BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004M21

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075175.1|  PREDICTED: TBCC domain-containing protein 1-...    134   1e-32   Sesamum indicum [beniseed]
emb|CBI30042.3|  unnamed protein product                                132   3e-32   Vitis vinifera
ref|XP_002278205.1|  PREDICTED: TBCC domain-containing protein 1-...    132   5e-32   Vitis vinifera
ref|XP_003554199.1|  PREDICTED: TBCC domain-containing protein 1-...    132   6e-32   Glycine max [soybeans]
gb|KHN26370.1|  TBCC domain-containing protein 1                        132   6e-32   Glycine soja [wild soybean]
gb|EYU20708.1|  hypothetical protein MIMGU_mgv1a007731mg                128   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_003520533.1|  PREDICTED: TBCC domain-containing protein 1-...    128   1e-30   Glycine max [soybeans]
ref|XP_008360822.1|  PREDICTED: TBCC domain-containing protein 1-...    126   2e-30   
emb|CDP20019.1|  unnamed protein product                                127   2e-30   Coffea canephora [robusta coffee]
ref|XP_009369834.1|  PREDICTED: TBCC domain-containing protein 1-...    126   5e-30   Pyrus x bretschneideri [bai li]
ref|XP_007162300.1|  hypothetical protein PHAVU_001G140500g             126   9e-30   Phaseolus vulgaris [French bean]
ref|XP_003521203.1|  PREDICTED: TBCC domain-containing protein 1-...    125   1e-29   Glycine max [soybeans]
gb|KHN07410.1|  TBCC domain-containing protein 1                        125   1e-29   Glycine soja [wild soybean]
emb|CDY06066.1|  BnaA09g37140D                                          118   2e-29   
gb|KHN26369.1|  TBCC domain-containing protein 1                        124   3e-29   Glycine soja [wild soybean]
ref|XP_003554198.1|  PREDICTED: TBCC domain-containing protein 1-...    124   3e-29   Glycine max [soybeans]
gb|KCW48078.1|  hypothetical protein EUGRSUZ_K01823                     122   5e-29   Eucalyptus grandis [rose gum]
gb|AFK40546.1|  unknown                                                 116   7e-29   Lotus japonicus
ref|XP_010038901.1|  PREDICTED: TBCC domain-containing protein 1        122   1e-28   
ref|XP_002532335.1|  conserved hypothetical protein                     123   1e-28   Ricinus communis
gb|KJB15036.1|  hypothetical protein B456_002G156800                    122   1e-28   Gossypium raimondii
ref|XP_011078850.1|  PREDICTED: TBCC domain-containing protein 1-...    122   2e-28   Sesamum indicum [beniseed]
ref|XP_007028946.1|  Tubulin binding cofactor C domain-containing...    122   2e-28   
ref|XP_009369843.1|  PREDICTED: TBCC domain-containing protein 1-...    122   2e-28   Pyrus x bretschneideri [bai li]
gb|KJB16388.1|  hypothetical protein B456_002G228100                    122   3e-28   Gossypium raimondii
ref|XP_009629812.1|  PREDICTED: TBCC domain-containing protein 1-...    122   3e-28   Nicotiana tomentosiformis
gb|KDP24597.1|  hypothetical protein JCGZ_25513                         122   3e-28   Jatropha curcas
ref|XP_010672700.1|  PREDICTED: TBCC domain-containing protein 1        121   4e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008240958.1|  PREDICTED: TBCC domain-containing protein 1 ...    121   4e-28   Prunus mume [ume]
gb|EYU39914.1|  hypothetical protein MIMGU_mgv1a003654mg                121   6e-28   Erythranthe guttata [common monkey flower]
ref|XP_004304384.1|  PREDICTED: TBCC domain-containing protein 1 ...    121   6e-28   Fragaria vesca subsp. vesca
ref|XP_009376106.1|  PREDICTED: TBCC domain-containing protein 1-...    120   8e-28   Pyrus x bretschneideri [bai li]
emb|CDX98257.1|  BnaC06g16180D                                          120   8e-28   
ref|XP_002323291.1|  tubulin-specific chaperone C-related family ...    120   8e-28   Populus trichocarpa [western balsam poplar]
emb|CDX67713.1|  BnaA07g17530D                                          120   1e-27   
ref|XP_009772589.1|  PREDICTED: TBCC domain-containing protein 1-...    119   2e-27   Nicotiana sylvestris
ref|XP_009104081.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    119   3e-27   Brassica rapa
ref|XP_011033250.1|  PREDICTED: TBCC domain-containing protein 1 ...    119   3e-27   Populus euphratica
ref|XP_010265832.1|  PREDICTED: TBCC domain-containing protein 1-...    118   4e-27   
ref|XP_010265831.1|  PREDICTED: TBCC domain-containing protein 1-...    118   6e-27   Nelumbo nucifera [Indian lotus]
ref|XP_004249279.1|  PREDICTED: TBCC domain-containing protein 1        118   7e-27   Solanum lycopersicum
ref|XP_007162298.1|  hypothetical protein PHAVU_001G140300g             118   8e-27   Phaseolus vulgaris [French bean]
ref|XP_004493562.1|  PREDICTED: TBCC domain-containing protein 1-...    117   9e-27   Cicer arietinum [garbanzo]
emb|CDY06067.1|  BnaA09g37130D                                          117   9e-27   
ref|XP_006402830.1|  hypothetical protein EUTSA_v10005862mg             117   1e-26   Eutrema salsugineum [saltwater cress]
ref|XP_011020269.1|  PREDICTED: TBCC domain-containing protein 1 ...    117   1e-26   Populus euphratica
ref|XP_004146385.1|  PREDICTED: TBCC domain-containing protein 1-...    117   1e-26   Cucumis sativus [cucumbers]
ref|XP_011020268.1|  PREDICTED: TBCC domain-containing protein 1 ...    117   1e-26   Populus euphratica
ref|XP_011020267.1|  PREDICTED: TBCC domain-containing protein 1 ...    117   1e-26   Populus euphratica
ref|XP_004156008.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    117   1e-26   
ref|XP_009139004.1|  PREDICTED: TBCC domain-containing protein 1-...    117   1e-26   Brassica rapa
emb|CDX71986.1|  BnaC08g28880D                                          117   1e-26   
ref|XP_008442093.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    117   1e-26   Cucumis melo [Oriental melon]
ref|XP_007203759.1|  hypothetical protein PRUPE_ppa003584mg             117   2e-26   Prunus persica
ref|XP_008240959.1|  PREDICTED: TBCC domain-containing protein 1 ...    117   2e-26   Prunus mume [ume]
emb|CDY61748.1|  BnaA04g27540D                                          117   2e-26   Brassica napus [oilseed rape]
ref|XP_009629687.1|  PREDICTED: TBCC domain-containing protein 1-...    117   2e-26   Nicotiana tomentosiformis
emb|CDY47657.1|  BnaC04g23940D                                          117   2e-26   Brassica napus [oilseed rape]
ref|XP_011468069.1|  PREDICTED: TBCC domain-containing protein 1 ...    116   3e-26   Fragaria vesca subsp. vesca
ref|XP_006351339.1|  PREDICTED: TBCC domain-containing protein 1-...    116   3e-26   Solanum tuberosum [potatoes]
ref|XP_008392091.1|  PREDICTED: TBCC domain-containing protein 1        116   3e-26   
ref|XP_009797552.1|  PREDICTED: TBCC domain-containing protein 1-...    116   3e-26   Nicotiana sylvestris
ref|XP_006381055.1|  tubulin-specific chaperone C-related family ...    116   4e-26   Populus trichocarpa [western balsam poplar]
emb|CAB67617.1|  putative protein                                       116   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290821.1|  hypothetical protein CARUB_v10016930mg             116   4e-26   Capsella rubella
ref|NP_567059.1|  Tubulin binding cofactor C domain-containing pr...    116   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116487.1|  PREDICTED: TBCC domain-containing protein 1        116   4e-26   Brassica rapa
ref|XP_003625224.1|  TBCC domain-containing protein                     115   4e-26   
ref|XP_010257397.1|  PREDICTED: TBCC domain-containing protein 1-...    116   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010524365.1|  PREDICTED: TBCC domain-containing protein 1-...    115   5e-26   Tarenaya hassleriana [spider flower]
gb|EPS74445.1|  hypothetical protein M569_00304                         115   5e-26   Genlisea aurea
ref|NP_001190120.1|  Tubulin binding cofactor C domain-containing...    115   6e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB82781.1|  hypothetical protein B456_013G212400                    114   7e-26   Gossypium raimondii
gb|KEH41654.1|  tubulin-binding cofactor C domain protein               115   7e-26   Medicago truncatula
ref|XP_010427682.1|  PREDICTED: TBCC domain-containing protein 1-...    115   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010507501.1|  PREDICTED: uncharacterized protein LOC104784134    114   1e-25   Camelina sativa [gold-of-pleasure]
gb|KFK35082.1|  hypothetical protein AALP_AA5G233000                    114   1e-25   Arabis alpina [alpine rockcress]
gb|KJB82780.1|  hypothetical protein B456_013G212400                    114   1e-25   Gossypium raimondii
ref|XP_002876443.1|  hypothetical protein ARALYDRAFT_486241             114   1e-25   
emb|CDY53502.1|  BnaC04g02540D                                          114   1e-25   Brassica napus [oilseed rape]
gb|KJB82776.1|  hypothetical protein B456_013G212400                    114   2e-25   Gossypium raimondii
ref|XP_010548390.1|  PREDICTED: TBCC domain-containing protein 1-...    114   2e-25   Tarenaya hassleriana [spider flower]
gb|KDO57721.1|  hypothetical protein CISIN_1g0403992mg                  109   3e-25   Citrus sinensis [apfelsine]
gb|AGJ83863.1|  tublin binding cofactor C                               113   5e-25   Gossypium hirsutum [American cotton]
ref|NP_973669.1|  C-CAP/cofactor C-like domain-containing protein       112   7e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KHG16745.1|  TBCC domain-containing 1                                112   7e-25   Gossypium arboreum [tree cotton]
ref|XP_006411483.1|  hypothetical protein EUTSA_v10016442mg             112   1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010508603.1|  PREDICTED: TBCC domain-containing protein 1-...    111   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010517737.1|  PREDICTED: TBCC domain-containing protein 1-...    111   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010506033.1|  PREDICTED: TBCC domain-containing protein 1-...    111   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006342320.1|  PREDICTED: TBCC domain-containing protein 1-...    111   2e-24   Solanum tuberosum [potatoes]
ref|XP_009142814.1|  PREDICTED: TBCC domain-containing protein 1        111   2e-24   Brassica rapa
emb|CDX79886.1|  BnaA05g02700D                                          111   3e-24   
ref|XP_006293916.1|  hypothetical protein CARUB_v10022907mg             110   3e-24   
ref|XP_010516427.1|  PREDICTED: TBCC domain-containing protein 1-...    110   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004497930.1|  PREDICTED: TBCC domain-containing protein 1-...    109   7e-24   Cicer arietinum [garbanzo]
ref|XP_006485027.1|  PREDICTED: TBCC domain-containing protein 1-...    108   2e-23   Citrus sinensis [apfelsine]
ref|XP_006437044.1|  hypothetical protein CICLE_v10031101mg             108   2e-23   Citrus clementina [clementine]
gb|KJB36107.1|  hypothetical protein B456_006G141400                    105   3e-23   Gossypium raimondii
gb|KJB36111.1|  hypothetical protein B456_006G141400                    105   4e-23   Gossypium raimondii
ref|XP_008778358.1|  PREDICTED: TBCC domain-containing protein 1-...    105   5e-23   Phoenix dactylifera
gb|KJB36108.1|  hypothetical protein B456_006G141400                    105   5e-23   Gossypium raimondii
ref|XP_009411800.1|  PREDICTED: TBCC domain-containing protein 1-...    107   7e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928451.1|  PREDICTED: TBCC domain-containing protein 1 ...    106   1e-22   
gb|KJB36105.1|  hypothetical protein B456_006G141400                    106   1e-22   Gossypium raimondii
gb|AFW66197.1|  hypothetical protein ZEAMMB73_400795                    100   1e-22   
ref|XP_010928450.1|  PREDICTED: TBCC domain-containing protein 1 ...    106   1e-22   
ref|XP_009391882.1|  PREDICTED: TBCC domain-containing protein 1-...    105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36106.1|  hypothetical protein B456_006G141400                    105   2e-22   Gossypium raimondii
ref|XP_008795746.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    105   3e-22   Phoenix dactylifera
ref|NP_001058077.1|  Os06g0614300                                       105   3e-22   
gb|EEE66013.1|  hypothetical protein OsJ_21970                          105   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80975.1|  hypothetical protein OsI_23703                          105   3e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_010943570.1|  PREDICTED: TBCC domain-containing protein 1-...    102   2e-21   Elaeis guineensis
ref|XP_004965884.1|  PREDICTED: TBCC domain-containing protein 1-...    102   4e-21   Setaria italica
ref|XP_006657134.1|  PREDICTED: TBCC domain-containing protein 1-...    100   8e-21   Oryza brachyantha
ref|NP_001168301.1|  hypothetical protein                               101   8e-21   Zea mays [maize]
ref|XP_008800652.1|  PREDICTED: TBCC domain-containing protein 1-...    100   9e-21   Phoenix dactylifera
gb|ACN28202.1|  unknown                                                 100   1e-20   Zea mays [maize]
dbj|BAJ90629.1|  predicted protein                                      100   2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951581.1|  PREDICTED: TBCC domain-containing protein 1-...  99.8    3e-20   Setaria italica
ref|XP_003563624.1|  PREDICTED: TBCC domain-containing protein 1-...  99.4    3e-20   Brachypodium distachyon [annual false brome]
dbj|BAJ93674.1|  predicted protein                                    99.4    3e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK39829.1|  unknown                                               91.3    5e-20   Medicago truncatula
gb|ABR16182.1|  unknown                                               99.0    5e-20   Picea sitchensis
ref|XP_002453473.1|  hypothetical protein SORBIDRAFT_04g006490        98.6    5e-20   Sorghum bicolor [broomcorn]
ref|XP_003571239.1|  PREDICTED: TBCC domain-containing protein 1-...  97.4    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_008643390.1|  PREDICTED: hypothetical protein isoform X2       97.1    2e-19   Zea mays [maize]
ref|NP_001144767.1|  hypothetical protein                             97.1    2e-19   Zea mays [maize]
ref|XP_008643389.1|  PREDICTED: hypothetical protein isoform X1       96.7    2e-19   Zea mays [maize]
ref|XP_006648417.1|  PREDICTED: TBCC domain-containing protein 1-...  95.1    5e-19   Oryza brachyantha
ref|XP_006850073.1|  hypothetical protein AMTR_s00022p00213770        95.9    5e-19   Amborella trichopoda
gb|EEE56495.1|  hypothetical protein OsJ_05741                        95.5    6e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72669.1|  hypothetical protein OsI_06222                        95.5    6e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001046181.1|  Os02g0194800                                     95.5    6e-19   
gb|KJB15038.1|  hypothetical protein B456_002G156800                  95.5    8e-19   Gossypium raimondii
ref|XP_010913921.1|  PREDICTED: TBCC domain-containing protein 1-...  93.6    3e-18   Elaeis guineensis
ref|XP_008787292.1|  PREDICTED: TBCC domain-containing protein 1-...  93.6    4e-18   Phoenix dactylifera
gb|EEC67872.1|  hypothetical protein OsI_35505                        91.3    4e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_011033249.1|  PREDICTED: TBCC domain-containing protein 1 ...  92.0    9e-18   Populus euphratica
gb|KGN54813.1|  hypothetical protein Csa_4G507430                     89.4    7e-17   Cucumis sativus [cucumbers]
gb|KHG18606.1|  TBCC domain-containing 1                              89.4    9e-17   Gossypium arboreum [tree cotton]
gb|KJB15037.1|  hypothetical protein B456_002G156800                  86.3    7e-16   Gossypium raimondii
gb|KJB36110.1|  hypothetical protein B456_006G141400                  84.7    7e-16   Gossypium raimondii
ref|NP_181752.3|  C-CAP/cofactor C-like domain-containing protein     85.1    2e-15   
ref|XP_002881827.1|  hypothetical protein ARALYDRAFT_483312           85.1    2e-15   
gb|AAB88648.1|  hypothetical protein                                  84.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98763.1|  TBCC domain-containing 1                              79.3    2e-13   Gossypium arboreum [tree cotton]
gb|ACM17606.1|  tubulin-specific chaperon-like protein                76.6    7e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002986516.1|  hypothetical protein SELMODRAFT_182480           75.5    4e-12   
ref|XP_002964936.1|  hypothetical protein SELMODRAFT_439144           75.1    4e-12   Selaginella moellendorffii
gb|EMT00776.1|  hypothetical protein F775_29395                       70.5    2e-11   
ref|XP_001757659.1|  predicted protein                                72.8    2e-11   
ref|XP_010233970.1|  PREDICTED: TBCC domain-containing protein 1-...  71.6    6e-11   Brachypodium distachyon [annual false brome]
gb|EMT07109.1|  TBCC domain-containing protein 1                      70.9    1e-10   
ref|XP_001778693.1|  predicted protein                                68.2    7e-10   
ref|XP_001765734.1|  predicted protein                                66.6    2e-09   
ref|XP_001758135.1|  predicted protein                                62.8    4e-08   
ref|XP_003060588.1|  predicted protein                                60.8    2e-07   Micromonas pusilla CCMP1545
ref|XP_011396281.1|  TBCC domain-containing protein 1                 58.2    2e-06   Auxenochlorella protothecoides
gb|EMS64518.1|  TBCC domain-containing protein 1                      56.6    6e-06   Triticum urartu
ref|XP_005651291.1|  TBCC-domain-containing protein                   55.5    1e-05   Coccomyxa subellipsoidea C-169
ref|XP_002505027.1|  predicted protein                                54.7    2e-05   Micromonas commoda
ref|XP_009514404.1|  hypothetical protein PHYSODRAFT_358230           51.6    2e-04   Phytophthora sojae
gb|ETK90738.1|  hypothetical protein L915_05554                       50.8    4e-04   Phytophthora parasitica
gb|ETO79605.1|  hypothetical protein F444_05744                       51.2    4e-04   Phytophthora parasitica P1976
gb|ETL97323.1|  hypothetical protein, variant                         50.8    4e-04   Phytophthora parasitica
gb|ETO79606.1|  hypothetical protein, variant                         50.8    4e-04   Phytophthora parasitica P1976
ref|XP_008903430.1|  hypothetical protein, variant                    50.8    4e-04   Phytophthora parasitica INRA-310
ref|XP_008903429.1|  hypothetical protein PPTG_22581                  50.8    5e-04   Phytophthora parasitica INRA-310
gb|ETL97322.1|  hypothetical protein L917_05380                       50.8    5e-04   Phytophthora parasitica
gb|ETP20620.1|  hypothetical protein F441_05699                       50.8    5e-04   Phytophthora parasitica CJ01A1
ref|XP_002909594.1|  conserved hypothetical protein                   50.8    5e-04   Phytophthora infestans T30-4
gb|ETI50864.1|  hypothetical protein F443_05691                       50.8    5e-04   Phytophthora parasitica P1569



