BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004M04

Length=539
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP21408.1|  unnamed protein product                                100   4e-22   Coffea canephora [robusta coffee]
gb|AAW51125.1|  putative alcohol acyl-transferases                      101   5e-22   Cucumis melo [Oriental melon]
ref|XP_008462816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    101   6e-22   
ref|XP_004243496.2|  PREDICTED: benzyl alcohol O-benzoyltransferase   99.8    3e-21   Solanum lycopersicum
ref|XP_004243495.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  99.4    4e-21   Solanum lycopersicum
gb|AEM43830.1|  alcohol acyl transferase                              98.6    4e-21   Fragaria x ananassa
emb|CDP18599.1|  unnamed protein product                              99.4    4e-21   Coffea canephora [robusta coffee]
emb|CDP21409.1|  unnamed protein product                              99.0    4e-21   Coffea canephora [robusta coffee]
ref|XP_006446261.1|  hypothetical protein CICLE_v10015234mg           98.6    6e-21   Citrus clementina [clementine]
ref|XP_004151058.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  98.6    8e-21   Cucumis sativus [cucumbers]
ref|XP_002266420.1|  PREDICTED: methanol O-anthraniloyltransferase    98.2    8e-21   Vitis vinifera
emb|CBI37442.3|  unnamed protein product                              98.2    1e-20   Vitis vinifera
gb|ABX57719.1|  acyltransferase                                       97.8    1e-20   Vanda hybrid cultivar
emb|CAN68818.1|  hypothetical protein VITISV_012041                   97.8    1e-20   Vitis vinifera
ref|XP_002270962.1|  PREDICTED: methanol O-anthraniloyltransferas...  97.4    2e-20   Vitis vinifera
emb|CAN69458.1|  hypothetical protein VITISV_024175                   96.3    2e-20   Vitis vinifera
ref|XP_010644207.1|  PREDICTED: methanol O-anthraniloyltransferas...  96.7    2e-20   
ref|XP_009368754.1|  PREDICTED: methanol O-anthraniloyltransferas...  97.4    2e-20   Pyrus x bretschneideri [bai li]
emb|CAN69948.1|  hypothetical protein VITISV_009219                   97.1    3e-20   Vitis vinifera
gb|KDO54864.1|  hypothetical protein CISIN_1g041010mg                 95.5    3e-20   Citrus sinensis [apfelsine]
ref|XP_010665859.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  95.1    3e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP30452.1|  hypothetical protein JCGZ_17140                       94.7    5e-20   Jatropha curcas
emb|CAN72252.1|  hypothetical protein VITISV_017467                   95.9    5e-20   Vitis vinifera
gb|KJB82262.1|  hypothetical protein B456_013G185500                  95.9    6e-20   Gossypium raimondii
ref|XP_002265049.1|  PREDICTED: methanol O-anthraniloyltransferase    95.9    6e-20   Vitis vinifera
ref|XP_008356442.1|  PREDICTED: methanol O-anthraniloyltransferas...  95.9    6e-20   
emb|CBI37443.3|  unnamed protein product                              96.3    7e-20   Vitis vinifera
ref|XP_006470742.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  95.5    8e-20   Citrus sinensis [apfelsine]
gb|KCW72707.1|  hypothetical protein EUGRSUZ_E01159                   94.7    8e-20   Eucalyptus grandis [rose gum]
ref|XP_002266114.1|  PREDICTED: methanol O-anthraniloyltransferas...  95.1    1e-19   Vitis vinifera
ref|XP_009365780.1|  PREDICTED: methanol O-anthraniloyltransferas...  95.1    1e-19   Pyrus x bretschneideri [bai li]
gb|AAT68601.1|  benzoyl coenzyme A: benzyl alcohol benzoyl transf...  95.1    1e-19   Petunia x hybrida [garden petunia]
ref|XP_002265841.1|  PREDICTED: methanol O-anthraniloyltransferase    95.1    1e-19   Vitis vinifera
emb|CAN74729.1|  hypothetical protein VITISV_042062                   95.1    1e-19   Vitis vinifera
ref|XP_007029776.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  95.9    1e-19   
ref|XP_010058386.1|  PREDICTED: methanol O-anthraniloyltransferas...  94.4    3e-19   Eucalyptus grandis [rose gum]
ref|XP_010644575.1|  PREDICTED: methanol O-anthraniloyltransferas...  94.0    3e-19   
ref|XP_008462818.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  94.0    3e-19   Cucumis melo [Oriental melon]
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g           93.2    5e-19   Phaseolus vulgaris [French bean]
ref|XP_010667725.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  93.6    5e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008373466.1|  PREDICTED: methanol O-anthraniloyltransferas...  93.2    7e-19   
ref|XP_011018694.1|  PREDICTED: methanol O-anthraniloyltransferas...  92.8    7e-19   Populus euphratica
ref|XP_006446260.1|  hypothetical protein CICLE_v10015249mg           92.8    8e-19   Citrus clementina [clementine]
ref|XP_008373477.1|  PREDICTED: methanol O-anthraniloyltransferas...  91.3    8e-19   
ref|XP_006368247.1|  hypothetical protein POPTR_0001s00950g           92.8    9e-19   
ref|XP_006446721.1|  hypothetical protein CICLE_v10017956mg           91.7    1e-18   
ref|XP_003516503.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  92.0    1e-18   Glycine max [soybeans]
ref|XP_008373476.1|  PREDICTED: methanol O-anthraniloyltransferas...  92.0    1e-18   
ref|XP_007029780.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  92.4    1e-18   
ref|XP_010108951.1|  Benzyl alcohol O-benzoyltransferase              90.5    2e-18   
ref|XP_006470741.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  92.0    2e-18   Citrus sinensis [apfelsine]
gb|KDO44967.1|  hypothetical protein CISIN_1g0133461mg                90.5    2e-18   Citrus sinensis [apfelsine]
ref|XP_007029777.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  92.0    2e-18   
gb|EMT21730.1|  2-alpha-hydroxytaxane 2-O-benzoyltransferase          89.0    2e-18   
gb|KHN41759.1|  Benzyl alcohol O-benzoyltransferase                   92.0    2e-18   Glycine soja [wild soybean]
gb|KDP39568.1|  hypothetical protein JCGZ_02588                       92.0    2e-18   Jatropha curcas
emb|CAN77583.1|  hypothetical protein VITISV_040970                   91.7    2e-18   Vitis vinifera
gb|KDO49560.1|  hypothetical protein CISIN_1g036972mg                 89.7    2e-18   Citrus sinensis [apfelsine]
sp|Q3ZPN4.1|ACMAT_VITLA  RecName: Full=Methanol O-anthraniloyltra...  91.3    3e-18   Vitis labrusca [Concord grape]
ref|XP_007029787.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  91.7    3e-18   
ref|XP_009759678.1|  PREDICTED: methanol O-anthraniloyltransferas...  91.3    3e-18   Nicotiana sylvestris
ref|XP_009372579.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  91.3    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_004239236.1|  PREDICTED: methanol O-anthraniloyltransferas...  91.3    3e-18   Solanum lycopersicum
ref|XP_007029786.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  91.7    3e-18   
emb|CBI25251.3|  unnamed protein product                              90.9    3e-18   Vitis vinifera
ref|XP_002271603.1|  PREDICTED: methanol O-anthraniloyltransferase    91.3    3e-18   Vitis vinifera
ref|XP_009386561.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  91.3    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIW04708.1|  alcohol acyltransferase 1                             90.9    3e-18   Solanum pennellii
gb|AIC83790.1|  alcohol acyltransferase                               90.9    4e-18   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009803457.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  90.5    4e-18   Nicotiana sylvestris
ref|XP_004156760.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...  90.9    5e-18   
ref|XP_004151857.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  90.5    5e-18   Cucumis sativus [cucumbers]
gb|ACP31201.1|  HRS201-like protein                                   88.2    5e-18   Solanum melongena [aubergine]
ref|XP_002517500.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...  90.5    6e-18   Ricinus communis
ref|XP_009803456.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  90.5    6e-18   Nicotiana sylvestris
ref|XP_006470749.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  90.1    6e-18   
ref|XP_009619718.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   90.5    6e-18   Nicotiana tomentosiformis
emb|CAA64636.1|  hsr201                                               90.1    7e-18   Nicotiana tabacum [American tobacco]
sp|Q8GT20.1|BEBT_TOBAC  RecName: Full=Benzyl alcohol O-benzoyltra...  90.1    7e-18   Nicotiana tabacum [American tobacco]
ref|XP_009368287.1|  PREDICTED: methanol O-anthraniloyltransferas...  90.1    8e-18   
gb|KHN04051.1|  Benzyl alcohol O-benzoyltransferase                   89.4    8e-18   Glycine soja [wild soybean]
gb|ACU23519.1|  unknown                                               87.0    8e-18   Glycine max [soybeans]
ref|XP_008359502.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  89.7    1e-17   
ref|XP_007029781.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  90.5    1e-17   
ref|XP_007029788.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  89.7    1e-17   
gb|KHF99421.1|  Benzyl alcohol O-benzoyltransferase                   89.7    1e-17   Gossypium arboreum [tree cotton]
ref|XP_011007948.1|  PREDICTED: methanol O-anthraniloyltransferas...  89.7    1e-17   Populus euphratica
ref|XP_002304071.1|  hypothetical protein POPTR_0003s01420g           89.4    1e-17   Populus trichocarpa [western balsam poplar]
ref|NP_001234496.1|  alcohol acyl transferase                         89.4    1e-17   Solanum lycopersicum
ref|XP_011085899.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  89.4    1e-17   Sesamum indicum [beniseed]
dbj|BAF49304.1|  putative acyltransferase                             89.4    2e-17   Clitoria ternatea
ref|XP_003521736.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  89.4    2e-17   Glycine max [soybeans]
gb|AAL77060.1|AF468022_1  putative acyltransferase                    89.4    2e-17   Cucumis melo [Oriental melon]
ref|NP_001284403.1|  benzyl alcohol O-benzoyltransferase-like         89.0    2e-17   Cucumis melo [Oriental melon]
ref|XP_009365763.1|  PREDICTED: methanol O-anthraniloyltransferas...  89.0    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_006437408.1|  hypothetical protein CICLE_v10031489mg           89.0    2e-17   Citrus clementina [clementine]
ref|XP_004982683.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  89.0    2e-17   Setaria italica
ref|XP_006484694.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  89.0    2e-17   Citrus sinensis [apfelsine]
tpg|DAA49394.1|  TPA: hypothetical protein ZEAMMB73_141384            87.4    2e-17   
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                   89.0    2e-17   Eucalyptus grandis [rose gum]
ref|XP_003518844.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   89.0    2e-17   Glycine max [soybeans]
dbj|BAJ96970.1|  predicted protein                                    89.0    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB44358.1|  hypothetical protein B456_007G247700                  88.6    2e-17   Gossypium raimondii
ref|XP_009612665.1|  PREDICTED: methanol O-anthraniloyltransferas...  87.0    2e-17   Nicotiana tomentosiformis
dbj|BAB78588.1|  alcohol acetyltransferase                            88.6    3e-17   Cucumis melo [Oriental melon]
gb|KDP39575.1|  hypothetical protein JCGZ_02595                       85.5    3e-17   Jatropha curcas
ref|XP_007029790.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  88.6    3e-17   
ref|XP_010058392.1|  PREDICTED: methanol O-anthraniloyltransferas...  88.6    3e-17   
ref|XP_008232530.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   88.6    3e-17   Prunus mume [ume]
gb|AFK38671.1|  unknown                                               84.3    3e-17   Medicago truncatula
gb|AFK45581.1|  unknown                                               84.3    3e-17   Medicago truncatula
ref|XP_008380361.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...  86.7    3e-17   
ref|XP_008348383.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  86.7    4e-17   
ref|NP_001064997.1|  Os10g0503300                                     88.2    4e-17   
gb|ABR16407.1|  unknown                                               88.2    4e-17   Picea sitchensis
gb|ABR16595.1|  unknown                                               88.2    4e-17   Picea sitchensis
ref|XP_008355599.1|  PREDICTED: methanol O-anthraniloyltransferas...  88.2    4e-17   
ref|XP_006375977.1|  hypothetical protein POPTR_0013s072102g          85.9    4e-17   
ref|XP_011085895.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...  88.2    5e-17   
ref|XP_011082158.1|  PREDICTED: methanol O-anthraniloyltransferas...  87.8    5e-17   Sesamum indicum [beniseed]
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase       87.8    5e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002325454.2|  transferase family protein                       87.8    6e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010038484.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  87.8    6e-17   Eucalyptus grandis [rose gum]
sp|Q8GT21.1|BEBT_CLABR  RecName: Full=Benzyl alcohol O-benzoyltra...  87.8    6e-17   Clarkia breweri [fairy fans]
ref|XP_008343918.1|  PREDICTED: methanol O-anthraniloyltransferas...  87.8    6e-17   
gb|ACV74416.1|  putative alcohol acyl transferase                     87.8    6e-17   Camellia sinensis [black tea]
gb|EAZ02323.1|  hypothetical protein OsI_24425                        87.0    8e-17   Oryza sativa Indica Group [Indian rice]
dbj|BAE72881.1|  benzoyl CoA benzoic acid benzoyltransferase          87.4    8e-17   Glandularia x hybrida [garden verbena]
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  87.0    8e-17   Populus euphratica
ref|NP_001058545.2|  Os06g0710700                                     87.0    8e-17   
ref|XP_009804829.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   87.0    9e-17   Nicotiana sylvestris
gb|KJB82260.1|  hypothetical protein B456_013G185300                  86.7    9e-17   Gossypium raimondii
ref|XP_004966402.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  87.0    1e-16   Setaria italica
gb|AGW30202.1|  alcohol acyl transferase                              86.7    1e-16   Malus domestica [apple tree]
ref|XP_007158092.1|  hypothetical protein PHAVU_002G123400g           83.6    1e-16   Phaseolus vulgaris [French bean]
gb|AJD18611.1|  alcohol acyltransferase                               87.0    1e-16   Pyrus ussuriensis [Harbin pear]
gb|KEH40970.1|  benzyl alcohol O-benzoyltransferase                   86.7    1e-16   Medicago truncatula
tpg|DAA49395.1|  TPA: 10-deacetylbaccatin III 10-O-acetyltransferase  87.0    1e-16   
ref|XP_007200171.1|  hypothetical protein PRUPE_ppa016489mg           85.1    1e-16   
ref|NP_001152518.1|  10-deacetylbaccatin III 10-O-acetyltransferase   87.0    1e-16   Zea mays [maize]
gb|ACJ85557.1|  unknown                                               87.0    1e-16   Medicago truncatula
ref|XP_003536235.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  86.7    1e-16   Glycine max [soybeans]
ref|XP_008352569.1|  PREDICTED: methanol O-anthraniloyltransferas...  84.7    1e-16   
gb|EMS67264.1|  Omega-hydroxypalmitate O-feruloyl transferase         83.6    1e-16   Triticum urartu
ref|XP_002447250.1|  hypothetical protein SORBIDRAFT_06g031260        86.7    1e-16   
ref|XP_004966401.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  86.7    1e-16   Setaria italica
ref|XP_009388282.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   86.7    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008238035.1|  PREDICTED: methanol O-anthraniloyltransferas...  86.3    2e-16   
ref|XP_006470748.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  86.3    2e-16   Citrus sinensis [apfelsine]
ref|XP_002437575.1|  hypothetical protein SORBIDRAFT_10g029620        86.3    2e-16   Sorghum bicolor [broomcorn]
gb|AAS79797.1|  alcohol acyl transferase                              86.3    2e-16   Malus domestica [apple tree]
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   86.3    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009336751.1|  PREDICTED: methanol O-anthraniloyltransferas...  86.3    2e-16   
ref|XP_002524019.1|  hypothetical protein RCOM_1517170                83.2    2e-16   
ref|XP_004498016.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  86.3    2e-16   Cicer arietinum [garbanzo]
ref|XP_008368021.1|  PREDICTED: methanol O-anthraniloyltransferas...  85.9    2e-16   
ref|XP_010110383.1|  Benzyl alcohol O-benzoyltransferase              85.9    2e-16   Morus notabilis
ref|XP_008645066.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.9    2e-16   Zea mays [maize]
ref|XP_006351055.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  85.5    3e-16   Solanum tuberosum [potatoes]
ref|XP_004305015.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.5    3e-16   Fragaria vesca subsp. vesca
ref|XP_002466979.1|  hypothetical protein SORBIDRAFT_01g017800        85.5    3e-16   Sorghum bicolor [broomcorn]
ref|XP_007209120.1|  hypothetical protein PRUPE_ppa005455mg           85.5    4e-16   Prunus persica
ref|XP_007209131.1|  hypothetical protein PRUPE_ppa005625mg           85.1    4e-16   Prunus persica
ref|XP_006446264.1|  hypothetical protein CICLE_v10015163mg           85.5    4e-16   Citrus clementina [clementine]
ref|XP_008678444.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.5    4e-16   Zea mays [maize]
ref|XP_009336752.1|  PREDICTED: methanol O-anthraniloyltransferas...  85.5    4e-16   
ref|XP_004294711.1|  PREDICTED: methanol O-anthraniloyltransferas...  85.5    4e-16   Fragaria vesca subsp. vesca
ref|XP_008364483.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.1    4e-16   
gb|KJB80923.1|  hypothetical protein B456_013G121600                  85.1    4e-16   Gossypium raimondii
ref|XP_006376283.1|  hypothetical protein POPTR_0013s11650g           84.7    4e-16   
ref|XP_002264599.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   85.1    5e-16   Vitis vinifera
ref|XP_004301775.1|  PREDICTED: methanol O-anthraniloyltransferas...  84.7    5e-16   Fragaria vesca subsp. vesca
ref|XP_006446263.1|  hypothetical protein CICLE_v10015199mg           85.1    5e-16   Citrus clementina [clementine]
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                   85.1    5e-16   Glycine soja [wild soybean]
ref|XP_004290447.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   85.1    5e-16   Fragaria vesca subsp. vesca
ref|XP_009374085.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.1    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.1    5e-16   Glycine max [soybeans]
ref|NP_001275839.1|  alcohol acyl transferase                         84.7    5e-16   Citrus sinensis [apfelsine]
ref|XP_006350348.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  84.7    6e-16   Solanum tuberosum [potatoes]
ref|NP_001266678.1|  10-deacetylbaccatin III 10-O-acetyltransferase   84.7    6e-16   
ref|XP_006470570.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  84.7    6e-16   Citrus sinensis [apfelsine]
emb|CAA94432.1|  unknown                                              84.7    6e-16   Cucumis melo [Oriental melon]
ref|XP_008462821.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.7    6e-16   Cucumis melo [Oriental melon]
gb|AGW30203.1|  alcohol acyl transferase                              84.7    6e-16   Malus domestica [apple tree]
ref|XP_009778012.1|  PREDICTED: methanol O-anthraniloyltransferas...  84.7    7e-16   Nicotiana sylvestris
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.7    7e-16   Phoenix dactylifera
gb|AGW30201.1|  alcohol acyl transferase                              84.7    7e-16   Malus domestica [apple tree]
ref|XP_008391402.1|  PREDICTED: methanol O-anthraniloyltransferas...  84.7    7e-16   Malus domestica [apple tree]
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.7    7e-16   Populus euphratica
ref|XP_010644225.1|  PREDICTED: methanol O-anthraniloyltransferas...  82.0    7e-16   
gb|AAR99826.1|  alcohol acyl transferase                              84.7    7e-16   Malus domestica [apple tree]
ref|XP_006368249.1|  hypothetical protein POPTR_0001s00970g           84.3    8e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006470747.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  84.3    8e-16   
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...  84.3    8e-16   
gb|AAG13627.1|AC078840_18  putative hypersensitivity-related (hsr...  84.7    9e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AFK36385.1|  unknown                                               84.3    9e-16   Medicago truncatula
ref|XP_006878645.1|  hypothetical protein AMTR_s00011p00264700        80.9    9e-16   
ref|XP_009589917.1|  PREDICTED: methanol O-anthraniloyltransferas...  84.3    9e-16   Nicotiana tomentosiformis
ref|XP_004244681.1|  PREDICTED: methanol O-anthraniloyltransferase    84.3    9e-16   Solanum lycopersicum
ref|XP_002524024.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...  84.0    9e-16   
gb|AGK82816.1|  alcohol acyltransferase 2                             84.0    1e-15   Solanum pimpinellifolium [currant tomato]
gb|AAN85436.1|  acyltransferase 2                                     84.3    1e-15   Capsicum chinense [bonnet pepper]
gb|ACU24193.1|  unknown                                               82.8    1e-15   Glycine max [soybeans]
gb|EYU41390.1|  hypothetical protein MIMGU_mgv1a009242mg              82.8    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_008359513.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  82.4    1e-15   
gb|EYU26841.1|  hypothetical protein MIMGU_mgv1a011322mg              82.0    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_006361592.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  84.0    1e-15   Solanum tuberosum [potatoes]
gb|ACF07921.1|  alcohol acyl transferase                              84.0    1e-15   Prunus armeniaca
ref|XP_011085894.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.0    1e-15   Sesamum indicum [beniseed]
dbj|BAJ92444.1|  predicted protein                                    84.0    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN16174.1|  Benzyl alcohol O-benzoyltransferase                   82.4    1e-15   Glycine soja [wild soybean]
ref|XP_002438993.1|  hypothetical protein SORBIDRAFT_10g029610        83.6    1e-15   Sorghum bicolor [broomcorn]
gb|KDP39567.1|  hypothetical protein JCGZ_02587                       83.6    1e-15   Jatropha curcas
ref|XP_011007950.1|  PREDICTED: LOW QUALITY PROTEIN: methanol O-a...  81.6    1e-15   Populus euphratica
gb|AHC32224.2|  alcohol acyl transferase 1                            83.6    1e-15   Eriobotrya japonica [loquat]
emb|CAN68586.1|  hypothetical protein VITISV_027876                   82.4    2e-15   Vitis vinifera
gb|KEH40971.1|  benzyl alcohol O-benzoyltransferase                   83.6    2e-15   Medicago truncatula
gb|KCW84616.1|  hypothetical protein EUGRSUZ_B01447                   82.0    2e-15   Eucalyptus grandis [rose gum]
ref|XP_002319767.1|  transferase family protein                       83.6    2e-15   Populus trichocarpa [western balsam poplar]
gb|AAS48090.1|  alcohol acyl transferase                              83.2    2e-15   Pyrus communis
gb|EYU41389.1|  hypothetical protein MIMGU_mgv1a006154mg              83.6    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_003574156.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   83.2    2e-15   Brachypodium distachyon [annual false brome]
ref|XP_011085897.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  83.2    2e-15   Sesamum indicum [beniseed]
ref|XP_010110389.1|  Benzyl alcohol O-benzoyltransferase              83.6    2e-15   
ref|XP_010045975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  82.0    2e-15   
gb|EYU41386.1|  hypothetical protein MIMGU_mgv1a006089mg              83.2    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_007208844.1|  hypothetical protein PRUPE_ppa025565mg           83.6    3e-15   
emb|CBI29212.3|  unnamed protein product                              82.4    3e-15   Vitis vinifera
ref|XP_003563544.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  82.8    3e-15   Brachypodium distachyon [annual false brome]
