QK++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1094  LVRDMFH-SSRWTSPEGLGLSVCQKILKLMNGEVQYIRESERSYFLIILELP--DPRKR  1149



>gb|AFK31045.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31003.1| phytochrome b, partial [Oryza sativa Indica Group]
Length=1171

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31001.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31035.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31029.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31018.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30979.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AAW56589.1| phytochrome B, partial [Arabidopsis thaliana]
Length=1158

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  975   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1033

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1034  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1092

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1093  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1148



>gb|AFK31030.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>ref|XP_010414759.1| PREDICTED: phytochrome B-like isoform X4 [Camelina sativa]
Length=1166

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 126/179 (70%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+  ELK  EF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ +YGD
Sbjct  976   DMDLESIEDGS-FELKGAEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSVAVYGD  1034

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +LS+FLLSI+R+APS + WVEI +S   K + +G   I  ++RM  PG+GLP  
Sbjct  1035  QIRIQQLLSEFLLSIIRYAPSQE-WVEIHLSQVSKQMANGFATIRTEYRMACPGEGLPPE  1093

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + QK++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1094  LVRDMFH-SSRWTSPEGLGLSVCQKILKLMNGEVQYIRESERSYFLIILELP--DPRKR  1149



>gb|AFK31024.1| phytochrome b, partial [Oryza nivara]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30984.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31009.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31021.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30978.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31049.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30982.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>sp|Q10MG9.1|PHYB_ORYSJ RecName: Full=Phytochrome B [Oryza sativa Japonica Group]
 dbj|BAC76432.1| phytochrome B [Oryza sativa Japonica Group]
 dbj|BAD86669.1| phytochrome B [Oryza sativa Japonica Group]
 gb|ABF95558.1| Phytochrome B, putative, expressed [Oryza sativa Japonica Group]
 gb|AFK30987.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31005.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31006.1| phytochrome b, partial [Oryza sativa Japonica Group]
 gb|AFK31008.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AAW56588.1| phytochrome B, partial [Arabidopsis thaliana]
Length=1161

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  977   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1035

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1036  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1094

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1095  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1150



>gb|AAR32737.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61305.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61306.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61309.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61310.1| phytochrome B [Arabidopsis thaliana]
Length=1168

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  978   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1037  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1095

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1096  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1151



>gb|AFK31031.1| phytochrome b, partial [Oryza rufipogon]
 gb|AFK31050.1| phytochrome b, partial [Oryza rufipogon]
 gb|AFK31051.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31039.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31022.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31011.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31028.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|ABY61301.1| phytochrome B [Arabidopsis thaliana]
Length=1168

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  978   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1037  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1095

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1096  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1151



>gb|AAW56587.1| phytochrome B, partial [Arabidopsis thaliana]
Length=1158

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  975   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1033

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1034  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1092

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1093  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1148



>gb|AFK31004.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30973.1| phytochrome b, partial [Oryza sativa Indica Group]
 gb|AFK30977.1| phytochrome b, partial [Oryza sativa Indica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|ABY61307.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61308.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61312.1| phytochrome B [Arabidopsis thaliana]
Length=1168

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  978   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1037  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1095

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1096  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1151



>gb|AFK31047.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AAW56580.1| phytochrome B [Arabidopsis thaliana]
 gb|AAW56581.1| phytochrome B [Arabidopsis thaliana]
 gb|AAW56582.1| phytochrome B [Arabidopsis thaliana]
 gb|AAW56583.1| phytochrome B [Arabidopsis thaliana]
 gb|AAW56584.1| phytochrome B [Arabidopsis thaliana]
 gb|AAW56585.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61302.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61303.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61304.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61311.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61313.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61316.1| phytochrome B [Arabidopsis thaliana]
 gb|ABY61317.1| phytochrome B [Arabidopsis thaliana]
Length=1168

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  978   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1037  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1095

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1096  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1151



>gb|ABY61300.1| phytochrome B [Arabidopsis thaliana]
Length=1168

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (71%), Gaps = 5/179 (3%)
 Frame = -3

Query  756   NMDSGGIVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGD  577
             +MD   I DG+ V LK EEF +G+VI+A+VSQ M  L+++ LQL+ DIP++IKS+ ++GD
Sbjct  978   DMDLESIEDGSFV-LKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGD  1036

Query  576   QIKLQLVLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSA  397
             QI++Q +L++FLLSI+R+APS + WVEI +S   K + DG   I  +FRM  PG+GLP  
Sbjct  1037  QIRIQQLLAEFLLSIIRYAPSQE-WVEIHLSQVSKQMADGFAAIRTEFRMACPGEGLPPE  1095

Query  396   LIEDMVRGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDFKTQKPRSR  220
             L+ DM    +RWT+ EG+ L + +K++++MNG V Y+RE ++ YFLI L+     PR R
Sbjct  1096  LVRDMFH-SSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPV--PRKR  1151



>gb|AFK31043.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31036.1| phytochrome b, partial [Oryza rufipogon]
 gb|AFK31037.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31034.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31017.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31015.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30999.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK30988.1| phytochrome b, partial [Oryza sativa Japonica Group]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



>gb|AFK31041.1| phytochrome b, partial [Oryza rufipogon]
Length=1171

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  738   IVDGNRVELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQL  559
             I DG+ V L+  EF +G+V++AVVSQVMI L+E++LQL+ DIPD+IK    YGDQ ++Q 
Sbjct  997   IEDGSLV-LEKGEFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQ  1055

Query  558   VLSDFLLSIVRHAPSPDGWVEIRVSPGLKLIQDGNEFIHIQFRMTHPGQGLPSALIEDMV  379
             VL DFLLS+VR AP+ +GWVEI+V P +K   DG + +   FR   PG+GLP  +++DM 
Sbjct  1056  VLCDFLLSMVRFAPAENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMF  1115

Query  378   RGGTRWTTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF-KTQKPRSRESS  211
                +RWTTQEG+ L + +K++++M G V Y+RE ++ +F I L+  + Q+  SR +S
Sbjct  1116  -SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSFFHIVLELPQPQQAASRGTS  1171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470