>ref|XP_011075175.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=570

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+ASQ KNHKNLVE+K ILRET+LE+SRKREL++ALH  FKDWLYASGN
Sbjct  501  TKDNPFPLPDAYLASQQKNHKNLVEVKHILRETQLEESRKRELSTALHACFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  561  IRQLYCLQGE  570



>emb|CBI30042.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMASQ +NHKNL EIKQILRET LE++RKREL+ ALHV FKDWLYASGN
Sbjct  397  TKDNPFPLPDAYMASQQRNHKNLGEIKQILRETPLEENRKRELSCALHVFFKDWLYASGN  456

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  457  IRQLYCLQGD  466



>ref|XP_002278205.1| PREDICTED: TBCC domain-containing protein 1-like [Vitis vinifera]
Length=568

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMASQ +NHKNL EIKQILRET LE++RKREL+ ALHV FKDWLYASGN
Sbjct  499  TKDNPFPLPDAYMASQQRNHKNLGEIKQILRETPLEENRKRELSCALHVFFKDWLYASGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  559  IRQLYCLQGD  568



>ref|XP_003554199.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LPDAYMASQHKNHKNL EI+Q+LRE  LE+SRKREL+SALHV FKDWLYASGN
Sbjct  496  TKDNPFTLPDAYMASQHKNHKNLEEIRQLLREASLEESRKRELSSALHVYFKDWLYASGN  555