ref|XP_010672751.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  82.8    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006878638.1|  hypothetical protein AMTR_s00011p00264170        82.8    3e-15   
gb|KGN63335.1|  hypothetical protein Csa_2G429070                     80.9    3e-15   Cucumis sativus [cucumbers]
gb|KDP39572.1|  hypothetical protein JCGZ_02592                       81.3    3e-15   Jatropha curcas
gb|AGW30205.1|  alcohol acyl transferase                              82.4    3e-15   Malus domestica [apple tree]
ref|XP_002270240.1|  PREDICTED: methanol O-anthraniloyltransferase    82.0    5e-15   Vitis vinifera
emb|CDP17523.1|  unnamed protein product                              82.0    6e-15   Coffea canephora [robusta coffee]
dbj|BAC58010.1|  alcohol acyltransferase                              82.0    6e-15   Cucumis melo [Oriental melon]
gb|KJB44361.1|  hypothetical protein B456_007G247900                  82.0    6e-15   Gossypium raimondii
gb|KGN63336.1|  hypothetical protein Csa_2G430570                     81.6    6e-15   Cucumis sativus [cucumbers]
ref|XP_003536109.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  82.0    7e-15   Glycine max [soybeans]
ref|XP_006446267.1|  hypothetical protein CICLE_v10015194mg           81.6    7e-15   
ref|XP_004986631.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  81.6    7e-15   Setaria italica
ref|XP_007210147.1|  hypothetical protein PRUPE_ppa025118mg           80.1    7e-15   
ref|XP_008373467.1|  PREDICTED: methanol O-anthraniloyltransferas...  81.6    8e-15   
ref|XP_009374321.1|  PREDICTED: methanol O-anthraniloyltransferas...  81.3    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_010058390.1|  PREDICTED: methanol O-anthraniloyltransferas...  81.3    9e-15   Eucalyptus grandis [rose gum]
gb|KCW72709.1|  hypothetical protein EUGRSUZ_E01161                   81.3    1e-14   Eucalyptus grandis [rose gum]
ref|XP_006470571.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  81.3    1e-14   Citrus sinensis [apfelsine]
ref|XP_002319765.2|  hypothetical protein POPTR_0013s07220g           80.9    1e-14   
ref|XP_004986643.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  80.9    1e-14   Setaria italica
ref|XP_002319766.1|  hypothetical protein POPTR_0013s07230g           80.9    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004517186.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.3    1e-14   
ref|XP_002437572.1|  hypothetical protein SORBIDRAFT_10g029590        80.9    1e-14   Sorghum bicolor [broomcorn]
gb|ABK96738.1|  unknown                                               80.9    1e-14   Populus trichocarpa x Populus deltoides
ref|XP_004156759.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  80.9    1e-14   
ref|XP_006657332.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  80.9    1e-14   Oryza brachyantha
ref|XP_010058391.1|  PREDICTED: methanol O-anthraniloyltransferas...  80.9    2e-14   Eucalyptus grandis [rose gum]
dbj|BAK02525.1|  predicted protein                                    80.5    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AES82596.2|  alcohol acyltransferase                               78.6    2e-14   Medicago truncatula
ref|XP_003554685.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  80.5    2e-14   Glycine max [soybeans]
ref|XP_004151856.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...  80.1    2e-14   
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg              80.1    3e-14   Erythranthe guttata [common monkey flower]
gb|KGN63331.1|  hypothetical protein Csa_2G429040                     79.7    3e-14   Cucumis sativus [cucumbers]
ref|XP_010689157.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.7    3e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW84614.1|  hypothetical protein EUGRSUZ_B01445                   79.0    4e-14   Eucalyptus grandis [rose gum]
ref|XP_004171979.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  77.0    5e-14   
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  79.3    5e-14   Medicago truncatula
gb|AFK49108.1|  unknown                                               79.3    5e-14   Medicago truncatula
ref|XP_010045974.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.0    5e-14   Eucalyptus grandis [rose gum]
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.3    5e-14   
ref|XP_010040517.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.3    5e-14   
ref|XP_002444747.1|  hypothetical protein SORBIDRAFT_07g027100        79.0    6e-14   
ref|XP_010040516.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.0    6e-14   Eucalyptus grandis [rose gum]
ref|XP_003626378.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  78.2    7e-14   
gb|KEH17124.1|  benzyl alcohol O-benzoyltransferase                   76.3    9e-14   Medicago truncatula
emb|CDP11061.1|  unnamed protein product                              78.6    9e-14   Coffea canephora [robusta coffee]
gb|EPS68008.1|  hypothetical protein M569_06766                       78.6    9e-14   Genlisea aurea
gb|EYU34530.1|  hypothetical protein MIMGU_mgv1a006233mg              78.6    9e-14   Erythranthe guttata [common monkey flower]
gb|KCW72714.1|  hypothetical protein EUGRSUZ_E01167                   78.2    1e-13   Eucalyptus grandis [rose gum]
ref|XP_011098396.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  78.2    1e-13   
ref|XP_003575185.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  78.2    1e-13   
gb|EEE59629.1|  hypothetical protein OsJ_11976                        77.4    1e-13   
gb|KEH17123.1|  benzyl alcohol O-benzoyltransferase                   76.3    1e-13   
gb|KDP39576.1|  hypothetical protein JCGZ_02596                       77.8    2e-13   
gb|KEH40977.1|  benzyl alcohol O-benzoyltransferase                   77.4    2e-13   
gb|EEC75861.1|  hypothetical protein OsI_12874                        77.4    2e-13   
gb|KDP39571.1|  hypothetical protein JCGZ_02591                       73.6    2e-13   
gb|AAS07101.1|  putative hypersensitivity-related protein             77.4    3e-13   
ref|XP_004506306.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  77.0    3e-13   
ref|XP_009365778.1|  PREDICTED: methanol O-anthraniloyltransferas...  77.0    3e-13   
ref|XP_007147136.1|  hypothetical protein PHAVU_006G098800g           76.6    4e-13   
ref|XP_007147137.1|  hypothetical protein PHAVU_006G098900g           77.0    4e-13   
gb|KCW72712.1|  hypothetical protein EUGRSUZ_E01165                   76.3    4e-13   
ref|XP_010941428.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  76.3    5e-13   
ref|XP_004514200.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  76.6    5e-13   
ref|XP_011009230.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.9    5e-13   
ref|NP_001059277.1|  Os07g0244200                                     76.3    6e-13   
ref|XP_003616154.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  75.9    7e-13   
ref|XP_010058394.1|  PREDICTED: methanol O-anthraniloyltransferas...  76.3    8e-13   
ref|XP_010941427.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.5    8e-13   
gb|EMT07181.1|  Taxadien-5-alpha-ol O-acetyltransferase               75.5    9e-13   
ref|XP_010689158.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.5    9e-13   
ref|XP_002524018.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...  75.5    1e-12   
gb|ACT82248.1|  alcohol acyltransferase                               75.1    1e-12   
gb|AES82607.2|  benzyl alcohol O-benzoyltransferase                   74.7    2e-12   
ref|XP_003626388.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  74.7    2e-12   
ref|XP_010058393.1|  PREDICTED: methanol O-anthraniloyltransferas...  74.7    3e-12   
gb|EMT02065.1|  hypothetical protein F775_43251                       73.9    3e-12   
gb|KJB82514.1|  hypothetical protein B456_013G200000                  73.9    3e-12   
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  74.3    3e-12   
ref|XP_006657584.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  73.9    3e-12   
gb|AAX96461.1|  Transferase family                                    72.8    4e-12   
ref|XP_010557044.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  73.6    5e-12   
ref|XP_008462820.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  73.6    5e-12   
gb|KJB82264.1|  hypothetical protein B456_013G185700                  73.6    5e-12   
gb|KHN31436.1|  Benzyl alcohol O-benzoyltransferase                   73.2    5e-12   
ref|XP_003520833.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  73.2    5e-12   
gb|KCW72713.1|  hypothetical protein EUGRSUZ_E01166                   71.2    6e-12   
ref|XP_002440561.1|  hypothetical protein SORBIDRAFT_09g003180        73.6    6e-12   
gb|EMT31153.1|  2-alpha-hydroxytaxane 2-O-benzoyltransferase          73.2    6e-12   
gb|EAY80579.1|  hypothetical protein OsI_35761                        73.2    7e-12   
gb|KEH40969.1|  benzyl alcohol O-benzoyltransferase                   72.8    8e-12   
ref|XP_003626382.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  72.8    8e-12   
ref|XP_007029789.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  72.8    8e-12   
gb|EEE51952.1|  hypothetical protein OsJ_33591                        72.8    8e-12   
emb|CDY50708.1|  BnaC05g47750D                                        72.8    1e-11   
ref|XP_009130368.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  72.4    1e-11   
gb|KJB82515.1|  hypothetical protein B456_013G200100                  72.4    1e-11   
ref|XP_007147135.1|  hypothetical protein PHAVU_006G098700g           72.0    1e-11   
dbj|BAJ88238.1|  predicted protein                                    72.0    1e-11   
ref|XP_010549748.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  72.0    1e-11   
gb|KHN43217.1|  Benzyl alcohol O-benzoyltransferase                   71.6    1e-11   
ref|XP_008660976.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  72.0    2e-11   
ref|XP_008660975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  72.0    2e-11   
ref|XP_003549135.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  72.0    2e-11   
ref|XP_006657816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  71.6    2e-11   
ref|XP_002438731.1|  hypothetical protein SORBIDRAFT_10g025140        71.6    2e-11   
gb|AFG70732.1|  hypothetical protein 0_17485_01                       67.8    3e-11   
gb|AFG70743.1|  hypothetical protein 0_17485_01                       67.8    3e-11   
gb|AFG70731.1|  hypothetical protein 0_17485_01                       67.8    3e-11   
ref|XP_003599548.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  69.7    3e-11   
ref|XP_010550256.1|  PREDICTED: LOW QUALITY PROTEIN: (Z)-3-hexen-...  70.9    4e-11   
ref|XP_006654215.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  70.5    5e-11   
gb|EMT25790.1|  Taxadien-5-alpha-ol O-acetyltransferase               69.7    6e-11   
ref|XP_010558859.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  70.5    6e-11   
ref|XP_003626385.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  68.6    9e-11   
ref|XP_006408298.1|  hypothetical protein EUTSA_v10022248mg           69.3    1e-10   
ref|XP_002298962.2|  hypothetical protein POPTR_0001s45210g           69.3    1e-10   
sp|Q5H873.1|HLTT_LUPAL  RecName: Full=13-hydroxylupanine O-tigloy...  68.9    1e-10   
ref|XP_010557037.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  68.9    2e-10   
gb|AFK34239.1|  unknown                                               68.9    2e-10   
ref|XP_004151858.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  68.9    2e-10   
gb|ABN48480.1|  quinolizidine alkaloid O-tigloyltransferase           68.9    2e-10   
emb|CDY43121.1|  BnaA05g32650D                                        68.6    2e-10   
gb|KJB82512.1|  hypothetical protein B456_013G199800                  68.6    2e-10   
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  68.6    2e-10   
gb|AES82601.2|  benzyl alcohol O-benzoyltransferase                   68.9    2e-10   
ref|XP_003626383.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  68.9    2e-10   
ref|XP_003626386.1|  Alcohol acetyltransferase                        68.6    2e-10   
ref|XP_010558858.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  68.2    3e-10   
ref|XP_011041077.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  67.8    4e-10   
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g           67.8    4e-10   
ref|XP_002461609.1|  hypothetical protein SORBIDRAFT_02g005330        67.8    4e-10   
ref|XP_004156786.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  67.8    5e-10   
ref|NP_001064025.2|  Os10g0105800                                     63.5    7e-10   
ref|NP_001042981.1|  Os01g0350000                                     67.0    8e-10   
gb|EAY73940.1|  hypothetical protein OsI_01825                        67.0    8e-10   
ref|XP_011046335.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  66.6    9e-10   
ref|XP_008670946.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  66.6    1e-09   
ref|XP_007147131.1|  hypothetical protein PHAVU_006G098300g           65.9    1e-09   
ref|XP_004963438.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  65.5    1e-09   
gb|EMT25680.1|  hypothetical protein F775_04430                       63.9    1e-09   
ref|XP_010689156.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  66.2    1e-09   
gb|EEE63219.1|  hypothetical protein OsJ_18029                        65.5    2e-09   
ref|XP_010420482.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  65.9    2e-09   
gb|AAT01406.1|  hypothetical protein                                  65.9    2e-09   
gb|EEE63107.1|  hypothetical protein OsJ_17915                        65.5    2e-09   
gb|EYU41388.1|  hypothetical protein MIMGU_mgv1a021683mg              65.5    2e-09   
ref|XP_004960441.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  65.5    2e-09   
gb|AAV32163.1|  hypothetical protein                                  65.5    2e-09   
ref|XP_006370913.1|  hypothetical protein POPTR_0019s01680g           65.5    2e-09   
ref|XP_008677983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  65.5    2e-09   
ref|NP_186998.1|  acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase       65.5    2e-09   
ref|XP_010676999.1|  PREDICTED: methanol O-anthraniloyltransferas...  63.9    3e-09   
ref|XP_010453953.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  65.5    3e-09   
gb|ABK24347.1|  unknown                                               62.4    3e-09   
ref|XP_008660766.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  65.1    3e-09   
gb|KJB82513.1|  hypothetical protein B456_013G199900                  65.1    3e-09   
ref|XP_010668238.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  62.8    3e-09   
ref|XP_010231737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  64.7    4e-09   
gb|EMT11617.1|  hypothetical protein F775_02272                       62.8    4e-09   
gb|EEE62279.1|  hypothetical protein OsJ_17067                        64.7    4e-09   
ref|XP_010238931.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  62.0    4e-09   
ref|XP_006370207.1|  hypothetical protein POPTR_0001s40640g           62.8    5e-09   
ref|NP_001054603.1|  Os05g0141300                                     64.3    5e-09   
ref|XP_008662941.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  64.3    5e-09   
gb|EAY96502.1|  hypothetical protein OsI_18404                        64.3    5e-09   
ref|XP_007147133.1|  hypothetical protein PHAVU_006G098500g           64.3    6e-09   
ref|XP_010527080.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  64.3    6e-09   
ref|XP_007147132.1|  hypothetical protein PHAVU_006G098400g           64.3    6e-09   
ref|XP_002884383.1|  chat-3-HEXEN-1-OL ACETYLTRANSFERASE              63.9    7e-09   
gb|AAS55785.1|  putative benzyl alcohol benzoyl transferase           63.9    8e-09   
ref|XP_006400294.1|  hypothetical protein EUTSA_v10013454mg           63.9    8e-09   
ref|XP_009130369.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  63.5    9e-09   
gb|AAM61186.1|  putative hypersensitivity-related gene                63.5    1e-08   
emb|CDM80509.1|  unnamed protein product                              63.5    1e-08   
ref|XP_010435703.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  61.2    1e-08   
gb|KFK23348.1|  hypothetical protein AALP_AAs43670U000100             61.6    1e-08   
gb|KFK38055.1|  hypothetical protein AALP_AA3G064400                  63.2    2e-08   
ref|XP_006297655.1|  hypothetical protein CARUB_v10013677mg           62.8    2e-08   
gb|EAY77467.1|  hypothetical protein OsI_32511                        62.8    2e-08   
ref|XP_002440560.1|  hypothetical protein SORBIDRAFT_09g003170        62.4    2e-08   
emb|CDY43120.1|  BnaA05g32660D                                        62.4    2e-08   
emb|CDY50709.1|  BnaC05g47740D                                        62.4    2e-08   
ref|XP_010550257.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  62.4    2e-08   
ref|XP_006661593.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  62.4    2e-08   
ref|XP_002298960.2|  hypothetical protein POPTR_0001s45190g           62.4    2e-08   
gb|EMT02922.1|  10-deacetylbaccatin III 10-O-acetyltransferase        62.0    2e-08   
ref|XP_010417470.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  61.2    3e-08   
ref|XP_010521555.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  62.0    3e-08   
ref|XP_008362881.1|  PREDICTED: methanol O-anthraniloyltransferas...  62.0    3e-08   
ref|XP_010492712.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  62.0    3e-08   
gb|KJB78759.1|  hypothetical protein B456_013G017100                  61.2    4e-08   
gb|KFK25975.1|  hypothetical protein AALP_AA8G187200                  61.6    5e-08   
emb|CDY11732.1|  BnaC06g13400D                                        61.2    5e-08   
ref|XP_002298956.2|  hypothetical protein POPTR_0001s45160g           61.2    6e-08   
gb|EEE61303.1|  hypothetical protein OsJ_15395                        61.2    6e-08   
emb|CAH67336.1|  OSIGBa0157A06.5                                      60.8    7e-08   
ref|XP_011041078.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  60.8    8e-08   
emb|CAE04720.1|  OSJNBa0043L24.8                                      60.8    8e-08   
emb|CDX70765.1|  BnaC03g08490D                                        60.1    8e-08   
ref|XP_010489657.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  60.8    8e-08   
gb|KJB70701.1|  hypothetical protein B456_011G088000                  60.5    1e-07   
ref|XP_002300497.2|  hypothetical protein POPTR_0001s45180g           60.5    1e-07   
ref|XP_009125170.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  60.5    1e-07   
gb|KJB70702.1|  hypothetical protein B456_011G088000                  60.5    1e-07   
ref|XP_010453955.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  60.5    1e-07   
emb|CDX67482.1|  BnaA07g15220D                                        60.5    1e-07   
ref|XP_006290244.1|  hypothetical protein CARUB_v100037961mg          59.7    1e-07   
ref|NP_197256.1|  HXXXD-type acyl-transferase family protein          60.5    1e-07   
gb|EMT30746.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase     60.1    1e-07   
gb|KFK25971.1|  hypothetical protein AALP_AA8G186800                  60.5    1e-07   
gb|EMT07805.1|  10-deacetylbaccatin III 10-O-acetyltransferase        60.1    1e-07   
ref|NP_568587.2|  omega-hydroxypalmitate O-feruloyl transferase       60.1    1e-07   
ref|NP_001148135.1|  taxadien-5-alpha-ol O-acetyltransferase          59.7    2e-07   
ref|NP_851111.1|  omega-hydroxypalmitate O-feruloyl transferase       59.7    2e-07   
gb|ACR36326.1|  unknown                                               59.7    2e-07   
ref|XP_006388975.1|  hypothetical protein POPTR_0065s002301g          59.3    2e-07   
ref|XP_010450574.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  59.7    2e-07   
ref|XP_010441266.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  59.7    2e-07   
ref|XP_006405403.1|  hypothetical protein EUTSA_v10027756mg           59.7    2e-07   
ref|XP_004951311.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  59.3    2e-07   
gb|KFK33037.1|  hypothetical protein AALP_AA6G322400                  59.3    2e-07   
ref|XP_010436740.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  59.3    2e-07   
ref|XP_006283644.1|  hypothetical protein CARUB_v10004701mg           59.3    2e-07   
ref|XP_010109027.1|  Benzyl alcohol O-benzoyltransferase              59.3    3e-07   
emb|CDX78752.1|  BnaA03g06640D                                        59.3    3e-07   
ref|XP_010679985.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  58.9    3e-07   
ref|XP_009131598.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase    58.9    3e-07   
gb|KCW88667.1|  hypothetical protein EUGRSUZ_A01023                   58.9    3e-07   
ref|XP_010528158.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  58.9    3e-07   
ref|XP_010450554.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase    58.9    3e-07   
ref|XP_002272487.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   58.9    3e-07   
ref|XP_010045752.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  58.9    3e-07   
ref|XP_010067791.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  58.9    3e-07   
ref|XP_010528157.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  58.9    3e-07   
ref|XP_010436043.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  58.9    3e-07   
emb|CDY48963.1|  BnaA04g10770D                                        58.5    4e-07   
gb|EAY77620.1|  hypothetical protein OsI_32662                        58.2    4e-07   
ref|XP_009140062.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  58.5    4e-07   
ref|XP_007147134.1|  hypothetical protein PHAVU_006G098600g           58.5    5e-07   
gb|EAZ04276.1|  hypothetical protein OsI_26418                        58.5    5e-07   
ref|NP_001059940.1|  Os07g0550600                                     58.2    5e-07   
emb|CDY68497.1|  BnaCnng59260D                                        58.2    6e-07   
ref|XP_002870657.1|  transferase family protein                       58.2    6e-07   
ref|XP_011040637.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  58.2    6e-07   
gb|EYU41397.1|  hypothetical protein MIMGU_mgv1a024853mg              57.8    8e-07   
gb|KFK38057.1|  hypothetical protein AALP_AA3G064500                  58.2    8e-07   
gb|KFK38056.1|  hypothetical protein AALP_AA3G064500                  58.2    8e-07   
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase    57.4    1e-06   
ref|XP_010420481.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  57.4    1e-06   
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  57.0    1e-06   
ref|NP_001167754.1|  uncharacterized protein LOC100381444             56.6    1e-06   
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  57.0    1e-06   
gb|AAL01169.1|AC079843_9  Putative hsr201 hypersensitivity-relate...  56.2    2e-06   
gb|EYU41399.1|  hypothetical protein MIMGU_mgv11b015258mg             54.7    2e-06   
ref|XP_006377894.1|  hypothetical protein POPTR_0011s15660g           56.6    2e-06   
gb|AAP51790.2|  Transferase family protein                            56.6    2e-06   
ref|XP_010554116.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  56.6    2e-06   
ref|NP_001064111.1|  Os10g0133500                                     56.6    2e-06   
tpg|DAA46610.1|  TPA: hypothetical protein ZEAMMB73_163572            56.6    2e-06   
gb|AFG49897.1|  hypothetical protein 0_9164_01                        53.9    2e-06   
ref|XP_010112404.1|  Omega-hydroxypalmitate O-feruloyl transferase    56.2    3e-06   
emb|CDP09539.1|  unnamed protein product                              56.2    3e-06   
gb|EEE62389.1|  hypothetical protein OsJ_17179                        55.8    3e-06   
emb|CAN74177.1|  hypothetical protein VITISV_029256                   55.8    4e-06   
ref|XP_001772486.1|  predicted protein                                55.1    6e-06   
ref|XP_010557036.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  55.1    7e-06   
ref|XP_006289628.1|  hypothetical protein CARUB_v10003180mg           54.7    8e-06   
gb|KDP39569.1|  hypothetical protein JCGZ_02589                       54.3    9e-06   