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  556  IRQLYCLQGD  565



>gb|KHN26370.1| TBCC domain-containing protein 1 [Glycine soja]
Length=553

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LPDAYMASQHKNHKNL EI+Q+LRE  LE+SRKREL+SALHV FKDWLYASGN
Sbjct  484  TKDNPFTLPDAYMASQHKNHKNLEEIRQLLREASLEESRKRELSSALHVYFKDWLYASGN  543

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  544  IRQLYCLQGD  553



>gb|EYU20708.1| hypothetical protein MIMGU_mgv1a007731mg [Erythranthe guttata]
Length=397

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+ASQ KN K+L E+KQILRET+LE++RKREL+SALH  FKDWLYASGN
Sbjct  328  TKDNPFPLPDAYLASQQKNIKSLAEVKQILRETQLEENRKRELSSALHACFKDWLYASGN  387

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  388  IRQLYCLQGE  397



>ref|XP_003520533.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  709  KDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNI  530
            KDNPF LPDAYMASQHKNHKNL EI+++LRE  LE+SRKREL+SALHV FKDWLYASGNI
Sbjct  497  KDNPFTLPDAYMASQHKNHKNLEEIRKLLREASLEESRKRELSSALHVYFKDWLYASGNI  556

Query  529  RQLYCLQGE  503
            RQLYCLQG+
Sbjct  557  RQLYCLQGD  565



>ref|XP_008360822.1| PREDICTED: TBCC domain-containing protein 1-like [Malus domestica]
Length=362

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMASQH+N  NL E+KQ+L+E  LE++RKREL++ALHV FKDWLYASGN
Sbjct  293  TKDNPFPLPDAYMASQHRNQNNLGEVKQLLKEAPLEENRKRELSTALHVYFKDWLYASGN  352

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  353  IRQLYCLQGE  362



>emb|CDP20019.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYM SQ +NHKNL EIK IL+ET+LE+SRKREL+S LH  FKDWLYASGN
Sbjct  521  TKDNPFPLPDAYMVSQQRNHKNLGEIKHILKETQLEESRKRELSSTLHACFKDWLYASGN  580

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  581  IRQLYCLQGD  590



>ref|XP_009369834.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=565

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMASQH+N  NL E+KQ+L+E  LE++RKREL++ALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDAYMASQHRNQNNLGEVKQLLKEAPLEENRKRELSTALHVYFKDWLYASGN  555

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  556  IRQLYCLQGE  565



>ref|XP_007162300.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
 gb|ESW34294.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
Length=565

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF LPDAYMASQHKNHKNL E++Q++RE  LE+SRKREL+SALHV FKDWLYASGN
Sbjct  496  TEGNPFSLPDAYMASQHKNHKNLGELRQLIREASLEESRKRELSSALHVYFKDWLYASGN  555

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  556  IRQLYCLQGD  565



>ref|XP_003521203.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=566

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LPDAYMASQHKN KNL EI+Q+LRE  LE+SRKREL+SALHV FKDWLYASGN
Sbjct  497  TKGNPFMLPDAYMASQHKNQKNLGEIRQLLREAPLEESRKRELSSALHVYFKDWLYASGN  556

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  557  IRQLYCLQGD  566



>gb|KHN07410.1| TBCC domain-containing protein 1 [Glycine soja]
Length=566

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LPDAYMASQHKN KNL EI+Q+LRE  LE+SRKREL+SALHV FKDWLYASGN
Sbjct  497  TKGNPFMLPDAYMASQHKNQKNLGEIRQLLREAPLEESRKRELSSALHVYFKDWLYASGN  556

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  557  IRQLYCLQGD  566



>emb|CDY06066.1| BnaA09g37140D [Brassica napus]
Length=136

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  67   TKDNPFPLPDPYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFKDWLYASGN  126

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  127  IRQLYCLQGD  136



>gb|KHN26369.1| TBCC domain-containing protein 1 [Glycine soja]
Length=551

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LPDAYM SQHKN KNL EI+ +LRE  LEDSRKREL+SALHV FKDWLYASGN
Sbjct  482  TKGNPFTLPDAYMVSQHKNQKNLGEIRHLLREAPLEDSRKRELSSALHVYFKDWLYASGN  541

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  542  IRQLYCLQGD  551



>ref|XP_003554198.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Glycine 
max]
Length=566

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LPDAYM SQHKN KNL EI+ +LRE  LEDSRKREL+SALHV FKDWLYASGN
Sbjct  497  TKGNPFTLPDAYMVSQHKNQKNLGEIRHLLREAPLEDSRKRELSSALHVYFKDWLYASGN  556

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  557  IRQLYCLQGD  566



>gb|KCW48078.1| hypothetical protein EUGRSUZ_K01823 [Eucalyptus grandis]
Length=397

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPFPLPDAYM SQ +NHK+L EIKQ+LRE  LE++RKREL+SALHV FKDWLYASGN
Sbjct  328  TEGNPFPLPDAYMTSQQRNHKSLGEIKQMLREVPLEENRKRELSSALHVYFKDWLYASGN  387

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  388  IRQLYCLQGD  397



>gb|AFK40546.1| unknown [Lotus japonicus]
Length=116

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  709  KDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNI  530
            K+NPF LPD Y+ASQH+N KNL EI+++L+E+ LE+SRKRE +SALHV FKDWLYASGNI
Sbjct  48   KNNPFTLPDVYVASQHRNQKNLGEIRKLLQESSLEESRKREFSSALHVYFKDWLYASGNI  107

Query  529  RQLYCLQGE  503
            RQLYCLQG+
Sbjct  108  RQLYCLQGD  116



>ref|XP_010038901.1| PREDICTED: TBCC domain-containing protein 1 [Eucalyptus grandis]
Length=523

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPFPLPDAYM SQ +NHK+L EIKQ+LRE  LE++RKREL+SALHV FKDWLYASGN
Sbjct  454  TEGNPFPLPDAYMTSQQRNHKSLGEIKQMLREVPLEENRKRELSSALHVYFKDWLYASGN  513

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  514  IRQLYCLQGD  523



>ref|XP_002532335.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30037.1| conserved hypothetical protein [Ricinus communis]
Length=572

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AYM+SQ +N KNL EIKQ+LRE  LE++RKREL+ ALH+LFKDWLYASGN
Sbjct  503  TKDNPFPLPEAYMSSQERNQKNLGEIKQLLREAPLEENRKRELSCALHLLFKDWLYASGN  562

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  563  IRQLYCLQGD  572



>gb|KJB15036.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=567

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYM SQ +N KNL EIKQ+LRE  LE++ KREL+SALHV FKDWLYASGN
Sbjct  498  TKDNPFPLPDAYMTSQQRNQKNLSEIKQMLREAPLEENWKRELSSALHVYFKDWLYASGN  557

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  558  IRQLYCLQGD  567



>ref|XP_011078850.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=573

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+ASQ K  K+L E+KQ+L++T+LE+SRKR+L+SALH  FKDWLYASGN
Sbjct  504  TKDNPFPLPDAYLASQQKKTKSLGEVKQVLKDTQLEESRKRQLSSALHACFKDWLYASGN  563

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  564  IRQLYCLQGE  573



>ref|XP_007028946.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 ref|XP_007028947.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09448.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09449.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
Length=567

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD Y+ SQ +N KNL EIKQILRE  LE++RKREL+ ALHV FKDWLYASGN
Sbjct  498  TKDNPFPLPDTYLTSQQRNQKNLGEIKQILREAPLEENRKRELSCALHVYFKDWLYASGN  557

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  558  IRQLYCLQGD  567



>ref|XP_009369843.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=564

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMASQH+N+ NL E+KQ+L+E  LE++RKREL++ALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDAYMASQHRNN-NLGEVKQLLKEAPLEENRKRELSTALHVYFKDWLYASGN  554

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  555  IRQLYCLQGE  564



>gb|KJB16388.1| hypothetical protein B456_002G228100 [Gossypium raimondii]
Length=572

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+ SQ +N KNL EIKQILRE  LE++RKREL+ ALHV FKDWLYASGN
Sbjct  503  TKDNPFPLPDAYLKSQLRNQKNLSEIKQILREAPLEENRKRELSCALHVYFKDWLYASGN  562

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  563  IRQLYCLQGD  572



>ref|XP_009629812.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=570

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+ASQ +NHKNL E K++L++TEL+++RKRE+A+ALH  FKDWLYASGN
Sbjct  501  TKDNPFPLPDAYLASQQRNHKNLEENKRMLKDTELDETRKREVATALHACFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>gb|KDP24597.1| hypothetical protein JCGZ_25513 [Jatropha curcas]
Length=568

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AY++SQ +N KNL EIKQ+LRE  LE++RKREL+ ALH+LFKDWLYASGN
Sbjct  499  TKDNPFPLPEAYLSSQQRNQKNLGEIKQLLREAPLEENRKRELSCALHLLFKDWLYASGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  559  IRQLYCLQGD  568



>ref|XP_010672700.1| PREDICTED: TBCC domain-containing protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=568

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AYMASQHKN+ NL E+KQ+L+ET L++S+KREL+ ALHVLFKDWLYASGN
Sbjct  499  TKDNPFSLPEAYMASQHKNNTNLGEVKQVLQETPLDESKKRELSCALHVLFKDWLYASGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCL G+
Sbjct  559  IRQLYCLHGD  568



>ref|XP_008240958.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Prunus 
mume]
Length=565

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD Y+ASQ +N  NL E+KQ+LRE  LE++RKREL++ALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDIYVASQQRNQNNLGEVKQLLREAPLEENRKRELSTALHVYFKDWLYASGN  555

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  556  IRQLYCLQGE  565



>gb|EYU39914.1| hypothetical protein MIMGU_mgv1a003654mg [Erythranthe guttata]
Length=571

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LPD Y+ASQ KNHKNL E+KQILRET+LE+SRKREL+ ALH  FKDWLYASGN
Sbjct  503  TKDNPFTLPDPYLASQQKNHKNLEEVKQILRETQLEESRKRELSGALHACFKDWLYASGN  562