>emb|CDP21408.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+RP+ YA+EL+ +AK  V+ DY+KSV D +VI GRP  +V+R  +VSD+++IG 
Sbjct  152  TAGELCKRPLGYALELVTKAKGDVTEDYMKSVADLMVIKGRPHFTVVRTCVVSDVTQIGF  211

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG         G   A  G      P +N + E+  +VPI LP  +M  F RE+
Sbjct  212  NEVDFGWGRPEYGGPAKGGVGAIPGVVSFYIPVTNKNGEKGRVVPICLPGFAMDRFVREL  271

Query  190  KKMTKFN  170
            +K+   N
Sbjct  272  EKLLSNN  278



>gb|AAW51125.1| putative alcohol acyl-transferases [Cucumis melo]
Length=459

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+R+AK  V+ DY+KSV D +VI GRP  +V+R  LVSD++R G 
Sbjct  315  TAGKLCQNPLGYALELVRKAKADVTEDYMKSVADLMVIKGRPHFTVVRTYLVSDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            E +DFGWG A+Y G A    GA         P  N   ER +LVP+ LP  +M  F +E+
Sbjct  375  EDVDFGWGKAMYGGPAKGGVGAIPGVASFYIPFKNKKGERGILVPLCLPAPAMERFVKEL  434

Query  190  KKMTK  176
              + K
Sbjct  435  DALLK  439



>ref|XP_008462816.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=459

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+R+AK  V+ DY+KSV D +VI GRP  +V+R  LVSD++R G 
Sbjct  315  TAGKLCQNPLGYALELVRKAKADVTEDYMKSVADLMVIKGRPHFTVVRTYLVSDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            E +DFGWG A+Y G A    GA         P  N   ER +LVP+ LP  +M  F +E+
Sbjct  375  EDVDFGWGKAMYGGPAKGGVGAIPGVASFYIPFKNKKGERGILVPLCLPAPAMERFVKEL  434

Query  190  KKMTK  176
              + K
Sbjct  435  DALLK  439



>ref|XP_004243496.2| PREDICTED: benzyl alcohol O-benzoyltransferase [Solanum lycopersicum]
Length=485

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+++AK+ V+ +Y+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  342  TAAKLCKNPLGYALELVKKAKSDVTEEYMKSVADLMVMKGRPHFTVVRTYLVSDVTRAGF  401

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A    GA         P  N + E  ++VP+ LP  +M IF RE+
Sbjct  402  GEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFKNKNGENGIVVPVCLPAFAMEIFVREL  461

Query  190  KKMTK  176
              M K
Sbjct  462  NGMLK  466



>ref|XP_004243495.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P+ YA+EL+++AK+ V+ +Y+KSV D +VINGRP  +V+R  LVSD++R G 
Sbjct  329  TAEKLVKNPLGYALELVKKAKSDVTEEYMKSVADLMVINGRPHFAVVRTFLVSDVTRAGF  388

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG         G      G      P  N + E  ++VP+ LP  +M IF +EI
Sbjct  389  GEVDFGWGKPVYGGPAKGGVGPFPGMASFYIPFRNKNGENGIVVPMCLPAFAMEIFVKEI  448

Query  190  KKMTK  176
            ++M K
Sbjct  449  ERMLK  453



>gb|AEM43830.1| alcohol acyl transferase [Fragaria x ananassa]
Length=391

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 84/121 (69%), Gaps = 4/121 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSV--MRNILVSDISRI  365
            TA+ LC  P+ YA+EL++++K K+S +Y++S +DF+ + GRP  ++  M + LVSD +R 
Sbjct  271  TAERLCNSPLGYAVELVKKSKAKMSEEYLRSAIDFVEVRGRPPFALEGMSDFLVSDNTRT  330

Query  364  GLEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKK  185
            GL +IDFG+G  +YAG A +    +F  R  S +  ER +LVP+ LP LSM IF++E+KK
Sbjct  331  GLGEIDFGFGKPVYAGVAKSTDLISFYVR--STNKEEREILVPVCLPILSMEIFQQELKK  388

Query  184  M  182
            M
Sbjct  389  M  389



>emb|CDP18599.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+RP+ YA+EL+ +AK  V+ DY+KSV D +VI GRP  + +R  +VSD++RIG 
Sbjct  319  TAGELCKRPLGYALELVTKAKGDVTEDYMKSVADLMVIKGRPHFTAVRTYVVSDVTRIGF  378

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG         G   A  G      P +N + E+  +VPI LP  +M  F RE+
Sbjct  379  NEVDFGWGRPEYGGPAKGGVGAIPGLLSFYIPVTNRNGEKGRVVPICLPGFAMDRFVREL  438

Query  190  KKMTKFN  170
            +K+   N
Sbjct  439  EKLLSNN  445



>emb|CDP21409.1| unnamed protein product [Coffea canephora]
Length=456

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+RP+ YA+EL+ ++K  V+ DY+KSV D +VI GRP  +V+R  LVSD++R G 
Sbjct  315  TAGELCKRPLGYALELVNKSKCDVTEDYMKSVADLMVIKGRPHFTVVRTYLVSDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG   Y G A    GA         P  N + E+ ++VPI LP  +M  F RE+
Sbjct  375  NEVDFGWGKPAYGGPAKGGVGAIPGVASFYIPFKNKNGEKGIVVPICLPGFAMDAFVREL  434

Query  190  KKMTKFN  170
            + +   N
Sbjct  435  ENLLSKN  441



>ref|XP_006446261.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
 gb|ESR59501.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
Length=447

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNI--LVSDISRIGLEK  353
            LC  P+ YA+EL++E K KVS +Y++SV D +V  GRP  + M ++  +VSD +R G E+
Sbjct  329  LCGSPLGYAVELVKEGKAKVSEEYIRSVADLMVTRGRPVPTTMGDLYFIVSDTTRTGFEE  388

Query  352  IDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            IDFGWG  ++AG A  A   +F    +  +  ER ++VPI LP  +M  F+ EIKKMT
Sbjct  389  IDFGWGKPMFAGIAGCALFISFYVNYQKKNDCERGIVVPIRLPFSAMERFQEEIKKMT  446



>ref|XP_004151058.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 ref|XP_004164522.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63337.1| hypothetical protein Csa_2G431070 [Cucumis sativus]
Length=459

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+R+AK  V+ +Y+KSV D ++I GRP  +V+R+ LVSD++R G 
Sbjct  315  TAGKLCQNPLGYALELVRKAKADVTEEYMKSVADLMMIKGRPHFTVVRSYLVSDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            E +DFGWG A Y G A    GA         P  N   ER +LVP+ LP  +M  F +E+
Sbjct  375  EDVDFGWGKATYGGPAKGGVGAIPGVASFYIPFKNKKEERGILVPLCLPAPAMERFVKEL  434

Query  190  KKMTK  176
              + K
Sbjct  435  DALLK  439



>ref|XP_002266420.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +YVKSV D +VI GRP  +   N L+SD++R G+ 
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADHMVIKGRPSFTQPGNYLISDVTRAGIG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y G A A    +F  R + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  381  EIDFGWGKPVYGGVARALSNISFCMRFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  439



>emb|CBI37442.3| unnamed protein product [Vitis vinifera]
Length=475

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +YVKSV D +VI GRP  +   N L+SD++R G+ 
Sbjct  345  AGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADHMVIKGRPSFTQPGNYLISDVTRAGIG  404

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y G A A    +F  R + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  405  EIDFGWGKPVYGGVARALSNISFCMRFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  463



>gb|ABX57719.1| acyltransferase [Vanda hybrid cultivar]
Length=447

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC RP+ YA+EL++ AK++VS DY+ SV D++V+ GRP  +V+R  ++SD++R G 
Sbjct  318  TAGELCSRPLDYAVELVKRAKSQVSGDYLHSVADYMVMKGRPHFTVVRTYVISDLTRAGF  377