Query  532  IRQLYCL  512
            +RQLYCL
Sbjct  563  VRQLYCL  569



>ref|XP_004304384.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=569

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AY+ SQ +N KNL E+KQ+LRE  LED++KREL++ALHV FKDWLYASGN
Sbjct  500  TKDNPFPLPEAYVESQERNQKNLGEVKQLLREAPLEDNKKRELSTALHVYFKDWLYASGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  560  IRQLYCLQGE  569



>ref|XP_009376106.1| PREDICTED: TBCC domain-containing protein 1-like [Pyrus x bretschneideri]
Length=564

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 1/70 (1%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYM SQH+N+ NL E+KQ+L+E  LE++RKREL++ALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDAYMVSQHRNN-NLGEVKQLLKEAPLEENRKRELSTALHVYFKDWLYASGN  554

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  555  IRQLYCLQGE  564



>emb|CDX98257.1| BnaC06g16180D [Brassica napus]
Length=590

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  521  TKDNPFPLPDAYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFKDWLYASGN  580

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  581  IRQLYCLQGD  590



>ref|XP_002323291.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|EEF05052.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=571

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AYMASQ +N KNL EIKQ+LRE  LE+++KREL+SALH+LFKDWLYASGN
Sbjct  502  TKDNPFQLPEAYMASQQRNQKNLGEIKQLLREVPLEENQKRELSSALHLLFKDWLYASGN  561

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  562  IRQLYCLQGD  571



>emb|CDX67713.1| BnaA07g17530D [Brassica napus]
Length=598

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  529  TKDNPFPLPDAYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFKDWLYASGN  588

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  589  IRQLYCLQGD  598



>ref|XP_009772589.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=568

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+ASQ +NHK+L E K++L++TEL+++RKRE+A+ALH  FKDWLYASGN
Sbjct  499  TKDNPFPLPDAYLASQQRNHKHLEENKRMLKDTELDETRKREVATALHACFKDWLYASGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  559  IRQLYCLQGD  568



>ref|XP_009104081.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Brassica rapa]
Length=554

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AYMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  485  TKDNPFPLPEAYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFKDWLYASGN  544

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  545  IRQLYCLQGD  554



>ref|XP_011033250.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=569

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AY+ASQ +N KNL EIKQ+LRE  LE+++KREL+SALH+LFKDWLYASGN
Sbjct  500  TKDNPFQLPEAYIASQQRNQKNLGEIKQLLREVPLEENQKRELSSALHLLFKDWLYASGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  560  IRQLYCLQGD  569



>ref|XP_010265832.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=520

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ YMASQ KN +NL EIKQ LRE +LE+SRKREL+SALHV FKDWLY SGN
Sbjct  451  TKHNPFPLPEVYMASQQKNLQNLGEIKQSLRELQLEESRKRELSSALHVYFKDWLYTSGN  510

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  511  IRQLYCLQGD  520



>ref|XP_010265831.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=567

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ YMASQ KN +NL EIKQ LRE +LE+SRKREL+SALHV FKDWLY SGN
Sbjct  498  TKHNPFPLPEVYMASQQKNLQNLGEIKQSLRELQLEESRKRELSSALHVYFKDWLYTSGN  557

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  558  IRQLYCLQGD  567



>ref|XP_004249279.1| PREDICTED: TBCC domain-containing protein 1 [Solanum lycopersicum]
Length=569

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AYMASQ +N KNL E K  L++ +L++SRKRE+A+ALHV FKDWLYASGN
Sbjct  500  TKDNPFPLPEAYMASQQRNLKNLEETKSSLKDIDLDESRKREVAAALHVCFKDWLYASGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  560  IRQLYCLQGE  569



>ref|XP_007162298.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
 gb|ESW34292.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
Length=566

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LPDAYMASQ+KN KNL EI+Q+LRE  LE+SRKREL+SALHV F+DWLYASGN
Sbjct  497  TKSNPFTLPDAYMASQNKNQKNLGEIRQLLREAPLEESRKRELSSALHVYFRDWLYASGN  556

Query  532  IRQLYCLQGE  503
            IRQLY LQG+
Sbjct  557  IRQLYFLQGD  566



>ref|XP_004493562.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=555

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AYMASQ KN KNL EI+Q+LRE  LE+SRK+EL+SALHV FKDWLYASGN
Sbjct  486  TKDNPFTLPEAYMASQQKNEKNLGEIRQLLREAPLEESRKKELSSALHVYFKDWLYASGN  545

Query  532  IRQLYCLQGE  503
            IRQLY LQG+
Sbjct  546  IRQLYYLQGD  555



>emb|CDY06067.1| BnaA09g37130D [Brassica napus]
Length=513

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  444  TKDNPFPLPDPYMAAQQRNLKNLEETRRSLRETPLEENRKKELSSALHVYFKDWLYASGN  503

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  504  IRQLYCLQGD  513



>ref|XP_006402830.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
 gb|ESQ44283.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
Length=573

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N K+L E ++ LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  504  TKDNPFPLPDAYMAAQQRNLKSLEETRRSLRETPLEENRKKELSSALHVYFKDWLYASGN  563

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  564  IRQLYCLQGD  573



>ref|XP_011020269.1| PREDICTED: TBCC domain-containing protein 1 isoform X3 [Populus 
euphratica]
Length=577

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFKDWLYASGN
Sbjct  508  TKDNPFQLPEAYMASQQRNQKNLAETKKLLREAPLEENQKRELSSALHLLFKDWLYASGN  567

Query  532  IRQLYCLQGE  503
            +RQLYCLQG+
Sbjct  568  VRQLYCLQGD  577



>ref|XP_004146385.1| PREDICTED: TBCC domain-containing protein 1-like [Cucumis sativus]
Length=570

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLPDAY+AS  +N K L E+KQILRET LE++RKREL+SALHV FKDWLYASGN
Sbjct  501  TDCNPFPLPDAYLASLERNKKTLGEVKQILRETPLEENRKRELSSALHVYFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>ref|XP_011020268.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=579

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFKDWLYASGN
Sbjct  510  TKDNPFQLPEAYMASQQRNQKNLAETKKLLREAPLEENQKRELSSALHLLFKDWLYASGN  569

Query  532  IRQLYCLQGE  503
            +RQLYCLQG+
Sbjct  570  VRQLYCLQGD  579



>ref|XP_011020267.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=581

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFKDWLYASGN
Sbjct  512  TKDNPFQLPEAYMASQQRNQKNLAETKKLLREAPLEENQKRELSSALHLLFKDWLYASGN  571

Query  532  IRQLYCLQGE  503
            +RQLYCLQG+
Sbjct  572  VRQLYCLQGD  581



>ref|XP_004156008.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis sativus]
Length=570

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLPDAY+AS  +N K L E+KQILRET LE++RKREL+SALHV FKDWLYASGN
Sbjct  501  TDCNPFPLPDAYLASLERNKKTLGEVKQILRETPLEENRKRELSSALHVYFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>ref|XP_009139004.1| PREDICTED: TBCC domain-containing protein 1-like [Brassica rapa]
Length=569

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  500  TKDNPFPLPDPYMAAQQRNLKNLDETRRSLRETPLEENRKKELSSALHVYFKDWLYASGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  560  IRQLYCLQGD  569



>emb|CDX71986.1| BnaC08g28880D [Brassica napus]
Length=565

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDPYMAAQQRNLKNLEETRRSLRETPLEENRKKELSSALHVYFKDWLYASGN  555

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  556  IRQLYCLQGD  565



>ref|XP_008442093.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis melo]
Length=570

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLPDAY+AS  +N K L E+KQILRET LE++RKREL+SALHV FKDWLYASGN
Sbjct  501  TDCNPFPLPDAYLASLERNKKTLGEVKQILRETPLEENRKRELSSALHVYFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>ref|XP_007203759.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
 gb|EMJ04958.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
Length=564

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD Y+ASQ +N+ NL E+KQ+LRE  LE++RKREL++ALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDIYVASQQRNN-NLGEVKQLLREAPLEENRKRELSTALHVYFKDWLYASGN  554

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  555  IRQLYCLQGE  564



>ref|XP_008240959.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Prunus 
mume]
Length=564

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD Y+ASQ +N+ NL E+KQ+LRE  LE++RKREL++ALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDIYVASQQRNN-NLGEVKQLLREAPLEENRKRELSTALHVYFKDWLYASGN  554

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  555  IRQLYCLQGE  564



>emb|CDY61748.1| BnaA04g27540D [Brassica napus]
Length=595

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  526  TKDNPFPLPDPYMAAQQRNLKNLDETRRSLRETPLEENRKKELSSALHVYFKDWLYASGN  585

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  586  IRQLYCLQGD  595



>ref|XP_009629687.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=572

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK+NPFPLPDAYMASQ +  KNL EIKQ LRE ELE+SRK+EL +ALH  FKDWLYASGN
Sbjct  503  TKNNPFPLPDAYMASQQRRQKNLEEIKQSLREAELEESRKKELTTALHQCFKDWLYASGN  562

Query  532  IRQLYCLQGE  503
            IRQLYCLQ +
Sbjct  563  IRQLYCLQND  572



>emb|CDY47657.1| BnaC04g23940D [Brassica napus]
Length=648

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  579  TKDNPFPLPDTYMAAQQRNLKNLDETRRSLRETPLEENRKKELSSALHVYFKDWLYASGN  638

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  639  IRQLYCLQGD  648



>ref|XP_011468069.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AY+ SQ +N KNL E+KQ+LRE  LED++KREL++ALHV FKDWLYASGN
Sbjct  500  TKDNPFPLPEAYVESQERN-KNLGEVKQLLREAPLEDNKKRELSTALHVYFKDWLYASGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  559  IRQLYCLQGE  568



>ref|XP_006351339.1| PREDICTED: TBCC domain-containing protein 1-like [Solanum tuberosum]
Length=569

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AY+ASQ +N KNL E K  L++ +L++SRKRE+A+ALHV FKDWLYASGN
Sbjct  500  TKDNPFPLPEAYLASQQRNLKNLEETKNSLKDIDLDESRKREVATALHVCFKDWLYASGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  560  IRQLYCLQGE  569



>ref|XP_008392091.1| PREDICTED: TBCC domain-containing protein 1 [Malus domestica]
Length=564

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYM SQ +N+ NL E+KQ+L E  LE++RKREL++ALHV FKDWLYASGN
Sbjct  496  TKDNPFPLPDAYMVSQXRNN-NLGEVKQLLXEAPLEENRKRELSTALHVYFKDWLYASGN  554

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  555  IRQLYCLQGE  564



>ref|XP_009797552.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=572

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK+NPFPLPDAYMASQ +  KNL EIKQ LRE +LE+SRK+EL +ALH  FKDWLYASGN
Sbjct  503  TKNNPFPLPDAYMASQQRRQKNLEEIKQNLREADLEESRKKELTTALHQCFKDWLYASGN  562

Query  532  IRQLYCLQGE  503
            IRQLYCLQ E
Sbjct  563  IRQLYCLQNE  572



>ref|XP_006381055.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|ERP58852.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=585

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFKDWLYASGN
Sbjct  516  TKDNPFQLPEAYMASQQRNQKNLGETKKLLREAPLEENQKRELSSALHLLFKDWLYASGN  575

Query  532  IRQLYCLQGE  503
            +RQLYCLQG+
Sbjct  576  VRQLYCLQGD  585



>emb|CAB67617.1| putative protein [Arabidopsis thaliana]
Length=570

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FKDWLYASGN
Sbjct  501  TKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>ref|XP_006290821.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 ref|XP_006290822.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23719.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23720.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
Length=573

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FKDWLYASGN
Sbjct  504  TKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFKDWLYASGN  563

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  564  IRQLYCLQGD  573



>ref|NP_567059.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK96632.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AAL36073.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AEE79713.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=573

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FKDWLYASGN
Sbjct  504  TKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFKDWLYASGN  563

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  564  IRQLYCLQGD  573



>ref|XP_009116487.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=570

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KNL E ++ LR+T LE++RK+EL+SALHV FKDWLYASGN
Sbjct  501  TKDNPFPLPDPYMAAQQRNLKNLEETRRALRKTPLEENRKKELSSALHVYFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>ref|XP_003625224.1| TBCC domain-containing protein [Medicago truncatula]
 gb|ABN08645.1| Tubulin binding cofactor C [Medicago truncatula]
 gb|AES81442.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=558

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+ YMASQ +N +NL EI+Q+LRE  LE+SRKREL+SALHV FKDWLYASGN
Sbjct  489  TKDNPFTLPEGYMASQQRNERNLGEIRQLLREAPLEESRKRELSSALHVYFKDWLYASGN  548

Query  532  IRQLYCLQGE  503
            IRQLY LQG+
Sbjct  549  IRQLYYLQGD  558



>ref|XP_010257397.1| PREDICTED: TBCC domain-containing protein 1-like [Nelumbo nucifera]
Length=575

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ YMASQ KNH+NL EIKQ LR+ +LE+SRKREL++ALH+ FKDWLY SGN
Sbjct  506  TKHNPFSLPETYMASQQKNHQNLGEIKQALRDLQLEESRKRELSNALHIYFKDWLYTSGN  565

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  566  IRQLYCLQGD  575



>ref|XP_010524365.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=569

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KNL E +Q LR   LE++RKREL+SALH+ FKDWLYA+GN
Sbjct  500  TKDNPFPLPDAYMATQQRNLKNLEETRQSLRGAPLEENRKRELSSALHLYFKDWLYATGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  560  IRQLYCLQGD  569



>gb|EPS74445.1| hypothetical protein M569_00304, partial [Genlisea aurea]
Length=572

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+DNPF LPDAY+ SQ KN KNL E+KQILRET+L++++KREL+SALH  FKDWLYASGN
Sbjct  504  TEDNPFRLPDAYLVSQQKNLKNLAEVKQILRETQLDEAKKRELSSALHASFKDWLYASGN  563

Query  532  IRQLYCLQG  506
            +RQLYCL G
Sbjct  564  VRQLYCLHG  572



>ref|NP_001190120.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79714.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=609

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FKDWLYASGN
Sbjct  540  TKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFKDWLYASGN  599

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  600  IRQLYCLQGD  609



>gb|KJB82781.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=397

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FKDWLYASGN
Sbjct  328  TRNNPFPLPDPYFTSQQRNQKNLGEIQQILREAPLEENRKRELSCALHVYFKDWLYASGN  387

Query  532  IRQLYCLQGE  503
            IRQLYCL G+
Sbjct  388  IRQLYCLLGD  397



>gb|KEH41654.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=553

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LPDAY ASQHKN  NL E+++++ E  LE+SRKREL+S LHV FKDWLYASGN
Sbjct  484  TKDNPFALPDAYAASQHKNQNNLEEVRKLIHEASLEESRKRELSSVLHVYFKDWLYASGN  543

Query  532  IRQLYCLQGE  503
            IRQLYCLQ +
Sbjct  544  IRQLYCLQAD  553



>ref|XP_010427682.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=575

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKRE++SALHV FKDWLYASGN
Sbjct  506  TKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKREVSSALHVYFKDWLYASGN  565

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  566  IRQLYCLQGD  575



>ref|XP_010507501.1| PREDICTED: uncharacterized protein LOC104784134 [Camelina sativa]
Length=512

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA+Q +N KN  E ++ L E  LE++RKRE++SALHV FKDWLYASGN
Sbjct  443  TKDNPFPLPDAYMAAQQRNLKNFEETRRSLNEAPLEENRKREVSSALHVYFKDWLYASGN  502

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  503  IRQLYCLQGD  512



>gb|KFK35082.1| hypothetical protein AALP_AA5G233000 [Arabis alpina]
Length=576

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KN  E ++ L+ET LE++RK+EL+SALHV FKDWLYASGN
Sbjct  507  TKDNPFPLPDPYMAAQQRNLKNFEETRRSLKETPLEENRKKELSSALHVYFKDWLYASGN  566

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  567  IRQLYCLQGD  576



>gb|KJB82780.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=534

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FKDWLYASGN
Sbjct  465  TRNNPFPLPDPYFTSQQRNQKNLGEIQQILREAPLEENRKRELSCALHVYFKDWLYASGN  524

Query  532  IRQLYCLQGE  503
            IRQLYCL G+
Sbjct  525  IRQLYCLLGD  534



>ref|XP_002876443.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52702.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPD YMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FKDWLYASGN
Sbjct  502  TKDNPFPLPDTYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFKDWLYASGN  561

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  562  IRQLYCLQGD  571



>emb|CDY53502.1| BnaC04g02540D [Brassica napus]
Length=599

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA Q  + KNL E +Q LRET LED+RKREL +A H+ FKDWLYA+GN
Sbjct  530  TKDNPFPLPDAYMAVQQTSLKNLEETRQSLRETPLEDNRKRELTTAFHMHFKDWLYATGN  589

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  590  IRQLYCLQGD  599



>gb|KJB82776.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
 gb|KJB82779.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=569

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FKDWLYASGN
Sbjct  500  TRNNPFPLPDPYFTSQQRNQKNLGEIQQILREAPLEENRKRELSCALHVYFKDWLYASGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCL G+
Sbjct  560  IRQLYCLLGD  569



>ref|XP_010548390.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=577

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY  +Q +N KNL E KQ LRE  LE++RKREL+ ALHV FKDWLYA+GN
Sbjct  508  TKDNPFPLPDAYTVAQQRNLKNLEETKQSLREAPLEENRKRELSGALHVHFKDWLYATGN  567

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  568  IRQLYCLQGD  577



>gb|KDO57721.1| hypothetical protein CISIN_1g0403992mg, partial [Citrus sinensis]
Length=219

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLPDAY+A+Q +  K+ VEIK++++E  L+DSRKRE++SALHV F+DWLYA+GN
Sbjct  150  TKANPFPLPDAYVAAQQRKQKSWVEIKKLIKEAPLDDSRKREVSSALHVYFRDWLYATGN  209

Query  532  IRQLYCLQGE  503
            IRQLYCLQ +
Sbjct  210  IRQLYCLQND  219



>gb|AGJ83863.1| tublin binding cofactor C [Gossypium hirsutum]
Length=570

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FKDWLYASGN
Sbjct  501  TRNNPFPLPDLYFTSQQRNKKNLGEIQQILREAPLEENRKRELSCALHVYFKDWLYASGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCL G+
Sbjct  561  IRQLYCLLGD  570



>ref|NP_973669.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AAU05480.1| At2g42230 [Arabidopsis thaliana]
 gb|AAU95425.1| At2g42230 [Arabidopsis thaliana]
 dbj|BAE98485.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10091.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=568

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  499  TKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHMYFKDWLYATGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  559  IRQLYCLQGD  568



>gb|KHG16745.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=569

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALH+ FKDWLYASGN
Sbjct  500  TRNNPFPLPDLYFTSQQRNKKNLGEIQQILREAPLEENRKRELSCALHIYFKDWLYASGN  559

Query  532  IRQLYCLQGE  503
            IRQLYCL G+
Sbjct  560  IRQLYCLLGD  569



>ref|XP_006411483.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
 gb|ESQ52936.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
Length=572

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYMA Q  N K L E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  503  TKDNPFPLPDAYMAVQQTNLKKLEETRQSLRETPLEENRKRELTTAFHMHFKDWLYATGN  562

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  563  IRQLYCLQGD  572



>ref|XP_010508603.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=565

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  496  TKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELITAFHMHFKDWLYATGN  555

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  556  IRQLYCLQGD  565



>ref|XP_010517737.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=572

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  503  TKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELITAFHMHFKDWLYATGN  562

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  563  IRQLYCLQGD  572



>ref|XP_010506033.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=568

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  499  TKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELITAFHMHFKDWLYATGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  559  IRQLYCLQGD  568



>ref|XP_006342320.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=567

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDA++AS+ +NHKNL  +KQIL+E +LE+SRK+EL +ALH  FKDWLYASGN
Sbjct  498  TKDNPFPLPDAFLASKQRNHKNLEGLKQILQEADLEESRKKELTTALHGCFKDWLYASGN  557

Query  532  IRQLYCLQGE  503
            IRQLY LQ +
Sbjct  558  IRQLYFLQND  567



>ref|XP_009142814.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=569

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+A Q  + KNL E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  500  TKDNPFPLPDAYLAVQQSSLKNLEETRQSLRETPLEENRKRELTTAFHMHFKDWLYATGN  559

Query  532  IRQLYCLQGE  503
            +RQLYCLQG+
Sbjct  560  VRQLYCLQGD  569



>emb|CDX79886.1| BnaA05g02700D [Brassica napus]
Length=582

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAY+A Q  + KNL E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  513  TKDNPFPLPDAYLAVQQSSLKNLEETRQSLRETPLEENRKRELTTAFHMHFKDWLYATGN  572