Query  358  EKIDFGWGDaiyagsataaygaT------FLERPKSNSSTERSVLVPISLPHLSMLIFKR  197
              +DFGWG  +Y G A    G +      F+  P  N+S E+ ++VPI LP  +M  F  
Sbjct  378  GDVDFGWGKPVYGGPAKGGVGVSPGVFNFFI--PFVNASGEKGIVVPICLPPPAMRRFVA  435

Query  196  EIKKM  182
            EI+ +
Sbjct  436  EIQSL  440



>emb|CAN68818.1| hypothetical protein VITISV_012041 [Vitis vinifera]
Length=451

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +YVKSV D +VI GRP  +   N L+SD++R G  
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVIKGRPSFTQPGNYLISDLTRAGFG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y G A A    +F  R + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  381  EIDFGWGKPVYGGIARALSNISFCMRFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  439



>ref|XP_002270962.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
 emb|CBI37440.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +YVKSV D +VI GRP  +   N L+SD++R G  
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVIKGRPSFTQPGNYLISDLTRAGFG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y G A A    +F  R + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  381  EIDFGWGKPVYGGIARALSNISFCMRFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  439



>emb|CAN69458.1| hypothetical protein VITISV_024175 [Vitis vinifera]
Length=333

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +Y+KSV D +VI GRP  +   N LVSDI+R+G  
Sbjct  203  AGILCKNPLEYAIRLLKKAKAEMSQEYMKSVADLMVIKGRPSFTQPGNYLVSDITRVGFG  262

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++DFGWG  +Y G A      +F  R  +NS  E   ++PI LP   M  F++E+K+MT+
Sbjct  263  EVDFGWGKPVYGGGARVLSIFSFCMR-FTNSKGEEGNVIPICLPPPIMERFEQELKRMTE  321



>ref|XP_010644207.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=396

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +Y+KSV D +VI GRP  +   N LVSDI+R+G  
Sbjct  266  AGILCKNPLEYAIRLLKKAKAEMSQEYMKSVADLMVIKGRPSFTQPGNYLVSDITRVGFG  325

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++DFGWG  +Y G A      +F  R  +NS  E   ++PI LP   M  F++E+K+MT+
Sbjct  326  EVDFGWGKPVYGGGARVLSIFSFCMR-FTNSKGEEGNVIPICLPPPIMERFEQELKRMTE  384



>ref|XP_009368754.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 79/121 (65%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVM-RNILVSDISRIG  362
            TA+LLC  P+ YA+EL+REAKNK++ DY+KSV D L + G P +++   N ++SD +R G
Sbjct  324  TAQLLCNSPLEYAVELVREAKNKMNEDYIKSVADLLTLRGWPPLTLAGNNFILSDNTRTG  383

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            + ++DFGWG  I AG A +    +F  R  SN   +  +LVP+ LP   M   ++E+K++
Sbjct  384  VGEVDFGWGKPIIAGPAKSVNLISFYVR-DSNQEKDYGILVPMCLPFWCMKKIEQELKRI  442

Query  181  T  179
            T
Sbjct  443  T  443



>emb|CAN69948.1| hypothetical protein VITISV_009219 [Vitis vinifera]
Length=451

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +YVKSV D +VI GRP  +   N L+SD++R G  
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVIKGRPSFTQPGNYLISDLTRAGFG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y G A A    +F  R + NS  E   ++PI LP   M  F+ E+K+MTK
Sbjct  381  EIDFGWGKPVYGGIARALSNISFCMRFR-NSKGEEGNVIPICLPPPVMERFEEELKRMTK  439



>gb|KDO54864.1| hypothetical protein CISIN_1g041010mg [Citrus sinensis]
Length=297

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNI--LVSDISRIGLEK  353
            LC  P+ YA+EL++E K KVS +Y++SV D +V  GRP  + M ++  +VSD +R G E+
Sbjct  179  LCGSPLGYAVELVKEGKAKVSEEYIRSVADLMVTRGRPVPTTMGDLYFIVSDTTRTGFEE  238

Query  352  IDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            IDFGWG  ++AG A  A   +F    +  +  E  ++VPI LP  +M  F+ EIKKMT
Sbjct  239  IDFGWGKPMFAGIAGCALFISFYVNYQKKNDGECGIVVPIRLPFSAMERFQEEIKKMT  296



>ref|XP_010665859.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=296

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKN-KVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIG  362
            TA  LC  PI YA+EL++ +K+   S +YVKS +D++VI GRP  +V+RN +VSD++R+G
Sbjct  151  TAAKLCINPIEYALELVKNSKSTATSQEYVKSTIDYMVIKGRPHFTVVRNFVVSDLTRVG  210

Query  361  LEKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
             +K+D+GWG   Y G A A  GA    +    P  N + E+ ++VPI LP  +M +F +E
Sbjct  211  FDKLDYGWGQPAYGGLAKAGVGAIPGVSSCHIPFKNRNGEKGIVVPICLPKNAMDLFVKE  270

Query  193  IKKM  182
            + ++
Sbjct  271  LNRL  274



>gb|KDP30452.1| hypothetical protein JCGZ_17140 [Jatropha curcas]
Length=286

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = -2

Query  529  LLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKI  350
            LLC+ P+ YA+EL++  KN++S +YVKSV+D LVI+G+PR +   N L  D+   GL K+
Sbjct  154  LLCKNPLGYALELVKNCKNQLSEEYVKSVIDLLVISGKPRYAQGLNFLSVDVRNSGLAKV  213

Query  349  DFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            DFGWG+ +YAG   A    +   R K NS  E  ++ PI LP   M  F+ E+ K+T
Sbjct  214  DFGWGNPVYAGPTGAFPYISIFARFK-NSKAEDGIVFPIWLPEPVMQRFQDELMKLT  269



>emb|CAN72252.1| hypothetical protein VITISV_017467 [Vitis vinifera]
Length=451

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YA+ L+++AK ++S +YVKSV D +VI GRP      N +V+D++R G  
Sbjct  321  AGMLCKNPLEYAVRLVKKAKAEMSQEYVKSVADLMVIKGRPSFMHPGNYMVADVTRDGSG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y+G A A    +F  R + NS  E   ++PI LP   M  F++EIKKMTK
Sbjct  381  EIDFGWGKPVYSGLARAISIISFCARFR-NSKGEEGNVIPICLPPPVMEKFEQEIKKMTK  439



>gb|KJB82262.1| hypothetical protein B456_013G185500 [Gossypium raimondii]
Length=454

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 77/125 (62%), Gaps = 6/125 (5%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC+ P+ Y++EL+++AKN V+ +Y+KS+ D +VI GRP  +V+R+ LVSD++R G +
Sbjct  316  AGKLCQNPLGYSLELVKQAKNDVTEEYMKSLADLMVIKGRPHFTVIRSYLVSDVTRAGFD  375

Query  355  KIDFGWGDa-----iyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              DFGWG A        G       A+FL  P  N   E  +++PI+LP  +M IF +E+
Sbjct  376  DADFGWGKAVYGGPAKGGVGAIPGVASFL-IPFKNKKGEAGIVLPITLPARAMEIFVKEL  434

Query  190  KKMTK  176
              M K
Sbjct  435  DGMLK  439



>ref|XP_002265049.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YA+ L+++AK ++S +YVKSV D +VI GRP      N +V+D++R G  
Sbjct  321  AGMLCKNPLEYAVRLVKKAKAEMSQEYVKSVADLMVIKGRPSFMHPGNYMVADVTRDGSG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y+G A A    +F  R + NS  E   ++PI LP   M  F++EIKKMTK
Sbjct  381  EIDFGWGKPVYSGLARAISIISFCARFR-NSKGEEGNVIPICLPPPVMERFEQEIKKMTK  439



>ref|XP_008356442.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 79/121 (65%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVM-RNILVSDISRIG  362
            TA+LLC  P+ YA++L+REAKNK++ DY+KSV D L + G P +++   N ++SD +R G
Sbjct  324  TAELLCNSPLEYAVQLVREAKNKMNEDYIKSVADLLALRGWPPLTLAGNNFILSDNTRTG  383

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            + ++DFGWG  I AG A +    +F  R  SN   +  +LVP+ LP   M   ++E+K++
Sbjct  384  VGEVDFGWGKPIIAGPAKSVNLISFYVR-DSNQEKDYGILVPMCLPFWCMEKIEQELKRI  442

Query  181  T  179
            T
Sbjct  443  T  443



>emb|CBI37443.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YA+ L+++AK ++S +YVKSV D +VI GRP      N +V+D++R G  
Sbjct  321  AGMLCKNPLEYAVRLVKKAKAEMSQEYVKSVADLMVIKGRPSFMHPGNYMVADVTRDGSG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y+G A A    +F  R + NS  E   ++PI LP   M  F++EIKKMTK
Sbjct  381  EIDFGWGKPVYSGLARAISIISFCARFR-NSKGEEGNVIPICLPPPVMERFEQEIKKMTK  439



>ref|XP_006470742.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=447

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNI--LVSDISRIGLEK  353
            LC  P+ YA+EL++E K KVS +Y++SV D +V  GRP  + M ++  +VSD +R G E+
Sbjct  329  LCGSPLGYAVELVKEGKAKVSEEYIRSVADLMVTRGRPVPTTMGDLYFIVSDTTRTGFEE  388

Query  352  IDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            IDFGWG  ++AG A  A   +F    +  +  E  ++VPI LP  +M  F+ EIKKMT
Sbjct  389  IDFGWGKPMFAGIAGCALFISFYVNYQKKNDGECGIVVPIRLPFSAMERFQEEIKKMT  446



>gb|KCW72707.1| hypothetical protein EUGRSUZ_E01159 [Eucalyptus grandis]
Length=401

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA+EL+++AK  VS +YV+S  D LV+ GRP+ + + N LV+D +++G E
Sbjct  263  AGYLCNSPLGYAVELVKKAKEMVSEEYVRSSFDVLVLKGRPKYTTVWNYLVADATKVGFE  322

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            + DFGWG   Y G A A    +F  + ++    E  ++VPI LP  +M  F+ E+ KMT
Sbjct  323  EADFGWGKPAYGGVAGAFPLISFYVKYRTRKG-EEGIVVPIMLPERAMRRFQEELAKMT  380



>ref|XP_002266114.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
Length=451

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +YVKSV D +VI GRP  +   N L+SD++R G  
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVIKGRPSFTQPGNYLISDLTRAGFG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +IDFGWG  +Y G A A    +F  R + NS  E   ++PI LP      F++E+K+MTK
Sbjct  381  EIDFGWGKPVYGGIARALSNISFCMRFR-NSKGEEGNVIPICLPPPVTERFEQELKRMTK  439



>ref|XP_009365780.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVM-RNILVSDISRIG  362
            TA+LLC  P+ YA+EL+REAKNK++ DY+KSV D L + G P +++   N ++SD +R G
Sbjct  324  TAELLCNSPLEYAVELVREAKNKMNEDYIKSVADLLALRGWPPLTLAGNNFILSDNTRTG  383

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            + ++DFGWG  I AG A +    +F  R  SN   +  +L P+ LP   M   ++E+K++
Sbjct  384  VGEVDFGWGKPIIAGPAKSVNLISFYVR-DSNQEKDYKILAPMCLPFWCMEKIEQELKRI  442

Query  181  T  179
            T
Sbjct  443  T  443



>gb|AAT68601.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Petunia 
x hybrida]
 gb|AAU06226.1| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase [Petunia 
x hybrida]
Length=460

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ LC+ P+ YA+EL+++ K+ V+ +Y+KSV D +VI GRP  +V+R  LVSD++R G 
Sbjct  319  TAEKLCKNPLGYALELVKKTKSDVTEEYMKSVADLMVIKGRPHFTVVRTYLVSDVTRAGF  378

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A+Y G A    GA         P  N   E  ++VPI LP  +M  F +E+
Sbjct  379  GEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFRNKKGENGIVVPICLPGFAMEKFVKEL  438

Query  190  KKMTK  176
              M K
Sbjct  439  DSMLK  443



>ref|XP_002265841.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
 emb|CBI37446.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +Y+KSV D +VI GRP  +   N  VSD++R G  
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYIKSVADLMVIKGRPSFTQPGNYFVSDVTRAGFG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +++FGWG  +Y G A A    +F  R + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  381  EVNFGWGKPVYGGLARALSIISFCTRFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  439



>emb|CAN74729.1| hypothetical protein VITISV_042062 [Vitis vinifera]
Length=451

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +Y+KSV D +VI GRP  +   N  VSD++R G  
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYIKSVADLMVIKGRPSFTQPGNYFVSDVTRAGFG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            +++FGWG  +Y G A A    +F  R + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  381  EVNFGWGKPVYGGLARALSIISFCTRFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  439



>ref|XP_007029776.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10278.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=540

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 54/121 (45%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T   LC+ P+ YAIEL+++ K KV+ +Y+KS  DFLV  GRP +S+ R+ LVSD++R   
Sbjct  414  TVGKLCQNPLWYAIELVKQTKAKVTEEYMKSTADFLVTRGRPALSLTRSFLVSDVTRAKF  473

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            E +DFGWG A YAG A    G+  L  P +N   E  +++PI LP   M  F +E+  M 
Sbjct  474  EDVDFGWGKAAYAGQAKIMDGSHLL--PFTNKKGEDGIIMPICLPATLMERFVKELDSML  531

Query  178  K  176
            K
Sbjct  532  K  532



>ref|XP_010058386.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA+EL+++AK  VS +YV+S  D LV+ GRP+ + + N LV+D +++G E
Sbjct  345  AGYLCNSPLGYAVELVKKAKEMVSEEYVRSSFDVLVLKGRPKYTTVWNYLVADATKVGFE  404

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            + DFGWG   Y G A A    +F  + ++    E  ++VPI LP  +M  F+ E+ KMT
Sbjct  405  EADFGWGKPAYGGVAGAFPLISFYVKYRTRKG-EEGIVVPIMLPERAMRRFQEELAKMT  462



>ref|XP_010644575.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=445

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA+ L+++AK ++S +Y++SV +F+VI GRP  +   N ++SD +R+G +
Sbjct  320  AGELCNNPLGYAVNLVKKAKAEMSEEYIRSVANFMVIKGRPSYTRTGNFIISDNTRVGFQ  379

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            +IDFGWG  +Y G A A    +F  R + NS  E  V+VPI LP   M  F +E+K+M
Sbjct  380  EIDFGWGKPLYGGLAKAMSIISFCLRFR-NSKGEEGVVVPICLPLQVMERFGQEVKRM  436



>ref|XP_008462818.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=461

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P++YA+ELIR+AK K++ +Y+KSV DF+VINGRP ++ +R+  VSD+++   
Sbjct  318  TAGNLCQNPLSYAVELIRKAKAKMTEEYMKSVADFMVINGRPNLTAVRSYAVSDVTKTDF  377

Query  358  EKIDFGWG-----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            EK+DFGWG          G AT     +F    K N   E+ ++VP SLP  +M  F  E
Sbjct  378  EKLDFGWGKPIFGGPAMGGVATVPGLTSFYISYK-NKKGEQGIVVPFSLPVQAMERFVVE  436

Query  193  IKKMTK  176
            +  + K
Sbjct  437  LDAVFK  442



>ref|XP_007145940.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
 gb|ESW17934.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
Length=458

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 78/123 (63%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LCE P+ YA+EL+R+AK +VS +Y++S+ D +V  GRP  +V+R+ LVSD+ R G 
Sbjct  315  TAGKLCENPLGYALELVRKAKAEVSEEYMQSLADLMVTRGRPHFTVVRSYLVSDVRRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            E++DFGWG A+Y G A    GA         P  N   +  +++P+ LP  +ML F++E+
Sbjct  375  EEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFRNDKGDEGLVMPVCLPSEAMLRFEKEL  434

Query  190  KKM  182
              +
Sbjct  435  HSV  437



>ref|XP_010667725.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKN-KVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIG  362
            TA  LC  PI YA+EL++ +K+   S +YV+S +D++VI GRP  +V RN +VSD++R+G
Sbjct  331  TAAKLCINPIEYALELVKNSKSTATSQEYVRSTIDYMVIKGRPHFTVARNFVVSDLTRVG  390

Query  361  LEKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
             +K+D+GWG   Y G A A  GA         P  N   E+ ++VPI LP  +M +F +E
Sbjct  391  FDKLDYGWGQPAYGGLAKAGVGAIPGVLSCYVPFKNRHGEKGIVVPICLPQSAMDLFVKE  450

Query  193  IKKM  182
            + ++
Sbjct  451  LNRL  454



>ref|XP_008373466.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRM-SVMRNILVSDISRIGL  359
            A+LLC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP   S   N LVSD++R+G+
Sbjct  323  AELLCKNPLGYALELVKKAKATMNEEYLRSVADXLVLRGRPXYSSTGSNFLVSDLTRVGV  382

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  383  GDVNFGWGQPVFAGPAKAMDLISFYIQHKNN--TEDGILVPMCLPFSAMERFQQELERIT  440

Query  178  K  176
            +
Sbjct  441  Q  441



>ref|XP_011018694.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=461

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A+L+C+ P+ YA+EL+R+ K ++S +Y++SV D++VI GRP  S   + +V+D SR+   
Sbjct  324  AELVCKNPLGYALELVRKIKTQMSEEYMRSVADYMVIKGRPHYSTAGHFIVADSSRVPFR  383

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +IDFGWG  +YAG A AA   +F  R K  S+ E  +L+ +SLP  +M  F++E+ K T
Sbjct  384  EIDFGWGKPVYAGVAKAAPNTSFCVRFK-KSTGEDGILIQVSLPLQAMDRFEKELAKFT  441



>ref|XP_006446260.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
 gb|ESR59500.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
Length=445

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L +  + YA++L+++ K   S +YV+S++DF+ I GRP  +V  + +VSDI+R G 
Sbjct  324  TAGDLSKYSLGYALDLVKKVKATASEEYVRSLIDFMEIKGRPMPAVKGSFVVSDITRGGF  383

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            E+IDFGWG  +YAG   A    +F  + ++N S E   LVPI LP  +M  F+ E+KKMT
Sbjct  384  EEIDFGWGKPVYAGPPEAVLFMSFYIKYQNNDSGEYGTLVPICLPLRAMKKFEEELKKMT  443



>ref|XP_008373477.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=309

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRM-SVMRNILVSDISRIGL  359
            A+LLC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+  S   N LVSD++R+G+
Sbjct  178  AELLCKNPLGYALELVKKAKATMNEEYLRSVADHLVLRGRPQYSSTGSNFLVSDLTRVGV  237

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGW   ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  238  GDVNFGWEQPVFAGPAKAMDLISFYIQHKNN--TEDGILVPMCLPFSAMERFQQELERIT  295

Query  178  K  176
            +
Sbjct  296  Q  296



>ref|XP_006368247.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
 gb|ERP64816.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
Length=462

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A+L+C+ P+ YA+EL+R+ K ++S +Y++SV D++VI GRP  S   + +V+D SR+   
Sbjct  325  AELVCKNPLGYALELVRKIKTQMSEEYMRSVADYMVIKGRPHYSTAGHFIVADSSRVPFR  384

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +IDFGWG  +YAG A AA   +F  R K  S+ E  +L+ +SLP  +M  F++E+ K T
Sbjct  385  EIDFGWGKPVYAGVAKAAPNTSFCVRFK-KSTGEDGILIQMSLPLQAMDKFQKELAKFT  442



>ref|XP_006446721.1| hypothetical protein CICLE_v10017956mg [Citrus clementina]
 gb|ESR59961.1| hypothetical protein CICLE_v10017956mg [Citrus clementina]
Length=395

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMR-NILVSDISRIG  362
            TA+ LC+ PI YA+EL+++AK +++ +Y++SV D +VI GR   S  R N +VSD+  +G
Sbjct  256  TAEQLCKNPIGYAVELVKKAKAQMNEEYIRSVADLMVIKGRRIKSSTRGNFIVSDLRNVG  315

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            L  +DFGWG  IY G+A A    +F  + +S +  E  +LVPI LP  +M  F+ E+K++
Sbjct  316  LGDVDFGWGKPIYGGAAGAVAVFSFCVKYQSKNG-EPGILVPICLPQSAMERFQEELKRL  374

Query  181  T  179
            T
Sbjct  375  T  375



>ref|XP_003516503.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Glycine 
max]
Length=452

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC+ P+ YA+ LI++AK ++  +YVKSV D +V+ GRP+     N L+ D + +G  
Sbjct  317  AGLLCQSPLEYALGLIKKAKAQMGLEYVKSVADLMVLKGRPKYKTKENYLIGDTTHVGFY  376

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             +DFGWG  IY G A A    +F  R ++N   E  V+VPI LPH  M  F  E+ K+T
Sbjct  377  DVDFGWGSPIYGGPAGAIPFVSFYGRFRNNEG-EDGVVVPILLPHHVMKRFLFELVKIT  434



>ref|XP_008373476.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRM-SVMRNILVSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+  S   N LVSDI+R+G+
Sbjct  323  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSNFLVSDITRVGV  382

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  I+AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  383  GDVNFGWGQPIFAGPAKAMDLISFYIQHKNN--TEDGILVPMCLPFSAMERFQQELERIT  440



>ref|XP_007029780.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10282.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=475

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YAIEL+R+AK K++ +Y+KS  D +VI GRP ++ +R  +VSD++R   
Sbjct  339  TAGQLCQNPMEYAIELVRQAKAKITEEYMKSTADLMVIRGRPNVNTVRCFMVSDLTRAKF  398

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             + DFGWG+A +   A      +F   P  N   E  ++VP+ LP   M  F +E+  + 
Sbjct  399  READFGWGEAEFGEPAYGGDRISFY-IPSKNKEGEGGIVVPVCLPAPVMECFVKELDGIL  457

Query  178  KFN  170
              N
Sbjct  458  SNN  460



>ref|XP_010108951.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC20591.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=286

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC +P+ YA+EL+++AK +V+ +Y++SV D + I GRP  +V+R+ LVSD++  G 
Sbjct  148  TAGNLCAKPLGYALELVKKAKAEVTEEYMRSVADLMAIRGRPHFTVVRSYLVSDLTHAGF  207

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++D GWG         G   A  G      P +N + E+ V+VPI LP  +M  F +E+
Sbjct  208  GEVDLGWGKPVYGGSAKGGVGAIPGVASFYIPFTNKAGEKGVVVPICLPAPAMDRFVKEL  267

Query  190  KKMTK  176
            + + K
Sbjct  268  EALLK  272



>ref|XP_006470741.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L +  + YA++L+++ K   S +YV+S++DF+ I GRP  +V  + +VSDI+R G 
Sbjct  324  TAGDLSKYSLGYAVDLVKKVKATASEEYVRSLIDFMEIKGRPMPAVKGSFVVSDITRGGF  383

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            E+IDFGWG  +YAG   A    +F  R ++  S E   LVPI LP  +M  F+ E+KKMT
Sbjct  384  EEIDFGWGKPVYAGPPEAVLFMSFYIRYQNKDSGEYGTLVPICLPLRAMKKFEEELKKMT  443



>gb|KDO44967.1| hypothetical protein CISIN_1g0133461mg, partial [Citrus sinensis]
Length=293

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L +  + YA++L+++ K   S +YV+S++DF+ I GRP  +V  + +VSDI+R G 
Sbjct  172  TAGDLSKYSLAYAVDLVKKVKATASEEYVRSLIDFMEIRGRPMPAVKGSFVVSDITRGGF  231

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            E++DFGWG  +YAG   A    +F  + ++  S E   LVPI LP  +M  F+ E+KKMT
Sbjct  232  EEVDFGWGKPVYAGPPEAVLFMSFYIKYQNKDSGEYGTLVPICLPLRAMKKFEEELKKMT  291



>ref|XP_007029777.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
 gb|EOY10279.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
Length=471

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YAIEL+++ K  V+ +YVKSV DFL   GRP +S++R  LVSD      
Sbjct  336  TAGKLCQNPLGYAIELVKQTKKSVTEEYVKSVADFLATKGRPPVSLVRVYLVSDARHAKF  395

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              +DFGWG A+Y G A     +   + P  N   E  ++VPI LP  +M  F RE+ +M 
Sbjct  396  SDVDFGWGKAMYGGPAKGVVAS--FQIPHRNKKGENGLVVPIYLPASAMERFVRELNRML  453

Query  178  K  176
            K
Sbjct  454  K  454



>gb|EMT21730.1| 2-alpha-hydroxytaxane 2-O-benzoyltransferase [Aegilops tauschii]
Length=188

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC   + YA+EL+++AK+ V+ DY+ SV D +V+ GRP  ++ R  +VSD+S  G 
Sbjct  62   TAGELCAGGLGYALELVKKAKSAVTYDYLLSVADLMVLRGRPLFTLSRAYIVSDVSHTGF  121

Query  358  EKIDFGWGDaiyagsataa-----ygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + +DFGWG+A+Y G A            +  R K N   E   +VPISLP  +M  F+ E
Sbjct  122  KSVDFGWGEAVYGGPAKGGEGLIPAVTNYFSRSK-NGKGEEGTVVPISLPKDAMDKFQLE  180

Query  193  IKKMT  179
            ++ +T
Sbjct  181  VEGLT  185



>gb|KHN41759.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=469

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC+ P+ YA+ LI++AK ++  +YVKSV D +V+ GRP+     N L+ D + +G  
Sbjct  317  AGLLCQSPLEYALGLIKKAKAQMGLEYVKSVADLMVLKGRPKYKTKENYLIGDTTHVGFY  376

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             +DFGWG  IY G A A    +F  R ++N   E  V+VPI LPH  M  F  E+ K+T
Sbjct  377  DVDFGWGSPIYGGPAGAIPFVSFYGRFRNNEG-EDGVVVPILLPHHVMKRFLFELVKIT  434



>gb|KDP39568.1| hypothetical protein JCGZ_02588 [Jatropha curcas]
Length=459

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 76/125 (61%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L ++P+ +A+ELIRE K  V+ +Y++SV D +V+ GRP  +V+R+ LVSD++  G 
Sbjct  318  TAGELAQKPLGFALELIREVKRSVNEEYMRSVADLMVVKGRPHFTVVRSYLVSDVTHAGF  377

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A    GA         P  N   E  +++PI LP  +M IF +E+
Sbjct  378  GEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPSKNEKGENGIVLPIVLPAQAMEIFIKEL  437

Query  190  KKMTK  176
            K M +
Sbjct  438  KGMLQ  442



>emb|CAN77583.1| hypothetical protein VITISV_040970 [Vitis vinifera]
Length=451

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ YAI L+++AK ++S +YVKSV D +VI GRP  +   N ++SD++R G  
Sbjct  321  AGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVIKGRPLFTQPGNYIISDLTRAGFG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            + DFGWG  +Y G A A    +F  R + NS  E   ++PI LP      F++E+K+MTK
Sbjct  381  EXDFGWGKPVYGGXARALSXISFCMRFR-NSKGEEGNVIPICLPPPVXERFEQELKRMTK  439



>gb|KDO49560.1| hypothetical protein CISIN_1g036972mg [Citrus sinensis]
Length=275

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMR-NILVSDISRIG  362
            TA+ LC+ PI YA+EL+++AK +++ +Y++SV D +VI GR   S  R N +VSD+  +G
Sbjct  136  TAEQLCKNPIGYAVELVKKAKAQMNEEYIRSVADLMVIKGRRIKSSTRGNFIVSDLRNVG  195

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            L  +DFGWG  IY G+A A    +F  + +S +  E  +LVPI LP  +M  F+ E+K++
Sbjct  196  LGDVDFGWGKPIYGGAAGAVAVFSFCVKYQSKNG-EPGILVPICLPQSAMERFQEELKRL  254



>sp|Q3ZPN4.1|ACMAT_VITLA RecName: Full=Methanol O-anthraniloyltransferase; AltName: Full=Anthraniloyl-CoA:methanol 
acyltransferase; AltName: Full=Benzyl 
alcohol O-benzoyltransferase [Vitis labrusca]
 gb|AAW22989.1| anthraniloyal-CoA: methanol anthraniloyal transferase [Vitis 
labrusca]
Length=449

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ +AI L+++AK ++S +Y+KSV D +VI GRP  +   N  VSD++R GL 
Sbjct  321  AGMLCKNPLEFAIRLVKKAKAEMSQEYIKSVADLMVIKGRPLFTQPGNFTVSDVTRAGLG  380

Query  355  KIDFGWGDaiyagsataaygaTF--LERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            ++DFGWG  +Y G A A    +F  L R   NS  E   ++PI LP   M  F++E+K+M
Sbjct  381  EVDFGWGKPVYGGVARACPIISFRMLFR---NSKGEEGSVIPIWLPPPVMERFEQELKRM  437

Query  181  TK  176
            TK
Sbjct  438  TK  439



>ref|XP_007029787.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
 gb|EOY10289.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
Length=485

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ Y IEL+R+AK K++ +Y+KS  D +VI GRP ++ +R  +VSD++R   
Sbjct  330  TAGQLCQNPMEYGIELVRQAKAKITEEYMKSTADLMVIRGRPNVNTVRCFMVSDLTRAKF  389

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             ++DFGWG+A + G A      +F   P  N   E  ++VP+ LP   M  F +E+  + 
Sbjct  390  REVDFGWGEAEFGGPAYGGDRISFY-IPSKNKEGEGGIVVPVCLPAPVMESFVKELDGIL  448

Query  178  KFN  170
              N
Sbjct  449  SNN  451



>ref|XP_009759678.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=444

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC  P+ YA+EL+++ K+ ++ +Y++SV D +VI GRP +S   N +VSD    G +
Sbjct  314  AGLLCSSPLLYAVELVKKVKDHMNEEYIRSVADLMVIKGRPELSKSWNFVVSDNRSAGFD  373

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            ++DFGWG  I+ G   A    +F   P  N   E+ +L+ ISLP L+M  F+  + KMT
Sbjct  374  EVDFGWGKPIFGGVPKAISFISFC-VPVKNDKGEKGILIAISLPPLAMEKFQEVVYKMT  431



>ref|XP_009372579.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=461

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK  V+ +Y++S+ D +VI GRP  +V+ + LVSD++R G 
Sbjct  318  TAGRLCNNPLGYALELVRKAKADVTEEYMRSLADLMVIKGRPHFTVVNSYLVSDVTRAGF  377

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A    GA         P  ++  E  ++VPI LP  +M IF +E+
Sbjct  378  GEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRDNRGEDGIVVPICLPAAAMEIFVKEL  437

Query  190  KKM  182
              M
Sbjct  438  DAM  440



>ref|XP_004239236.1| PREDICTED: methanol O-anthraniloyltransferase-like [Solanum lycopersicum]
Length=448

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC  P+TYA+E+I++ K+ ++ +Y+KSV D +VI GRP++S   N ++SD    G +
Sbjct  318  AGLLCSNPLTYAVEMIKKLKDHMNEEYIKSVTDLIVIKGRPQLSKSWNFIISDNRSGGFD  377

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            K DFGWG+ I+ G   A    +F   P  N   E+ +L+ ISLP L+M  F+  +  +T
Sbjct  378  KFDFGWGEPIFGGVPKAVSLISF-GVPVKNERGEKGILIAISLPPLAMKKFQEVVYNLT  435



>ref|XP_007029786.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
 gb|EOY10288.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
Length=525

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ Y IEL+R+AK K++ +Y+KS  D +VI GRP ++ +R  +VSD++R   
Sbjct  338  TAGQLCQNPMEYGIELVRQAKAKITEEYMKSTADLMVIRGRPNVNTVRCFMVSDLTRAKF  397

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             ++DFGWG+A + G A      +F   P  N   E  ++VP+ LP   M  F +E+  + 
Sbjct  398  REVDFGWGEAEFGGPAYGGDRISFY-IPSKNKEGEGGIVVPVCLPAPVMESFVKELDGIL  456

Query  178  KFN  170
              N
Sbjct  457  SNN  459



>emb|CBI25251.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ +AI L+++AK ++S +Y+KSV D +VI GRP  +   N +VSD++R G+ 
Sbjct  292  AGMLCKNPLEFAIRLVKKAKAEMSQEYIKSVADLMVIKGRPLFTQPGNYIVSDVTRAGIG  351

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++DFGWG  +Y G A A+   +F    + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  352  EVDFGWGKPVYGGVAKASPIISFRMWFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  410



>ref|XP_002271603.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=449

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ +AI L+++AK ++S +Y+KSV D +VI GRP  +   N +VSD++R G+ 
Sbjct  321  AGMLCKNPLEFAIRLVKKAKAEMSQEYIKSVADLMVIKGRPLFTQPGNYIVSDVTRAGIG  380

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++DFGWG  +Y G A A+   +F    + NS  E   ++PI LP   M  F++E+K+MTK
Sbjct  381  EVDFGWGKPVYGGVAKASPIISFRMWFR-NSKGEEGNVIPICLPPPVMERFEQELKRMTK  439



>ref|XP_009386561.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=460

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC RP+ YA+EL++EAK+ V+ +Y++SV+D +V+ GRP   V  + LVSD +R GL
Sbjct  332  TAGELCARPVGYALELVKEAKSMVTEEYMRSVVDLMVLRGRPHYKVRGSYLVSDATRSGL  391

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            E +D+GWG  +Y G A     +        NS  E  V+VP  LP  +M  F  E++K+
Sbjct  392  ELVDYGWGKPLYGGPAWGRVASFHFR--FRNSKGEEGVVVPHYLPRTTMDKFAMELQKL  448



>gb|AIW04708.1| alcohol acyltransferase 1 [Solanum pennellii]
Length=442

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC  P+TYA+ELI++ K+ ++ +Y+KSV+D  VI GRP ++   N LVSD   IG +
Sbjct  318  AGLLCSNPVTYAVELIKKVKDHINEEYIKSVIDLTVIKGRPELTKSWNFLVSDNRYIGFD  377

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSM  212
            + DFGWG+ I+ G + A    +F    K N   E+ VL+ ISLP L+M
Sbjct  378  EFDFGWGNPIFGGISKATSFISFGVSVK-NDKGEKGVLIAISLPPLAM  424



>gb|AIC83790.1| alcohol acyltransferase [Actinidia deliciosa]
Length=456

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A ++   P+ YA+E +++AK +++ +Y++SV D +V  GRP  +V+ N +VSD++R+GL+
Sbjct  320  AGMISTSPLEYAMEGVKKAKARMTGEYLRSVADLMVTKGRPLYTVVGNYIVSDMTRVGLD  379

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             IDFGWG  +Y G A A    +F  R K N   E  ++V I LP  +M  F+ E+KKMT
Sbjct  380  TIDFGWGKPVYGGPARAFPLISFYGRFKDNKG-EDGIVVLICLPEAAMKRFQEELKKMT  437



>ref|XP_009803457.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Nicotiana sylvestris]
Length=415

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 74/125 (59%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+ YA+EL+++ K  V+ +Y+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  274  TAAKLSKNPLAYALELVKKTKTDVTEEYMKSVADLMVLKGRPHFTVVRTYLVSDVTRAGF  333

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A+Y G A    GA         P  N   E  ++VPI LP  +M  F +E+
Sbjct  334  REVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPICLPGFAMETFIKEL  393

Query  190  KKMTK  176
              M K
Sbjct  394  DGMLK  398



>ref|XP_004156760.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Cucumis sativus]
Length=461

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P++YA+ELIR+AK +++ +Y+KSV D +VINGRP ++ +R+  VSD+++  L
Sbjct  318  TAGNLCQNPLSYAVELIRKAKAEMTEEYMKSVADLMVINGRPNLTAVRSYAVSDVTKTDL  377