Query  532  IRQLYCLQGE  503
            +RQLYCLQG+
Sbjct  573  VRQLYCLQGD  582



>ref|XP_006293916.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
 gb|EOA26814.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
Length=570

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+AY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLYA+GN
Sbjct  501  TKDNPFPLPNAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHIHFKDWLYATGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>ref|XP_010516427.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010516428.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=612

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LPDAYMA+Q +N KN  E ++ L E  LE++RKRE++SALHV FKDWLYASGN
Sbjct  543  TKDNPFQLPDAYMAAQQRNLKNFEETRRSLNEAPLEENRKREVSSALHVYFKDWLYASGN  602

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  603  IRQLYCLQGD  612



>ref|XP_004497930.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=561

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LPDAY ASQ +N K+L E++Q+++E  LE++RKRE +S LHV FKDWL+ASGN
Sbjct  492  TKDNPFALPDAYAASQLRNQKSLGELRQLIQEASLEENRKREFSSVLHVHFKDWLHASGN  551

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  552  IRQLYCLQGE  561



>ref|XP_006485027.1| PREDICTED: TBCC domain-containing protein 1-like [Citrus sinensis]
Length=568

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLPDAY+A+Q +  K+ VEIK++++E  L+D+RKRE++SALHV F+DWLYA+GN
Sbjct  499  TKANPFPLPDAYVAAQQRKQKSWVEIKKLIKEAPLDDNRKREVSSALHVYFRDWLYATGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQ +
Sbjct  559  IRQLYCLQND  568



>ref|XP_006437044.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
 gb|ESR50284.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
Length=568

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLPDAY+A+Q +  K+ VEIK++++E  L+D+RKRE++SALHV F+DWLYA+GN
Sbjct  499  TKANPFPLPDAYVAAQQRKQKSWVEIKKLIKEAPLDDNRKREVSSALHVYFRDWLYATGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQ +
Sbjct  559  IRQLYCLQND  568



>gb|KJB36107.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
 gb|KJB36109.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=347

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+DWLYASGN
Sbjct  278  TKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFRDWLYASGN  337

Query  532  IRQLYCLQGE  503
            IRQLYC Q +
Sbjct  338  IRQLYCQQSD  347



>gb|KJB36111.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=377

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+DWLYASGN
Sbjct  308  TKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFRDWLYASGN  367

Query  532  IRQLYCLQGE  503
            IRQLYC Q +
Sbjct  368  IRQLYCQQSD  377



>ref|XP_008778358.1| PREDICTED: TBCC domain-containing protein 1-like, partial [Phoenix 
dactylifera]
Length=374

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRE+A ALHV FKDWLYASGN
Sbjct  305  TKYNPFPLPEIYKASEKKNNSIVCDIQQAIRDAQLEESRKREMACALHVHFKDWLYASGN  364

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  365  IRQLYCLQGD  374



>gb|KJB36108.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=398

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+DWLYASGN
Sbjct  329  TKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFRDWLYASGN  388

Query  532  IRQLYCLQGE  503
            IRQLYC Q +
Sbjct  389  IRQLYCQQSD  398



>ref|XP_009411800.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLP+ Y ASQ K + NL++I+Q +R   L+++R+REL SALHV FKDWLYASGN
Sbjct  512  TKDNPFPLPEIYGASQQKKNSNLIDIQQAIRNVHLDENRERELTSALHVHFKDWLYASGN  571

Query  532  IRQLYCLQGE  503
            IRQLYCLQ +
Sbjct  572  IRQLYCLQAD  581



>ref|XP_010928451.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRELA ALHV FKDWLYASGN
Sbjct  488  TKYNPFPLPEIYKASEKKNNSVVCDIQQAIRDAQLEESRKRELACALHVHFKDWLYASGN  547

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  548  IRQLYCLQGD  557



>gb|KJB36105.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=555

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+DWLYASGN
Sbjct  486  TKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFRDWLYASGN  545

Query  532  IRQLYCLQGE  503
            IRQLYC Q +
Sbjct  546  IRQLYCQQSD  555



>gb|AFW66197.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
 gb|AFW66198.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=136

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLP+ Y  SQ K    L +I++++RE +L+++RKRELA+ALHV FKDWLYASGN
Sbjct  67   TNRNPFPLPEIYGTSQSKKRSALEDIQKMIRELQLDENRKRELATALHVQFKDWLYASGN  126

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  127  IRQLYCLQGD  136



>ref|XP_010928450.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Elaeis 
guineensis]
Length=592

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRELA ALHV FKDWLYASGN
Sbjct  523  TKYNPFPLPEIYKASEKKNNSVVCDIQQAIRDAQLEESRKRELACALHVHFKDWLYASGN  582

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  583  IRQLYCLQGD  592



>ref|XP_009391882.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y ASQ K H NL ++++ +R+ +L+++RKRELASALHV F+DWLYASGN
Sbjct  512  TKYNPFPLPEIYRASQKKKHSNLTDVQEAIRDVQLDENRKRELASALHVHFRDWLYASGN  571

Query  532  IRQLYCLQGE  503
            IRQLYCLQ +
Sbjct  572  IRQLYCLQSD  581



>gb|KJB36106.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=606

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+DWLYASGN
Sbjct  537  TKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFRDWLYASGN  596

Query  532  IRQLYCLQGE  503
            IRQLYC Q +
Sbjct  597  IRQLYCQQSD  606



>ref|XP_008795746.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1 [Phoenix dactylifera]
Length=577

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRE+A ALHV FKDWLYASGN
Sbjct  508  TKYNPFPLPEIYKASEKKNNSIVCDIQQAIRDAQLEESRKREMACALHVHFKDWLYASGN  567

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  568  IRQLYCLQGD  577



>ref|NP_001058077.1| Os06g0614300 [Oryza sativa Japonica Group]
 dbj|BAD35569.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAD35914.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAF19991.1| Os06g0614300 [Oryza sativa Japonica Group]
Length=581

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ Y ASQ K H +L +I++ +RE EL+D+RK+ELASALH  FKDWLYASGN
Sbjct  512  TKYNPFTLPEVYWASQRKKHVSLEDIQKNIRELELDDTRKKELASALHAQFKDWLYASGN  571

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  572  IRQLYCLQGE  581



>gb|EEE66013.1| hypothetical protein OsJ_21970 [Oryza sativa Japonica Group]
Length=581

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ Y ASQ K H +L +I++ +RE EL+D+RK+ELASALH  FKDWLYASGN
Sbjct  512  TKYNPFTLPEVYWASQRKKHVSLEDIQKNIRELELDDTRKKELASALHAQFKDWLYASGN  571

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  572  IRQLYCLQGE  581



>gb|EEC80975.1| hypothetical protein OsI_23703 [Oryza sativa Indica Group]
Length=568

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ Y ASQ K H +L +I++ +RE EL+D+RK+ELASALH  FKDWLYASGN
Sbjct  499  TKYNPFTLPEVYWASQRKKHVSLEDIQKNIRELELDDTRKKELASALHAQFKDWLYASGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  559  IRQLYCLQGE  568



>ref|XP_010943570.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=579

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+ RKRELA ALH  F+DWLYASGN
Sbjct  510  TKCNPFPLPEIYKASEKKNNSIMCDIQQAIRDAQLEEGRKRELACALHAHFRDWLYASGN  569

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  570  IRQLYCLQGD  579



>ref|XP_004965884.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=583

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ Y ASQ K H +L +I++ +RE E++D+RK+ELA ALH  FKDWLYASGN
Sbjct  514  TKYNPFTLPEVYWASQRKKHASLEDIQKNIRELEIDDNRKKELACALHAQFKDWLYASGN  573

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  574  IRQLYCLQGE  583



>ref|XP_006657134.1| PREDICTED: TBCC domain-containing protein 1-like, partial [Oryza 
brachyantha]
Length=481

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPF LP+ Y ASQ K H +L +I++ +RE +L+D+RK+ELASALH  FKDWLYASGN
Sbjct  412  TNYNPFTLPEIYWASQRKKHVSLEDIQKNIRELKLDDNRKKELASALHAQFKDWLYASGN  471

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  472  IRQLYCLQGE  481



>ref|NP_001168301.1| hypothetical protein [Zea mays]
 gb|ACN27744.1| unknown [Zea mays]
 gb|ACN28930.1| unknown [Zea mays]
 gb|AFW76296.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=574

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ Y ASQ K H +L +I++ +RE E++D RK+ELA ALH  FKDWLYASGN
Sbjct  505  TKYNPFTLPEVYWASQRKKHASLEDIQKNIRELEIDDIRKKELACALHAQFKDWLYASGN  564

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  565  IRQLYCLQGE  574



>ref|XP_008800652.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=577

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y AS+ KN+  + +I++ + + +LE+SRKRELA ALH  FKDWLYASGN
Sbjct  508  TKCNPFPLPEIYKASEKKNNSIMCDIQRAISDAQLEESRKRELACALHAHFKDWLYASGN  567

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  568  IRQLYCLQGD  577



>gb|ACN28202.1| unknown [Zea mays]
 gb|AFW66195.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=579

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLP+ Y  SQ K    L +I++++RE +L+++RKRELA+ALHV FKDWLYASGN
Sbjct  510  TNRNPFPLPEIYGTSQSKKRSALEDIQKMIRELQLDENRKRELATALHVQFKDWLYASGN  569

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  570  IRQLYCLQGD  579



>dbj|BAJ90629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ Y ASQ K + +L +I++ +RE EL+D+RK+ELA ALH  FKDWLYASGN
Sbjct  519  TKYNPFTLPEVYWASQRKKNASLEDIQKSIRELELDDNRKKELACALHSQFKDWLYASGN  578

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  579  IRQLYCLQGE  588



>ref|XP_004951581.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=578

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLP+ Y A Q K H  L +I++ +RE +L+++RKR+LA+ALH  FKDWLYASGN
Sbjct  509  TTCNPFPLPEIYGACQSKKHSALEDIQKTIRELQLDENRKRDLATALHAQFKDWLYASGN  568

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  569  IRQLYCLQGD  578



>ref|XP_003563624.1| PREDICTED: TBCC domain-containing protein 1-like [Brachypodium 
distachyon]
Length=583