Query  358  EKIDFGWGDa-----iyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            EKIDFGWG+A        G AT     +F    K N   E+  +VP SLP  +M  F  E
Sbjct  378  EKIDFGWGEAIFGGPAMGGVATVPGLTSFYISFK-NXKGEQGTVVPFSLPVEAMERFVVE  436

Query  193  IKKMTK  176
            +    K
Sbjct  437  LDAAFK  442



>ref|XP_004151857.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63330.1| hypothetical protein Csa_2G429030 [Cucumis sativus]
Length=461

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P++YA+ELIR+AK +++ +Y+KSV D +VINGRP ++ +R+  VSD+++  L
Sbjct  318  TAGNLCQNPLSYAVELIRKAKAEMTEEYMKSVADLMVINGRPNLTAVRSYAVSDVTKTDL  377

Query  358  EKIDFGWGDa-----iyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            EKIDFGWG+A        G AT     +F    K N   E+  +VP SLP  +M  F  E
Sbjct  378  EKIDFGWGEAIFGGPAMGGVATVPGLTSFYISFK-NKKGEQGTVVPFSLPVEAMERFVVE  436

Query  193  IKKMTK  176
            +    K
Sbjct  437  LDAAFK  442



>gb|ACP31201.1| HRS201-like protein [Solanum melongena]
Length=212

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+++AK+ V+ DY+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  94   TAAKLCKNPLGYALELVKKAKSDVTEDYMKSVADLMVMKGRPHFTVVRTYLVSDVTRAGF  153

Query  358  EKIDFGWG  335
            +++DFGWG
Sbjct  154  DQVDFGWG  161



>ref|XP_002517500.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF45042.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=458

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A+ LC+ P+ YA+EL+R++K+K+S +Y++S +D + I GRP      N+L+ D+S +GL 
Sbjct  322  AEHLCKNPLGYAVELVRKSKSKMSEEYIRSTIDLMEIKGRPHYVTAWNLLLVDMSHVGLA  381

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
             +DFGWG+ +Y G   +    +   R K NS  E   +VP+ LP   M  F+ E  KMT+
Sbjct  382  DVDFGWGNPVYFGPTGSFPNISMFSRFK-NSKGENGFVVPMWLPRTVMEKFQDEFLKMTE  440



>ref|XP_009803456.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Nicotiana sylvestris]
Length=462

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 74/125 (59%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+ YA+EL+++ K  V+ +Y+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  321  TAAKLSKNPLAYALELVKKTKTDVTEEYMKSVADLMVLKGRPHFTVVRTYLVSDVTRAGF  380

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A+Y G A    GA         P  N   E  ++VPI LP  +M  F +E+
Sbjct  381  REVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPICLPGFAMETFIKEL  440

Query  190  KKMTK  176
              M K
Sbjct  441  DGMLK  445



>ref|XP_006470749.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L +  + YA++L+++ K   S +YV+S++DF+ I GRP  +V  + +VSDI+R G 
Sbjct  324  TAGDLSKYSLAYAVDLVKKVKATASEEYVRSLIDFMEIRGRPMPAVKGSFVVSDITRGGF  383

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            E++DFGWG  +YAG   A    +F  + ++  S E   LVPI LP  +M  F+ E+KKMT
Sbjct  384  EEVDFGWGKPVYAGPPEAVLFMSFYIKYQNKDSGEYGTLVPICLPLRAMEKFEEELKKMT  443



>ref|XP_009619718.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana tomentosiformis]
Length=460

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+ YA+EL+++ K+ V+ +Y+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  319  TAAKLSKNPLGYALELVKKTKSDVTEEYMKSVADLMVLKGRPHFTVVRTFLVSDVTRGGF  378

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A+Y G A    GA         P  N   E  ++VPI LP  +M  F +E+
Sbjct  379  GEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPICLPGFAMETFVKEL  438

Query  190  KKMTKFN  170
              M K +
Sbjct  439  DGMLKVD  445



>emb|CAA64636.1| hsr201 [Nicotiana tabacum]
Length=460

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+ YA+EL+++ K+ V+ +Y+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  319  TAAKLSKNPLGYALELVKKTKSDVTEEYMKSVADLMVLKGRPHFTVVRTFLVSDVTRGGF  378

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A+Y G A    GA         P  N   E  ++VPI LP  +M  F +E+
Sbjct  379  GEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPICLPGFAMETFVKEL  438

Query  190  KKMTKFN  170
              M K +
Sbjct  439  DGMLKVD  445



>sp|Q8GT20.1|BEBT_TOBAC RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
 gb|AAN09798.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
Length=460

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+ YA+EL+++ K+ V+ +Y+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  319  TAAKLSKNPLGYALELVKKTKSDVTEEYMKSVADLMVLKGRPHFTVVRTFLVSDVTRGGF  378

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A+Y G A    GA         P  N   E  ++VPI LP  +M  F +E+
Sbjct  379  GEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPICLPGFAMETFVKEL  438

Query  190  KKMTKFN  170
              M K +
Sbjct  439  DGMLKVD  445



>ref|XP_009368287.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=463

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 83/125 (66%), Gaps = 7/125 (6%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRM-SVMRNILVSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRPR  S   N LVSDI+R+G 
Sbjct  322  AESLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPRYSSTGSNFLVSDITRVGF  381

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              ++FGWG  ++AG   A   A    +F  + K+N  TE  +LVP+ LP  +M  F++E+
Sbjct  382  GDVNFGWGQPVFAGPTKAISAALDLISFYVQHKNN--TEDGILVPMCLPSSAMERFQQEL  439

Query  190  KKMTK  176
            +++T+
Sbjct  440  ERITQ  444



>gb|KHN04051.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=403

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T++ LCE P  YA+EL++ AK+ V  +YV+S  D +V+ GRP  +  R+ LVS+ +RIGL
Sbjct  262  TSRRLCENPFGYALELVKNAKSNVDEEYVRSTSDLIVVKGRPHQATTRSYLVSNTTRIGL  321

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            +++DFGWG         G  T+    T +     N   E  ++VPISLP  +M  F  E+
Sbjct  322  DEVDFGWGKPIYGGPATGGMTSFPQMTSVYVSCKNHKGEHVIVVPISLPAKAMERFATEL  381

Query  190  KKMTK  176
            + M +
Sbjct  382  EGMLR  386



>gb|ACU23519.1| unknown [Glycine max]
Length=191

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 72/125 (58%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T++ LCE P  YA+EL++ AK+ V  +YV+   D +V+ GRP  +  R+ LVS+ +RIGL
Sbjct  50   TSRRLCENPFGYALELVKNAKSNVDEEYVRFTSDLIVVKGRPHQATTRSYLVSNTTRIGL  109

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            +++DFGWG         G  T+    T +     N   E  ++VPISLP  +M  F  E+
Sbjct  110  DEVDFGWGKPIYGGPATGGITSFPQMTSVYVSCKNHKGEHVIVVPISLPAKAMERFATEL  169

Query  190  KKMTK  176
            + M +
Sbjct  170  EGMLR  174



>ref|XP_008359502.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=461

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK  V+ +Y++S+ D +VI GRP  +V+ + L+SD++R G 
Sbjct  318  TAGRLCNNPLGYALELVRKAKADVTEEYMRSLADLMVIKGRPHFTVVNSYLMSDVTRAGF  377

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A    GA         P  ++  E  ++VPI LP  +M IF +E+
Sbjct  378  GEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRDNRGEDGIVVPICLPAAAMEIFVKEL  437

Query  190  KKM  182
              M
Sbjct  438  DTM  440



>ref|XP_007029781.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10283.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=562

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/116 (40%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YAI+L+R+AK K++ +Y+KS  D +VI GRP ++ +R  +VSD++R   
Sbjct  426  TAGQLCQNPMEYAIQLVRQAKAKITEEYMKSTADLMVIRGRPNVNTVRCFMVSDLTRAKF  485

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG+A + G A      +F   P  N   E  ++VP+ LP   M  F +E+
Sbjct  486  REVDFGWGEAEFGGPAYGGDIISFY-IPSKNKEGEGGIVVPVCLPAPVMESFVKEL  540



>ref|XP_007029788.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10290.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=454

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 75/125 (60%), Gaps = 6/125 (5%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  L + P+ YA+EL+++AK  V+ +Y+KS+ D +VI GRP  +V+R+ LVSD++R G  
Sbjct  314  AGKLRQNPLGYALELVKQAKADVTEEYMKSLADLMVIRGRPHFTVVRSYLVSDVTRAGFG  373

Query  355  KIDFGWGDa-----iyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             +DFGWG A        G       A+FL  P  N   E  +++PI+LP  +M IF +E+
Sbjct  374  DVDFGWGKAVYGGPAKGGVGAIPGLASFL-IPSKNKKGEDGIVLPITLPPPAMEIFVKEL  432

Query  190  KKMTK  176
              M K
Sbjct  433  DGMLK  437



>gb|KHF99421.1| Benzyl alcohol O-benzoyltransferase [Gossypium arboreum]
Length=454

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC+ P+ Y++EL+++AKN V+ +Y+KS+ D +VI GRP  +V+R+ LVSD++     
Sbjct  316  AGKLCQNPLEYSLELVKQAKNDVTEEYMKSLADLMVIKGRPHFTVIRSYLVSDVTHARFG  375

Query  355  KIDFGWGDa-----iyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              DFGWG A        G       A+FL  P  N   E  V++PI+LP  +M IF +E+
Sbjct  376  DADFGWGKAVYGGPAKGGVGAIPGVASFL-IPVKNKKGEAGVVLPITLPARAMEIFVKEL  434

Query  190  KKMTK  176
              M K
Sbjct  435  DGMLK  439



>ref|XP_011007948.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=468

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC+ P+ YA+EL+   K +++ +Y+KSV D LV+ GRP  + + + L++D++R+GL 
Sbjct  339  AGLLCQSPLGYALELVTRLKTQMNEEYIKSVADLLVLKGRPHYTTVWSFLIADVTRVGLG  398

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              DFGWG+++Y G   A    +F      NS  E  +LVPI LP   M  F++E+
Sbjct  399  DFDFGWGNSVYGGPIGARPCTSFHVSGFKNSYGEEGILVPILLPLPIMNRFQQEL  453



>ref|XP_002304071.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
 gb|EEE79050.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
Length=454

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC+ P+ YA+EL+R  K +++ +Y+KS  D +V+ GRP  + + + L++D +R+GL 
Sbjct  325  AGLLCQSPLGYALELVRRLKTQMNEEYIKSAADLMVLKGRPHYTTVWSFLIADATRVGLG  384

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             IDFGWG A+Y G   A    +F      NS  E  +LVPI LP   M  F++E+
Sbjct  385  DIDFGWGKAVYGGPIGAPPCTSFHVSGLKNSYGEEGILVPILLPLPIMNRFQQEL  439



>ref|NP_001234496.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AAS48091.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AFD29888.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AGK82805.1| alcohol acyltransferase 3 [Solanum lycopersicum]
 gb|AIW04709.1| alcohol acyltransferase 1 [Solanum lycopersicum]
Length=442

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC  P+TYA+ELI++ K+ ++ +Y+KS++D +V  GRP ++   N LVSD   IG +
Sbjct  318  AGLLCSNPVTYAVELIKKVKDHINEEYIKSLIDLMVTKGRPELTKSWNFLVSDNRYIGFD  377

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSM  212
            + DFGWG+ I+ G   A    +F    K N   E+ VL+ ISLP L+M
Sbjct  378  EFDFGWGNPIFGGILKAISFTSFGVSVK-NDKGEKGVLIAISLPPLAM  424



>ref|XP_011085899.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=464

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSV-MRNILVSDISRIG  362
            TA+ LC++P+ +A+EL+ +AK+KV+ DY+KSV + ++I GRP  +V MR  +VSD++ + 
Sbjct  317  TAENLCKQPLNFALELVMKAKSKVTEDYIKSVANLMIIRGRPHFAVDMRTYIVSDLTHVA  376

Query  361  LEKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
             + +D+GWG         G A    G      P  N   ER  LVPI LP  +M +F +E
Sbjct  377  SDNLDYGWGAPVFGGPAKGGAGVIPGLLSFHIPIKNIKGERGKLVPICLPANAMEVFVKE  436

Query  193  IKKMTK  176
            ++ M K
Sbjct  437  LETMVK  442



>dbj|BAF49304.1| putative acyltransferase [Clitoria ternatea]
Length=461

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 68/120 (57%), Gaps = 4/120 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK  VS +Y+ S+ D +V  GRP  +V+R+ LVSD++R G 
Sbjct  321  TAGKLCGNPLGYALELVRKAKGDVSEEYMHSLADLMVTKGRPHFTVVRSYLVSDVTRAGF  380

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG         G   A  G      P  NS  E  +++P+ LP  +M  F RE+
Sbjct  381  GDVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNSKGEEGLVIPVCLPSQAMDRFVREL  440



>ref|XP_003521736.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=464

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T++ LCE P  YA+EL++ AK+ V  +YV+S  D +V+ GRP  +  R+ LVS+ +RIGL
Sbjct  323  TSRRLCENPFGYALELVKNAKSNVDEEYVRSTSDLIVVKGRPHQATTRSYLVSNTTRIGL  382

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            +++DFGWG         G  T+    T +     N   E  ++VPISLP  +M  F  E+
Sbjct  383  DEVDFGWGKPIYGGPATGGITSFPQMTSVYVSCKNHKGEHVIVVPISLPAKAMERFATEL  442

Query  190  KKMTK  176
            + M +
Sbjct  443  EGMLR  447



>gb|AAL77060.1|AF468022_1 putative acyltransferase [Cucumis melo]
Length=461

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T   LC  P+ YA++LIR+AK K + +Y+KS++DF+VI GRPR + +   ++SDI+RIG 
Sbjct  318  TVAKLCGNPLGYAVDLIRKAKAKATKEYIKSMVDFMVIKGRPRFTEIGPFMMSDITRIGF  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKS----NSSTERSVLVPISLPHLSMLIFKREI  191
            E +DFGWG AI+ G      G        S    N + E+ ++VP+ LP  +M  F+  +
Sbjct  378  ENVDFGWGKAIFGGPIIGGCGIIRGMISYSIAFMNRNGEKGIVVPLCLPPPAMERFRANV  437

Query  190  K  188
             
Sbjct  438  H  438



>ref|NP_001284403.1| benzyl alcohol O-benzoyltransferase-like [Cucumis melo]
 gb|ACA04742.1| alcohol acetyltransferase [Cucumis melo]
Length=461

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T   LC  P+ YA++LIR+AK K + +Y+KS++DF+VI GRPR + +   ++SDI+RIG 
Sbjct  318  TVAKLCGNPLGYAVDLIRKAKAKATKEYIKSMVDFMVIKGRPRFTEIGPFMMSDITRIGF  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKS----NSSTERSVLVPISLPHLSMLIFKREI  191
            E +DFGWG AI+ G      G        S    N + E+ ++VP+ LP  +M  F+  +
Sbjct  378  ENVDFGWGKAIFGGPIIGGCGIIRGMISYSIAFMNRNGEKGIVVPLCLPPPAMERFRANV  437

Query  190  K  188
             
Sbjct  438  H  438



>ref|XP_009365763.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=451

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  529  LLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGLEK  353
            LLCE P+ YA+EL+++ K+K+S +Y+KS+ D  VI GRP + +  N+L VSD +R G  +
Sbjct  323  LLCENPLGYAVELVKKLKSKMSEEYMKSLADLFVIRGRPPLPMAWNVLIVSDNTRTGFGE  382

Query  352  IDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            ++FGWG  I+AG A +    TF  +  S    E  V+VPI LP   M  F++E K+MT
Sbjct  383  VNFGWGKPIFAGIAKSVNLITFYVQDNS-LKEEYGVVVPICLPFSCMEAFEKEFKRMT  439



>ref|XP_006437408.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
 gb|ESR50648.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
Length=458

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P+ +A+EL+R+AKN V+ +Y++S+ D +VI GRP  +V+R+ LVSD++R G 
Sbjct  315  TAEKLSKNPLGFALELVRKAKNDVNDEYMRSLADLMVIKGRPHFAVVRSYLVSDVTRAGF  374

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG         G   A  G      P  N   E  ++VP+ LP  +M  F  E+
Sbjct  375  GDVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNKKGEEGIVVPVCLPAPAMARFVEEL  434

Query  190  KKMTK  176
            +K  K
Sbjct  435  EKTLK  439



>ref|XP_004982683.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 72/124 (58%), Gaps = 6/124 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  RP+ +A+EL++ AK +V A+Y++SV D +V+ GRP  +V+R  L SD+++ G 
Sbjct  319  TAGDLAARPLGHAVELVKRAKGEVGAEYMRSVADLMVLRGRPHFTVVRAYLASDVTKAGF  378

Query  358  EKIDFGW-----GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGW     G     G       A+FL  P  N+  E  ++VP+ LP  +M  F RE
Sbjct  379  GDLDFGWGKPVYGGPAKGGVGAIPGVASFLI-PFKNAKGEDGIVVPMCLPGPAMETFVRE  437

Query  193  IKKM  182
            + K+
Sbjct  438  LGKL  441



>ref|XP_006484694.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Citrus sinensis]
Length=458

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P+ +A+EL+R+AKN V+ +Y++S+ D +VI GRP  +V+R+ LVSD++R G 
Sbjct  315  TAEKLSKNPLGFALELVRKAKNDVNDEYMRSLADLMVIKGRPHFAVVRSYLVSDVTRAGF  374

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG         G   A  G      P  N   E  ++VP+ LP  +M  F  E+
Sbjct  375  GDVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNKKGEEGIVVPVCLPAPAMARFVEEL  434

Query  190  KKMTK  176
            +K  K
Sbjct  435  EKTLK  439



>tpg|DAA49394.1| TPA: hypothetical protein ZEAMMB73_141384 [Zea mays]
Length=298

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 71/124 (57%), Gaps = 6/124 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  RP+ YA+EL++ AK +V  +Y++SV D +V+ GRP  +V+R  L SD+++ G 
Sbjct  153  TAGDLAARPLGYAVELVKRAKGEVDVEYMRSVADLMVLRGRPHFTVVRAYLASDVTKAGF  212

Query  358  EKIDFGW-----GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGW     G     G       A+FL  P  N+  E  ++VP+ LP  +M  F +E
Sbjct  213  GDLDFGWGKPVYGGPAKGGVGAIPGVASFL-IPFKNAKGEDGIVVPMCLPGPAMETFVKE  271

Query  193  IKKM  182
            + K+
Sbjct  272  MDKL  275



>gb|KCW72711.1| hypothetical protein EUGRSUZ_E01163 [Eucalyptus grandis]
Length=464

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA++L++++K  VS +YV+S +D LV+ GRP+ + + N +V+D +++G E
Sbjct  326  AGHLCNSPLGYAVDLVKKSKEMVSEEYVRSSIDVLVLKGRPKYTTVWNYVVADATKVGFE  385

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            + DFGWG   Y G A A    +F  + ++    E  ++VPI LP  +M  F+ E+ KMT
Sbjct  386  EADFGWGKPAYGGVAGAFPLISFNVKYRTRKG-EEGIVVPIMLPERAMRRFQEELAKMT  443



>ref|XP_003518844.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Glycine max]
Length=459

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+R+AK  V+ +Y+ SV D +V  GRP  +V+R+ LVSD++R G 
Sbjct  315  TAGKLCDNPLGYALELVRKAKADVTEEYMHSVADLMVTKGRPHFTVVRSYLVSDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              I+FGWG A+Y G A    GA         P  N+  E  +++P+ LP  +M  F++E+
Sbjct  375  GNIEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPVCLPSEAMERFQKEL  434



>dbj|BAJ96970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
             A  L  RP+   +EL+REAK  V+A+Y +S++D+LV++GRP ++      ++D+ RIG 
Sbjct  341  AAGSLLSRPMGDVVELVREAKASVTAEYARSMVDYLVLHGRPALAAANLFTLTDLRRIGF  400

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +++DFGWG+ +YAG+A +    + L   K N   +  V VP++LP L+M  F  EI+K+ 
Sbjct  401  DRVDFGWGEPVYAGAARSMLWVSSLITVK-NGGGQNVVAVPVALPRLAMERFASEIEKLA  459

Query  178  K  176
            K
Sbjct  460  K  460



>gb|KJB44358.1| hypothetical protein B456_007G247700 [Gossypium raimondii]
Length=455

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMR-NILVSDISRIG  362
            TA  LC  P+ YAIEL++  K K + +Y+KS  DFLV NGRP +++ R + L+S+++RI 
Sbjct  321  TADKLCRSPLEYAIELVKHTKGKATEEYMKSTADFLVTNGRPSLTLNRWSFLLSNLTRIK  380

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             + +DFGWG A+Y G A    G   +  P +N+  E  ++VP+ LP L M  F  E+  +
Sbjct  381  FQDVDFGWGKAVYGGDANNTDGKHLI--PFTNTKGEDGIVVPLYLPALIMERFVNELNSL  438

Query  181  TK  176
             K
Sbjct  439  LK  440



>ref|XP_009612665.1| PREDICTED: methanol O-anthraniloyltransferase-like, partial [Nicotiana 
tomentosiformis]
Length=282

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC  P+TYAI+L+R+ K++++ +YV+SV D +VI GRP ++   N ++SD    G +
Sbjct  174  AGLLCSSPLTYAIDLVRKVKDQMNEEYVRSVADLMVIKGRPELTKSWNFIISDNRSAGFD  233

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSM  212
            +IDFGWG  I+ G   A    +F   P  N+  E+ +L+ ISLP L+M
Sbjct  234  EIDFGWGLPIFGGVPKAISVISFC-LPLKNNMGEKGILIAISLPPLAM  280



>dbj|BAB78588.1| alcohol acetyltransferase [Cucumis melo]
Length=461

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 72/117 (62%), Gaps = 4/117 (3%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            LC  P+ YA++LIR+AK K + +Y+KS++DF+VI GRPR + +   ++SDI+RIG E +D
Sbjct  322  LCGNPLGYAVDLIRKAKAKATKEYIKSMVDFMVIKGRPRFTEIGPFMMSDITRIGFENVD  381

Query  346  FGWGDaiyagsataaygaTFLERPKS----NSSTERSVLVPISLPHLSMLIFKREIK  188
            FGWG AI+ G      G        S    N + E+ ++VP+ LP  +M  F+  + 
Sbjct  382  FGWGKAIFGGPIIGGCGIIRGMISYSIAFMNRNGEKGIVVPLCLPPPAMERFRANVH  438



>gb|KDP39575.1| hypothetical protein JCGZ_02595 [Jatropha curcas]
Length=171

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 0/123 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  + + PI Y +ELIR+AK +   +Y+KSV D LVI GRP ++V    +VSD+   G 
Sbjct  34   TAGEISKNPIGYGLELIRKAKMEFDREYIKSVADLLVIKGRPHIAVEGAYVVSDVRHTGF  93

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +++DFGWG AIY G A A         P      E  +L+PI LP  +M  F +E+K + 
Sbjct  94   KEVDFGWGKAIYGGPAKAIPILASFYVPFERKKGENGILIPICLPAQAMERFVKELKNLL  153

Query  178  KFN  170
              N
Sbjct  154  DDN  156



>ref|XP_007029790.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10292.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=457

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 76/125 (61%), Gaps = 7/125 (6%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ LC+ P+ YA++L+++AK  V+ +YVKSV   +VI GRP    +R+ L+SD++R G 
Sbjct  315  TARKLCQNPLGYAVKLVKQAKESVTEEYVKSVAALMVIKGRPHYPTVRSCLISDLTRAGF  374

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKS------NSSTERSVLVPISLPHLSMLIFKR  197
             ++DFGWG A+Y G   A  GAT L  P S      N   E  + +PI LP  +M  F +
Sbjct  375  GEVDFGWGKAVYGGLPKAGLGAT-LHAPSSFLIAVKNKKGEAGIAMPICLPAPAMERFAK  433

Query  196  EIKKM  182
            E+  +
Sbjct  434  ELDSL  438



>ref|XP_010058392.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA++L++++K  VS +YV+S +D LV+ GRP+ + + N +V+D +++G E
Sbjct  345  AGHLCNSPLGYAVDLVKKSKEMVSEEYVRSSIDVLVLKGRPKYTTVWNYVVADATKVGFE  404

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            + DFGWG   Y G A A    +F  + ++    E  ++VPI LP  +M  F+ E+ KMT
Sbjct  405  EADFGWGKPAYGGVAGAFPLISFNVKYRTRKG-EEGIVVPIMLPERAMRRFQEELAKMT  462



>ref|XP_008232530.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Prunus mume]
Length=461

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+++AK  V+ +Y++S+ D +VI GRP  +V+   LVSD++R G 
Sbjct  318  TAGRLCQNPLGYALELVKQAKADVTEEYMRSLADLMVIRGRPHFTVVGTYLVSDVTRAGF  377

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A    GA         P  +++ +  ++VPI LP  +M  F +E+
Sbjct  378  GEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFKDNNGQDGIVVPICLPAPAMERFIKEL  437

Query  190  KKMTKFN  170
              M   N
Sbjct  438  NTMLNAN  444



>gb|AFK38671.1| unknown [Medicago truncatula]
Length=140

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -2

Query  520  ERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKIDFG  341
            E P+ YA+EL+++AK+ V+ +Y+ SV D +VI GRP  +V+R+ LVSD++R G   ++FG
Sbjct  2    ENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHFTVVRSYLVSDVTRAGFGDVEFG  61

Query  340  WGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTKF  173
            WG A+Y G A    GA         P  N+  E  +++P+ LP  +M  F +E+  + K 
Sbjct  62   WGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPLCLPAQAMEKFVKELDSVLKN  121

Query  172  N  170
            N
Sbjct  122  N  122



>gb|AFK45581.1| unknown [Medicago truncatula]
Length=140

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -2

Query  520  ERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKIDFG  341
            E P+ YA+EL+++AK+ V+ +Y+ SV D +VI GRP  +V+R+ LVSD++R G   ++FG
Sbjct  2    ENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHFTVVRSYLVSDVTRAGFGDVEFG  61

Query  340  WGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTKF  173
            WG A+Y G A    GA         P  N+  E  +++P+ LP  +M  F +E+  + K 
Sbjct  62   WGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPLCLPAQAMEKFVKELDSVLKN  121

Query  172  N  170
            N
Sbjct  122  N  122



>ref|XP_008380361.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like, 
partial [Malus domestica]
Length=317

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK  V+ +Y++S+ D +VI GRP  +V+ + L+SD++R G 
Sbjct  174  TAWRLCNNPLGYALELVRKAKADVTEEYMRSLADLMVIKGRPHFTVVNSYLMSDVTRAGF  233

Query  358  EKIDFGWGDaiyagsataa----ygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A        G      P  ++  E  ++VP+ LP  +M  F +E+
Sbjct  234  GEVDFGWGKAAYGGPAKGGVGLITGLASFYIPSRDNRGEDGIVVPVCLPAAAMERFIKEL  293

Query  190  KKM  182
              M
Sbjct  294  DAM  296



>ref|XP_008348383.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Malus domestica]
Length=317

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK  V+ +Y++S+ D +VI GRP  +V+ + L+SD++R G 
Sbjct  174  TAWRLCNNPLGYALELVRKAKADVTEEYMRSLADLMVIKGRPHFTVVNSYLMSDVTRAGF  233

Query  358  EKIDFGWGDaiyagsataa----ygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A        G      P  ++  E  ++VP+ LP  +M  F +E+
Sbjct  234  GEVDFGWGKAAYGGPAKGGVGLITGLASFYIPSRDNRGEDGIVVPVCLPAAAMERFIKEL  293

Query  190  KKM  182
              M
Sbjct  294  DAM  296



>ref|NP_001064997.1| Os10g0503300 [Oryza sativa Japonica Group]
 dbj|BAF26911.1| Os10g0503300 [Oryza sativa Japonica Group]
 gb|EAY79120.1| hypothetical protein OsI_34226 [Oryza sativa Indica Group]
 gb|EAZ16606.1| hypothetical protein OsJ_32078 [Oryza sativa Japonica Group]
Length=475

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 6/126 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  RP+ YA+EL+R AK +VS +Y++SV D +V  GRP  +V+R  LVSD+++ G 
Sbjct  327  TAGELRARPLGYAVELVRAAKGEVSVEYMRSVADLMVQRGRPHFTVVRAYLVSDVTKAGF  386

Query  358  EKIDFGW-----GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGW     G     G       A+FL  P  N+  E  ++VP+ LP  +M  F  E
Sbjct  387  GDLDFGWGKPAYGGPAKGGVGAIPGVASFL-IPFKNAKGEDGIVVPMCLPGPAMDKFVEE  445

Query  193  IKKMTK  176
            + K+ K
Sbjct  446  MGKLMK  451



>gb|ABR16407.1| unknown [Picea sitchensis]
Length=448

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 8/127 (6%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+++A++LI EAK  V+ +Y++SV+D + + GRP  +V+ + LVSD+++IG 
Sbjct  313  TAGELAKNPLSFALKLINEAKTAVNDEYMRSVIDLMELEGRPHFTVVGSFLVSDVTKIGF  372

Query  358  EKIDFGW------GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKR  197
              +DFGW      G A     A     + F+  P  N+S    +LVP+ LP  +M IF+ 
Sbjct  373  GDVDFGWGRAAYGGPAKGGVGAVPGVSSFFI--PLRNTSGVEGILVPVCLPSAAMKIFQA  430

Query  196  EIKKMTK  176
            EI + T+
Sbjct  431  EISEATE  437



>gb|ABR16595.1| unknown [Picea sitchensis]
Length=448

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 8/127 (6%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+++A++LI EAK  V+ +Y++SV+D + + GRP  +V+ + LVSD+++IG 
Sbjct  313  TAGELAKNPLSFALKLINEAKTAVNDEYMRSVIDLMELEGRPHFTVVGSFLVSDVTKIGF  372

Query  358  EKIDFGW------GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKR  197
              +DFGW      G A     A     + F+  P  N+S    +LVP+ LP  +M IF+ 
Sbjct  373  GDVDFGWGRAAYGGPAKGGVGAVPGVSSFFI--PLRNTSGVEGILVPVCLPSAAMKIFQA  430

Query  196  EIKKMTK  176
            EI + T+
Sbjct  431  EISEATE  437



>ref|XP_008355599.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=454

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T + LC+ PI YA+EL+++ K K+S +Y+KSV D +V+ GRP  S  RN +V D +R G 
Sbjct  320  TVESLCKNPIGYALELVKKXKAKMSDEYIKSVADLMVMRGRPDFSSTRNFVVGDTTRAGF  379

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             ++DFGWG  ++AG A          R K+    E  +LV   LP  ++  F++E+K+MT
Sbjct  380  GEVDFGWGKPVFAGPAKCVNMINLYVRHKNKE--ENGILVLTCLPLSAVERFQQELKRMT  437



>ref|XP_006375977.1| hypothetical protein POPTR_0013s072102g, partial [Populus trichocarpa]
 gb|ERP53774.1| hypothetical protein POPTR_0013s072102g, partial [Populus trichocarpa]
Length=240

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L ++PI YA+EL+R+AK  ++ +Y++S    +V  GRP  +V    ++SD+ R GL
Sbjct  103  TAGELSKKPIGYALELVRKAKADLTEEYMRSTASLMVSKGRPPFTVTGTYILSDLRRAGL  162

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            EK DFGWG+AIYAG+ATA         P +N   E  ++VP  LP  ++  F +E++ M 
Sbjct  163  EKADFGWGNAIYAGTATAMAELGSFYIPFTNKKGEDGIVVPFCLPSPAVERFYKELEGML  222

Query  178  K  176
            K
Sbjct  223  K  223



>ref|XP_011085895.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Sesamum indicum]
Length=466

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            +A+ L   P+ YA+EL+R+ K  V+ +Y+KSV D +VI GRP  +V+R  LVSD++  G 
Sbjct  322  SAEKLSRNPLGYALELVRKTKADVTEEYMKSVADLMVIRGRPHFAVVRTYLVSDVTHAGF  381

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG A Y G A    GA         P +N+  E  ++VPI L   +M +F +E+
Sbjct  382  GDVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFTNNKGENGIVVPICLAANAMEVFVKEL  441

Query  190  KKMTK  176
            +KM K
Sbjct  442  EKMLK  446



>ref|XP_011082158.1| PREDICTED: methanol O-anthraniloyltransferase-like [Sesamum indicum]
Length=453

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            AK+LCE P++YAI+L++EA+ + + +Y +S +DF+    RP+++   N +VSD S++G +
Sbjct  316  AKILCESPLSYAIKLVKEARRQATPEYSRSTIDFIATKERPKLTSPWNFIVSDTSKVGFD  375

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
            ++DFGWG+ IY G+         +   + N   E  ++VP++LP   M  F+ E++
Sbjct  376  EVDFGWGNPIYGGTMYGGTFHYIVYAHQRNQKGEDVMVVPMTLPVAVMERFEDELR  431



>gb|AJD25145.1| benzoyl-CoA:benzyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=460

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P  YA+EL+R+AK  V+ +Y++SV   +VI GRP  +V+R  LVSD+ R G 
Sbjct  318  TAEELSKNPFGYALELVRKAKADVTEEYMRSVSSLMVIKGRPHFTVVRAYLVSDLRRAGF  377

Query  358  EKIDFGWGDaiyagsataayg----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            E++DFGWG+AIY G+A    G          P +N   E  V+VP  LP  +M  F +E+
Sbjct  378  EEVDFGWGNAIYGGAAKGGVGAIPGVASFYIPFTNKKGENGVVVPFCLPAPAMERFVKEL  437

Query  190  KKMTK  176
              M K
Sbjct  438  DGMLK  442



>ref|XP_002325454.2| transferase family protein [Populus trichocarpa]
 gb|EEE99835.2| transferase family protein [Populus trichocarpa]
Length=460

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P  YA+EL+R+AK  V+ +Y++SV   +VI GRP  +V+R  LVSD+ R G 
Sbjct  318  TAEELSKNPFGYALELVRKAKADVTEEYMRSVSSLMVIKGRPHFTVVRAYLVSDLRRAGF  377

Query  358  EKIDFGWGDaiyagsataayg----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            E++DFGWG+AIY G+A    G          P +N   E  V+VP  LP  +M  F +E+
Sbjct  378  EEVDFGWGNAIYGGAAKGGVGAIPGVASFYIPFTNKKGENGVVVPFCLPAPAMERFVKEL  437

Query  190  KKMTK  176
              M K
Sbjct  438  DGMLK  442



>ref|XP_010038484.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010038489.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84617.1| hypothetical protein EUGRSUZ_B01448 [Eucalyptus grandis]
Length=458

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 71/124 (57%), Gaps = 4/124 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC+ P+ YA+EL+++AK  V+ +Y++S+ D +V+ GRP  +V+R+ LVSD ++ G  
Sbjct  317  ADKLCQNPLGYALELVKKAKADVTEEYMRSLADLMVLRGRPHFTVVRSFLVSDTTKAGFG  376

Query  355  KIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
             +DFGWG         G   A  G      P  N   E  ++VP+ LP  +M IF +E+ 
Sbjct  377  NVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNREGENGIVVPVCLPAPAMRIFVQELD  436

Query  187  KMTK  176
             + K
Sbjct  437  ALLK  440



>sp|Q8GT21.1|BEBT_CLABR RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Clarkia 
breweri]
 gb|AAN09796.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Clarkia 
breweri]
Length=456

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ +A+ELIR+AK +V+ +Y+ SV D +V  GRP  +V+   LVSD++R G 
Sbjct  317  TAGKLCNNPLGFALELIRKAKREVTEEYMHSVADLMVATGRPHFTVVNTYLVSDVTRAGF  376