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPF LP+ Y ASQ K + +L +I++ +RE EL+D+RK+ELA ALH  FKDWLYASGN
Sbjct  514  TKYNPFTLPEVYWASQTKKNASLEDIQKNIRELELDDNRKKELACALHSQFKDWLYASGN  573

Query  532  IRQLYCLQGE  503
            IRQLYCLQGE
Sbjct  574  IRQLYCLQGE  583



>dbj|BAJ93674.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y ASQ+K    L + K+I+RE +L+++R +ELASALH  FKDWLYA+GN
Sbjct  501  TKCNPFPLPEIYQASQNKKQAVLEDTKKIIRELQLDENRNKELASALHSQFKDWLYATGN  560

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  561  IRQLYCLQGD  570



>gb|AFK39829.1| unknown [Medicago truncatula]
Length=58

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  676  MASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQLYCLQGE  503
            MASQ +N +NL EI+Q+LRE  LE+SRKREL+ ALHV FKDWLYASGNIRQLY LQG+
Sbjct  1    MASQQRNERNLGEIRQLLREAPLEESRKRELSFALHVYFKDWLYASGNIRQLYYLQGD  58



>gb|ABR16182.1| unknown [Picea sitchensis]
Length=609

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+ YMA+Q + + +L +++  LR T+L+D++KRELASA+H  FKDWLYASGN
Sbjct  532  TKDNPFILPNPYMAAQQQKYTSLEDMRASLRNTQLDDTKKRELASAIHGHFKDWLYASGN  591

Query  532  IRQLYCLQ  509
            IRQLYCLQ
Sbjct  592  IRQLYCLQ  599



>ref|XP_002453473.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
 gb|EES06449.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
Length=582

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELASALH  FKDWLYASGN
Sbjct  513  TNCNPFPLPEIYGAFQSKKRSALEDIQKMIRELQLDENRKRELASALHAQFKDWLYASGN  572

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  573  IRQLYCLQGD  582



>ref|XP_003571239.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=568

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK NPFPLP+ Y ASQ K H  L + ++ +RE +++++RK+ELA+ALH  FKDWLYA+GN
Sbjct  499  TKCNPFPLPELYQASQIKKHAVLEDTQKTIRELQIDENRKKELANALHAQFKDWLYATGN  558

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  559  IRQLYCLQGD  568



>ref|XP_008643390.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=566

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  703  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  524
            NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELA+ALH  FKDWLYASGNIRQ
Sbjct  500  NPFPLPEIYEAFQSKKRSALEDIQKMIRELQLDENRKRELAAALHAQFKDWLYASGNIRQ  559

Query  523  LYCLQGE  503
            LYCLQG+
Sbjct  560  LYCLQGD  566



>ref|NP_001144767.1| hypothetical protein [Zea mays]
 gb|ACG42825.1| hypothetical protein [Zea mays]
 gb|AFW70774.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=569

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  703  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  524
            NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELA+ALH  FKDWLYASGNIRQ
Sbjct  503  NPFPLPEIYEAFQSKKRSALEDIQKMIRELQLDENRKRELAAALHAQFKDWLYASGNIRQ  562

Query  523  LYCLQGE  503
            LYCLQG+
Sbjct  563  LYCLQGD  569



>ref|XP_008643389.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN30975.1| unknown [Zea mays]
 gb|AFW70773.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=581

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  703  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  524
            NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELA+ALH  FKDWLYASGNIRQ
Sbjct  515  NPFPLPEIYEAFQSKKRSALEDIQKMIRELQLDENRKRELAAALHAQFKDWLYASGNIRQ  574

Query  523  LYCLQGE  503
            LYCLQG+
Sbjct  575  LYCLQGD  581



>ref|XP_006648417.1| PREDICTED: TBCC domain-containing protein 1-like [Oryza brachyantha]
Length=484

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK  PFPLP+ Y  SQ K    L +I++ +RE +++D+RK+ELA+ALH  FKDWLYASGN
Sbjct  415  TKCCPFPLPEIYGVSQSKKLAALEDIRKTIRELQIDDNRKKELANALHAQFKDWLYASGN  474

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  475  IRQLYCLQGD  484



>ref|XP_006850073.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
 gb|ERN11654.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
Length=589

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  703  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  524
            NPF LP AY ASQ K    L EIKQ L E +LE++RKREL SALHV FK+WLYASGNIRQ
Sbjct  523  NPFRLPVAYEASQKKKSMVLNEIKQALIEAQLEENRKRELNSALHVYFKEWLYASGNIRQ  582

Query  523  LYCLQGE  503
            LYCLQG+
Sbjct  583  LYCLQGD  589



>gb|EEE56495.1| hypothetical protein OsJ_05741 [Oryza sativa Japonica Group]
Length=544

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK  PFPLP+ Y ASQ K    L +I++ +RE +++D+RK+EL +ALH  FKDWLYASGN
Sbjct  475  TKCCPFPLPEIYCASQSKKLAALEDIRRTIRELQIDDNRKKELTNALHAQFKDWLYASGN  534

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  535  IRQLYCLQGD  544



>gb|EEC72669.1| hypothetical protein OsI_06222 [Oryza sativa Indica Group]
Length=579

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK  PFPLP+ Y ASQ K    L +I++ +RE +++D+RK+EL +ALH  FKDWLYASGN
Sbjct  510  TKCCPFPLPEIYCASQSKKLAALEDIRRTIRELQIDDNRKKELTNALHAQFKDWLYASGN  569

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  570  IRQLYCLQGD  579



>ref|NP_001046181.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAD25242.1| tubulin-specific chaperone C-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF08095.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAH00408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=579

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK  PFPLP+ Y ASQ K    L +I++ +RE +++D+RK+EL +ALH  FKDWLYASGN
Sbjct  510  TKCCPFPLPEIYCASQSKKLAALEDIRRTIRELQIDDNRKKELTNALHAQFKDWLYASGN  569

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  570  IRQLYCLQGD  579



>gb|KJB15038.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=582

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPLPDAYM SQ +N KNL EIKQ+LRE  LE++ KREL+SALHV FKDWLY    
Sbjct  498  TKDNPFPLPDAYMTSQQRNQKNLSEIKQMLREAPLEENWKRELSSALHVYFKDWLYGKSI  557

Query  532  IRQLY  518
            I   +
Sbjct  558  ISIFF  562



>ref|XP_010913921.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=577

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK  PF LP+ Y  SQ + H  L +I+Q LR+ +L+ +RKR+LA ALHV FKDWLYASGN
Sbjct  508  TKYIPFRLPEIYSESQRRKHSVLSDIQQALRDVQLDANRKRDLAMALHVHFKDWLYASGN  567

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  568  IRQLYCLQGD  577



>ref|XP_008787292.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=574

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TK  PF LP+ Y  SQ + H  L +I+Q LR+ +L+ +RKR+LA ALHV FKDWLYASGN
Sbjct  505  TKYIPFRLPEIYSESQKRKHSVLSDIQQALRDVQLDANRKRDLAMALHVHFKDWLYASGN  564

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  565  IRQLYCLQGD  574



>gb|EEC67872.1| hypothetical protein OsI_35505 [Oryza sativa Indica Group]
Length=349

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPFPLP+ Y   Q K H  L +I++ + E +L+++RKR+LA+ALH  FK WLYASGN
Sbjct  280  TNCNPFPLPEIYGTFQSKKHSALEDIQKTIWELQLDENRKRDLATALHAQFKGWLYASGN  339

Query  532  IRQLYCLQGE  503
            IRQLYCLQG+
Sbjct  340  IRQLYCLQGD  349



>ref|XP_011033249.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=575

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 5/68 (7%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPF LP+AY+ASQ +N KNL EIKQ+LRE  LE+++KREL+SALH+LFKDWLY    
Sbjct  500  TKDNPFQLPEAYIASQQRNQKNLGEIKQLLREVPLEENQKRELSSALHLLFKDWLYVC--  557

Query  532  IRQLYCLQ  509
               + CLQ
Sbjct  558  ---VACLQ  562



>gb|KGN54813.1| hypothetical protein Csa_4G507430 [Cucumis sativus]
Length=561

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYA  542
            T  NPFPLPDAY+AS  +N K L E+KQILRET LE++RKREL+SALHV FKDWLY 
Sbjct  501  TDCNPFPLPDAYLASLERNKKTLGEVKQILRETPLEENRKRELSSALHVYFKDWLYG  557



>gb|KHG18606.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=582

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPL D Y+ SQ KN  NL EIKQILRE  LE++ KREL+ ALHV F+DWLY S  
Sbjct  495  TKDNPFPLTDPYLTSQQKNQNNLGEIKQILREAPLEENLKRELSCALHVYFRDWLYVSST  554

Query  532  IRQLYCLQGE*KCCWM  485
            +  +   Q    CC +
Sbjct  555  LLPVPQAQLISFCCGL  570



>gb|KJB15037.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=536

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  652  KNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQLYCLQGE  503
            KNL EIKQ+LRE  LE++ KREL+SALHV FKDWLYASGNIRQLYCLQG+
Sbjct  487  KNLSEIKQMLREAPLEENWKRELSSALHVYFKDWLYASGNIRQLYCLQGD  536



>gb|KJB36110.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=342

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            TKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+DWLY    
Sbjct  278  TKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFRDWLYGKSI  337

Query  532  IRQLY  518
            I   Y
Sbjct  338  IFLFY  342



>ref|NP_181752.3| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC10092.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=562

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  539
            TKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLY +
Sbjct  499  TKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHMYFKDWLYGN  556



>ref|XP_002881827.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58086.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  539
            TKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLY +
Sbjct  499  TKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETSLEENRKRELTTAFHMHFKDWLYGN  556



>gb|AAB88648.1| hypothetical protein [Arabidopsis thaliana]
Length=551

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLY  545
            TKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FKDWLY
Sbjct  447  TKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHMYFKDWLY  502



>gb|KHF98763.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=598

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 10/75 (13%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS--  539
            TKDNPFPLPDAY+ SQ +N KNL EIKQILRE  LE++RKREL+ ALH+      Y +  
Sbjct  501  TKDNPFPLPDAYLKSQLRNQKNLSEIKQILREAPLEENRKRELSCALHLPVTYVSYTAYK  560

Query  538  --------GNIRQLY  518
                    G IRQ+Y
Sbjct  561  VIETLRLRGVIRQVY  575



>gb|ACM17606.1| tubulin-specific chaperon-like protein [Oryza sativa Indica Group]
Length=389

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 53/99 (54%), Gaps = 29/99 (29%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLY----  545
            T  NPFPLP+ Y   Q K H  L +I++ + E +L+++RKR+LA+ALH  FK WLY    
Sbjct  291  TNCNPFPLPEIYGTFQSKKHSALEDIQKTIWELQLDENRKRDLATALHAQFKGWLYGIDS  350

Query  544  -------------------------ASGNIRQLYCLQGE  503
                                     ASGNIRQLYCLQG+
Sbjct  351  APATSSYEQLLQMLLAENDSHLSGVASGNIRQLYCLQGD  389



>ref|XP_002986516.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
 gb|EFJ12373.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
Length=570

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF LP  Y+ +Q + +K +  ++ +L+   L+D+RKR+L++A+H  FK+WLY SGN
Sbjct  496  TRANPFLLPKLYLMAQQQRNKAMENLRHLLQNVPLDDNRKRDLSNAIHAHFKEWLYGSGN  555

Query  532  IRQLYCLQ  509
            IRQLY LQ
Sbjct  556  IRQLYDLQ  563



>ref|XP_002964936.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
 gb|EFJ33774.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
Length=599

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF LP  Y+ +Q + +K +  ++ +L+   L+D+RKR+L++A+H  FK+WLY SGN
Sbjct  525  TRANPFLLPKLYLMAQQQRNKAMENLRHLLQNVPLDDNRKRDLSNAIHAHFKEWLYGSGN  584

Query  532  IRQLYCLQ  509
            IRQLY LQ
Sbjct  585  IRQLYDLQ  592



>gb|EMT00776.1| hypothetical protein F775_29395 [Aegilops tauschii]
Length=224

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYA  542
            TK NPFPLP+ Y ASQ K    L + K+ +RE +L+++RK+ELASALH  FKDWLY 
Sbjct  90   TKCNPFPLPEIYQASQSKKQAVLEDSKKTIRELQLDENRKKELASALHSQFKDWLYV  146



>ref|XP_001757659.1| predicted protein [Physcomitrella patens]
 gb|EDQ77716.1| predicted protein [Physcomitrella patens]
Length=608

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF LP  Y+ +Q    K    +KQ LR   LE+ +KREL SA+H  F+DWL+ASGN
Sbjct  529  TRANPFLLPKPYLLAQQHRCKAAEILKQNLRTALLEEGKKRELISAIHGHFRDWLFASGN  588

Query  532  IRQLYCLQG  506
            IRQ+Y LQ 
Sbjct  589  IRQIYDLQA  597



>ref|XP_010233970.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Brachypodium 
distachyon]
Length=560

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  539
            TK NPFPLP+ Y ASQ K H  L + ++ +RE +++++RK+ELA+ALH  FKDWLYA+
Sbjct  499  TKCNPFPLPELYQASQIKKHAVLEDTQKTIRELQIDENRKKELANALHAQFKDWLYAA  556



>gb|EMT07109.1| TBCC domain-containing protein 1 [Aegilops tauschii]
Length=511

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYA  542
            TK NPF LP+ Y ASQ K + +L +I++ +RE EL+D+RK+ELA ALH  FKDWLY 
Sbjct  414  TKYNPFTLPEVYWASQRKKNASLEDIQKNIRELELDDNRKKELACALHAQFKDWLYG  470



>ref|XP_001778693.1| predicted protein [Physcomitrella patens]
 gb|EDQ56486.1| predicted protein, partial [Physcomitrella patens]
Length=584

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF LP  Y+ +Q    K    +KQ L+   LED ++REL SA+   F+DWL A+GN
Sbjct  505  TRANPFLLPKPYLLAQQHRCKAAETLKQNLKTALLEDGKERELISAIQGHFRDWLVATGN  564

Query  532  IRQLYCLQG  506
            IRQ+Y LQ 
Sbjct  565  IRQMYGLQA  573



>ref|XP_001765734.1| predicted protein [Physcomitrella patens]
 gb|EDQ69325.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF LP  Y+ +Q    K    +KQ L+   LE+ +KR +  A+H  F+DWL+ASGN
Sbjct  481  TRANPFLLPKPYLLAQQHRCKAAENLKQNLKTITLEEGKKRGVILAIHGHFRDWLFASGN  540

Query  532  IRQLYCLQG  506
            IRQ+Y LQ 
Sbjct  541  IRQIYELQA  549



>ref|XP_001758135.1| predicted protein [Physcomitrella patens]
 gb|EDQ76957.1| predicted protein [Physcomitrella patens]
Length=579

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T  NPF LP  Y+A+  +  +    +K  ++   LE  ++REL +A+H  F+DWLYASG+
Sbjct  509  TSANPFILPQLYIAAVEQRSRAAETLKLNIKNAALEVDKERELVAAIHSHFRDWLYASGS  568

Query  532  IRQLY  518
            IRQLY
Sbjct  569  IRQLY  573



>ref|XP_003060588.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55357.1| predicted protein [Micromonas pusilla CCMP1545]
Length=490

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF +P+AY+ +  +  +++  ++  +R+  L+D +KREL + +   FK+WL  SG+
Sbjct  417  TQANPFSVPEAYVRALDQKVRSVASLRAAMRDAGLDDDQKRELQATIQAYFKEWLLTSGS  476

Query  532  IRQLY  518
            +RQ+Y
Sbjct  477  MRQVY  481



>ref|XP_011396281.1| TBCC domain-containing protein 1 [Auxenochlorella protothecoides]
 gb|KFM23411.1| TBCC domain-containing protein 1 [Auxenochlorella protothecoides]
Length=472

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -3

Query  703  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  524
            +PFPLP  Y  +         E++  ++E  LE+ R+REL +A+   FKDWL ++G++R 
Sbjct  393  SPFPLPQQYFETWEAKMAAAGEVRAAVKEAALEEGRRRELMAAIQASFKDWLQSTGSMRH  452

Query  523  LY  518
            +Y
Sbjct  453  VY  454



>gb|EMS64518.1| TBCC domain-containing protein 1 [Triticum urartu]
Length=472

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 44/85 (52%), Gaps = 27/85 (32%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKN---------------------------HKNLVEIKQILRET  614
            TK NPF LP+ Y ASQ K                            + +L +I++ +RE 
Sbjct  388  TKYNPFTLPEVYWASQRKKVFRSFTIGARLRGSVLPLKIPQLALSLNASLEDIQKNIREL  447

Query  613  ELEDSRKRELASALHVLFKDWLYAS  539
            EL+D+RK+ELA ALH  FKDWLY +
Sbjct  448  ELDDNRKKELACALHAQFKDWLYGN  472



>ref|XP_005651291.1| TBCC-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26747.1| TBCC-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=575

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -3

Query  703  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  524
            +PF LP  Y  ++ +    + +++  ++   L+D +KREL + +   FKDWL  SGN+RQ
Sbjct  479  SPFRLPAVYEEAKERKVSAVSDLRNAVKAASLDDGKKRELQAVIQSYFKDWLMTSGNMRQ  538

Query  523  LYCL  512
            +Y L
Sbjct  539  VYDL  542



>ref|XP_002505027.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66285.1| predicted protein [Micromonas sp. RCC299]
Length=634

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -3

Query  712  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  533
            T+ NPF +P  Y+ +     K +  ++  LR+  L++  +REL + +   FK+WL  SG+
Sbjct  561  TQANPFAVPPEYVRALDAKVKAVASLRSALRDAGLDERSRRELQATIQAFFKEWLMTSGS  620

Query  532  IRQLY  518
            +RQ+Y
Sbjct  621  MRQVY  625



>ref|XP_009514404.1| hypothetical protein PHYSODRAFT_358230 [Phytophthora sojae]
 gb|EGZ27129.1| hypothetical protein PHYSODRAFT_358230 [Phytophthora sojae]
Length=723

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  645  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  704

Query  526  QL  521
            Q+
Sbjct  705  QI  706



>gb|ETK90738.1| hypothetical protein L915_05554 [Phytophthora parasitica]
Length=655

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  526  QL  521
            Q+
Sbjct  636  QI  637



>gb|ETO79605.1| hypothetical protein F444_05744 [Phytophthora parasitica P1976]
 gb|ETP48550.1| hypothetical protein F442_05738 [Phytophthora parasitica P10297]
Length=699

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  620  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  679

Query  526  QL  521
            Q+
Sbjct  680  QI  681



>gb|ETL97323.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM50474.1| hypothetical protein, variant [Phytophthora parasitica]
Length=655

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  526  QL  521
            Q+
Sbjct  636  QI  637



>gb|ETO79606.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP48551.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=655

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  526  QL  521
            Q+
Sbjct  636  QI  637



>ref|XP_008903430.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETL44151.1| hypothetical protein L916_05494 [Phytophthora parasitica]
 gb|ETN11400.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=655

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  526  QL  521
            Q+
Sbjct  636  QI  637



>ref|XP_008903429.1| hypothetical protein PPTG_22581 [Phytophthora parasitica INRA-310]
 gb|ETN11399.1| hypothetical protein PPTG_22581 [Phytophthora parasitica INRA-310]
Length=699

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  620  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  679

Query  526  QL  521
            Q+
Sbjct  680  QI  681



>gb|ETL97322.1| hypothetical protein L917_05380 [Phytophthora parasitica]
 gb|ETM50473.1| hypothetical protein L914_05503 [Phytophthora parasitica]
Length=699

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  620  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  679

Query  526  QL  521
            Q+
Sbjct  680  QI  681



>gb|ETP20620.1| hypothetical protein F441_05699 [Phytophthora parasitica CJ01A1]
Length=1302

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706   DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
             + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  1223  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  1282

Query  526   QL  521
             Q+
Sbjct  1283  QI  1284



>ref|XP_002909594.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY58408.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=706

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  625  ERPFPIPPEYVAAVRKQYETVDSLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  684

Query  526  QL  521
            Q+
Sbjct  685  QI  686



>gb|ETI50864.1| hypothetical protein F443_05691 [Phytophthora parasitica P1569]
Length=1302

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  706   DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  527
             + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  1223  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  1282

Query  526   QL  521
             Q+
Sbjct  1283  QI  1284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395