Query  358  EKIDFGWGDaiyagsataay----gaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG+A+Y G A        G T    P  N   E+ +++PI LP  +M IF   +
Sbjct  377  GEVDFGWGEAVYGGPAKGGVGVIPGVTSFYIPLRNRQGEKGIVLPICLPSAAMEIFAEAL  436



>ref|XP_008343918.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
 gb|AAU14879.2| alcohol acyl transferase [Malus domestica]
 gb|AGW30200.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R+G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRVGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG   A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPVFAGPVKALDLISFYVQHKNN--TEDGILVPMCLPSSAMERFQQELERIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>gb|ACV74416.1| putative alcohol acyl transferase [Camellia sinensis]
Length=464

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRN--ILVSDISRIG  362
            A +L   P+ YA+EL+R+AK +VS +Y +SV D +VI GRP  ++  N   +VSD +R G
Sbjct  328  AGMLSMPPLGYALELVRKAKAQVSEEYFRSVADLMVIKGRPSYTLEANKDYIVSDTTRAG  387

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             +K+DFGWG  ++ G   A    +   R K     E  ++VPI LP   M  F++E+KKM
Sbjct  388  FDKVDFGWGKPVFGGVPRAISLISVFARFKDIRGGEDGIVVPICLPESVMDRFEQELKKM  447

Query  181  TK  176
             +
Sbjct  448  IQ  449



>gb|EAZ02323.1| hypothetical protein OsI_24425 [Oryza sativa Indica Group]
Length=450

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 77/125 (62%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC   + YA+ L+++AK+ V+ +Y++SV D +V+ GRP  ++ R  +VSD+S  G 
Sbjct  323  TAGELCGGDLGYALGLVKKAKSAVTYEYLQSVADLMVVAGRPLFALSRTYIVSDVSHAGF  382

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + +DFGWG+A+Y G A    G       +  R K N   E+SV+VPI LP  +M  F+ E
Sbjct  383  KSVDFGWGEAVYGGPAKGGEGPLLGVTNYFSRSK-NGKGEQSVVVPICLPKDAMDKFQLE  441

Query  193  IKKMT  179
            ++ +T
Sbjct  442  VQALT  446



>dbj|BAE72881.1| benzoyl CoA benzoic acid benzoyltransferase [Verbena x hybrida]
Length=461

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 76/122 (62%), Gaps = 4/122 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  L  +P+ +A++L+ +AKN V+ +Y++S+ D +VI GRP  +V+R+ LVSD++R G +
Sbjct  319  AGDLSTKPLGHALKLVMQAKNAVNDEYMRSLTDLMVIKGRPHFTVVRSYLVSDVTRAGFD  378

Query  355  KIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
             +DFGWG+A Y G A    GA         P +N   E  +++PI LP+ +M  F +E+ 
Sbjct  379  AVDFGWGNAAYGGPAKGGVGAIPGVASFYIPFTNHKGETGIVLPICLPNAAMETFVKELN  438

Query  187  KM  182
             M
Sbjct  439  NM  440



>ref|XP_011012995.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=459

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 74/125 (59%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L   P  YA+EL+R+AK  V+ +Y++SV   +VI GRP  +V+R  LVSD+ R G 
Sbjct  318  TAGELSRNPFGYALELVRKAKADVTEEYMRSVSSLMVIKGRPHFTVVRAYLVSDLRRAGF  377

Query  358  EKIDFGWGDaiyagsataayg----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            E++DFGWG+AIY G+A    G          P +N + E  V+VP  LP  +M  F +E+
Sbjct  378  EEVDFGWGNAIYGGAAKGGVGAIPGVASFYIPFTNKNGENGVVVPFCLPAPAMERFVKEL  437

Query  190  KKMTK  176
              M K
Sbjct  438  DGMLK  442



>ref|NP_001058545.2| Os06g0710700 [Oryza sativa Japonica Group]
 dbj|BAD53644.1| putative benzoyl coenzyme A, benzyl alcohol benzoyl transferase 
[Oryza sativa Japonica Group]
 dbj|BAF20459.2| Os06g0710700 [Oryza sativa Japonica Group]
Length=450

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 77/125 (62%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC   + YA+ L+++AK+ V+ +Y++SV D +V+ GRP  ++ R  +VSD+S  G 
Sbjct  323  TAGELCGGDLGYALGLVKKAKSAVTYEYLQSVADLMVVAGRPLFALSRTYIVSDVSHAGF  382

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + +DFGWG+A+Y G A    G       +  R K N   E+SV+VPI LP  +M  F+ E
Sbjct  383  KSVDFGWGEAVYGGPAKGGEGPLLGVTNYFSRSK-NGKGEQSVVVPICLPKDAMDKFQLE  441

Query  193  IKKMT  179
            ++ +T
Sbjct  442  VQALT  446



>ref|XP_009804829.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana sylvestris]
Length=460

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 74/125 (59%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L + P+ YA+EL+++ K  V+ +Y+KSV D +V+ GRP  +V+R  LVSD++R G 
Sbjct  319  TAAKLRKNPLGYALELVKKTKTDVTEEYMKSVADLMVLKGRPHFTVVRTYLVSDVTRGGF  378

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A+Y G A    GA         P  N   E  ++VPI LP  +M  F +E+
Sbjct  379  GEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPICLPGFAMETFIKEL  438

Query  190  KKMTK  176
              M +
Sbjct  439  DGMLR  443



>gb|KJB82260.1| hypothetical protein B456_013G185300 [Gossypium raimondii]
Length=415

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 19/119 (16%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YAI+L++EAK KV+ +Y+KS  D +VI GRP ++  R+++VSD+SR   
Sbjct  306  TAAKLCQNPLEYAIKLVKEAKGKVTEEYMKSTADLMVIRGRPNVNTGRSLIVSDLSRARF  365

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             ++DFGWG                      N   +  + VP+ LP   M  F +EI ++
Sbjct  366  REVDFGWGK-------------------AENKEGKEGITVPVCLPAPLMDSFVKEINRL  405



>ref|XP_004966402.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=446

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 75/125 (60%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC + + YA+EL+++AK+ V+ DY+ SV D +V+ GRP  ++ R  +VSD+S  G 
Sbjct  320  TAGELCGKDLGYALELVKKAKSAVTYDYLLSVADLMVLEGRPLFALSRTYIVSDVSHAGF  379

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + +DFGWG+A+Y G A    G       +  R K N   E   +VPI LP  +M  F+ E
Sbjct  380  KSVDFGWGEAVYGGPAKGGEGPLPGVTNYFSRAK-NGKGEEGTVVPICLPKDAMEKFQLE  438

Query  193  IKKMT  179
            ++ +T
Sbjct  439  VEGLT  443



>gb|AGW30202.1| alcohol acyl transferase, partial [Malus domestica]
Length=418

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  285  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  344

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  345  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLPSSAMERFQQELERIT  402

Query  178  K  176
            +
Sbjct  403  Q  403



>ref|XP_007158092.1| hypothetical protein PHAVU_002G123400g [Phaseolus vulgaris]
 gb|ESW30086.1| hypothetical protein PHAVU_002G123400g [Phaseolus vulgaris]
Length=156

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC+ P+ YA++L++ AK+++ A+ V S+ D +V+ GR R     N L  + + +G  
Sbjct  21   AAPLCQNPLAYALDLVKMAKDQMGAEKVSSLTDLMVLKGRLRYRTEGNCLTGETTHVGFY  80

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++DFGWG +    +       +F  R + NS  E  ++VPI LPHL M  F  E+ K+T 
Sbjct  81   EVDFGWGRSYIWLACWDIPFVSFYGRFR-NSEGEDGIVVPIFLPHLVMSWFLSELVKITN  139



>gb|AJD18611.1| alcohol acyltransferase [Pyrus ussuriensis]
Length=459

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R+G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRVGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E+ ++T
Sbjct  382  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLPSSAMKRFQQELARIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>gb|KEH40970.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=436

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L E P+ YA+EL+++AK+ V+ +Y+ SV D +VI GRP  +V+R+ LVSD++R G 
Sbjct  292  TAGKLMENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHFTVVRSYLVSDVTRAGF  351

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              ++FGWG A+Y G A    GA         P  N+  E  +++P+ LP  +M  F +E+
Sbjct  352  GDVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPLCLPAQAMEKFVKEL  411

Query  190  KKMTKFN  170
              + K N
Sbjct  412  DSVLKNN  418



>tpg|DAA49395.1| TPA: 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 71/124 (57%), Gaps = 6/124 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  RP+ YA+EL++ AK +V  +Y++SV D +V+ GRP  +V+R  L SD+++ G 
Sbjct  317  TAGDLAARPLGYAVELVKRAKGEVDVEYMRSVADLMVLRGRPHFTVVRAYLASDVTKAGF  376

Query  358  EKIDFGW-----GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGW     G     G       A+FL  P  N+  E  ++VP+ LP  +M  F +E
Sbjct  377  GDLDFGWGKPVYGGPAKGGVGAIPGVASFLI-PFKNAKGEDGIVVPMCLPGPAMETFVKE  435

Query  193  IKKM  182
            + K+
Sbjct  436  MDKL  439



>ref|XP_007200171.1| hypothetical protein PRUPE_ppa016489mg, partial [Prunus persica]
 gb|EMJ01370.1| hypothetical protein PRUPE_ppa016489mg, partial [Prunus persica]
Length=312

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ YA+EL+++AK  V+ +Y++S+ D +V  GRP  +V+   LVSD++R G 
Sbjct  169  TAGRLCQNPLGYALELVKQAKADVTEEYMRSLADLMVNRGRPHFTVVGTYLVSDVTRAGF  228

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G A    GA         P  + + +  ++VPI LP  +M  F +E+
Sbjct  229  GEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFKDHNGQDGIVVPICLPAPAMERFIKEL  288

Query  190  KKMTKFN  170
              M   N
Sbjct  289  DTMLNAN  295



>ref|NP_001152518.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
 gb|ACG48011.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 71/124 (57%), Gaps = 6/124 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  RP+ YA+EL++ AK +V  +Y++SV D +V+ GRP  +V+R  L SD+++ G 
Sbjct  317  TAGDLAARPLGYAVELVKRAKGEVDVEYMRSVADLMVLRGRPHFTVVRAYLASDVTKAGF  376

Query  358  EKIDFGW-----GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGW     G     G       A+FL  P  N+  E  ++VP+ LP  +M  F +E
Sbjct  377  GDLDFGWGKPVYGGPAKGGVGAIPGVASFLI-PFKNAKGEDGIVVPMCLPGPAMETFVKE  435

Query  193  IKKM  182
            + K+
Sbjct  436  MDKL  439



>gb|ACJ85557.1| unknown [Medicago truncatula]
Length=459

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L E P+ YA+EL+++AK+ V+ +Y+ SV D +VI GRP  +V+R+ LVSD++R G 
Sbjct  315  TAGKLMENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHFTVVRSYLVSDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              ++FGWG A+Y G A    GA         P  N+  E  +++P+ LP  +M  F +E+
Sbjct  375  GDVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPLCLPAQAMEKFVKEL  434

Query  190  KKMTKFN  170
              + K N
Sbjct  435  DSVLKNN  441



>ref|XP_003536235.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=454

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LCE P+ YA+EL+R+AK  V+ +Y+ SV + +V  GRP  +V+R+ +VSD++R G 
Sbjct  317  TAGKLCENPLGYAVELVRKAKADVTEEYMHSVANLMVAKGRPHFTVVRSYVVSDVTRAGF  376

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              ++FGWG A+Y G A    GA         P  N+  E  +++P+ LP  +M  F++E+
Sbjct  377  GNVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPVCLPSEAMERFQKEL  436

Query  190  KKM  182
              +
Sbjct  437  NSV  439



>ref|XP_008352569.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=265

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D  V+ GRP+ S   + L VSD +R G 
Sbjct  128  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLXVLRGRPQYSSTGSYLIVSDNTRAGF  187

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  188  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLPSSAMERFQQELERIT  245

Query  178  K  176
            +
Sbjct  246  Q  246



>gb|EMS67264.1| Omega-hydroxypalmitate O-feruloyl transferase [Triticum urartu]
Length=173

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 69/122 (57%), Gaps = 3/122 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
             A  LC R + YA+ELIREAK +V+ +Y++SV D +V+ GRP ++  R+  VSD+S  G 
Sbjct  34   AAGELCGRGLGYAVELIREAKARVTYEYMRSVADLMVLEGRPVIARTRSFGVSDVSHAGF  93

Query  358  EKIDFGWGD--aiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKK  185
            ++ +FGWG        +     GA+FL R K N   E    V I LP      ++ E++ 
Sbjct  94   DEAEFGWGKPVYAGVIADAHRGGASFLMRGK-NDGGEDETFVGIYLPGGCTARYRMEVEA  152

Query  184  MT  179
            +T
Sbjct  153  LT  154



>ref|XP_002447250.1| hypothetical protein SORBIDRAFT_06g031260 [Sorghum bicolor]
 gb|EES11578.1| hypothetical protein SORBIDRAFT_06g031260 [Sorghum bicolor]
Length=451

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK +V  +Y++SV D +V+ GRP  +  R  +VSD+++IG 
Sbjct  322  TAGELCVNPVGYAVELVRKAKAEVDVEYIQSVADLMVLRGRPNFANARLYMVSDLTKIGF  381

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +D+GWG  +Y G AT         ++FL  P  N+  E  ++VP+ LP  +M  F  E
Sbjct  382  AGLDYGWGQPVYGGVATMGLSPIPWMSSFLI-PCKNAKGESGIVVPLCLPRRAMDRFTEE  440

Query  193  IKKM  182
            + K+
Sbjct  441  VGKL  444



>ref|XP_004966401.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=450

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC R + YA+EL+++AK+ V+ DY+ SV D +V+ GRP   + R  +VSD+S  G 
Sbjct  324  TAGELCGRDLGYALELVKKAKSAVTYDYLLSVADLMVLTGRPLFVLSRTYIVSDVSHAGF  383

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + +DFGWG+A+Y G A    G       +  R K N   E   +VP+ LP  +M  F+ E
Sbjct  384  KSVDFGWGEAVYGGPAKGGEGPFPGVTNYFSRAK-NGKGEECTVVPVCLPKDAMEKFQLE  442

Query  193  IKKMT  179
            ++ +T
Sbjct  443  VQGLT  447



>ref|XP_009388282.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Musa acuminata 
subsp. malaccensis]
Length=457

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 73/122 (60%), Gaps = 4/122 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA++L+R+AK+ V+ +YV+SV D +V+ GRP  +V+R+ LVSD+++ G  
Sbjct  316  AGKLCANPLGYALDLVRKAKSDVTDEYVRSVADLMVLRGRPHFTVVRSYLVSDVTKAGFG  375

Query  355  KIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
             +DFGWG A Y G A    GA         P  N   E  ++VP+ LP  +M  F  E++
Sbjct  376  DVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRNGKGEDGIVVPVCLPGPAMEKFTMEME  435

Query  187  KM  182
             +
Sbjct  436  SL  437



>ref|XP_008238035.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=460

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGR-PRMSVMRNILVSDISRIGL  359
            AK +C  P+ YA+EL+ +AK  V+ +Y++SV D + I GR P+  +  N +VSD SR G 
Sbjct  321  AKAICTNPLGYALELVMKAKATVNEEYMRSVADLMEIRGRLPKYPLTGNFIVSDNSRAGF  380

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             ++ FGWG  ++ G A A    +F  + K N+  E  VLVPI LP   M  F++E++KMT
Sbjct  381  GEVSFGWGKPVFGGPAKALNLISFYVQHKCNN--EDGVLVPICLPLSDMERFQKELEKMT  438



>ref|XP_006470748.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=463

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGR-PRMSVMRNILVSDISRIGLEKI  350
            LC  P+ YA+ L+++AK ++S ++++S  D + + GR PR ++  N +VSD+S++G ++I
Sbjct  329  LCNNPLGYAVALVKKAKAEMSEEHIRSAADLMEVKGRRPRHAIKGNYIVSDLSKVGFDRI  388

Query  349  DFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            D GWG  ++AG A A    +FL R + +  T    L+PI LP  SM  F+ E+K+M +
Sbjct  389  DLGWGKPVFAGIAGAKSIFSFLNRYQKDGET--GTLIPIRLPRPSMKRFEEELKRMIQ  444



>ref|XP_002437575.1| hypothetical protein SORBIDRAFT_10g029620 [Sorghum bicolor]
 gb|EER88942.1| hypothetical protein SORBIDRAFT_10g029620 [Sorghum bicolor]
Length=450

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC   + +A+EL+++AK+ V+ DY+ SV D +V+ GRP   V R  +VSDIS  G 
Sbjct  324  TAGELCGGDLGFALELVKKAKSAVTYDYLVSVADLMVLTGRPLFEVSRTYIVSDISHAGF  383

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + IDFGWG+A+Y G A    G       +  R K N   E   +VPI LP  +M  F+ E
Sbjct  384  KSIDFGWGEAVYGGPAKGGEGPLPGVTNYFSRAK-NGKGEEGTVVPICLPKDAMEKFQLE  442

Query  193  IKKMT  179
            ++ +T
Sbjct  443  VEGLT  447



>gb|AAS79797.1| alcohol acyl transferase [Malus domestica]
Length=459

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLPSSAMERFQQELERIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>ref|XP_010275172.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nelumbo nucifera]
Length=459

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P  YA+ L+++AK+ V+ +Y++S+ D +V  GRP  +V+R+ LVSD++R G 
Sbjct  317  TAGKLCQNPFGYALGLVKKAKSDVTDEYMRSLADLMVTRGRPHFTVVRSYLVSDVTRAGF  376

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG   Y G A    GA         P  NS  E  +++PI LP  +M  F  E+
Sbjct  377  ADVDFGWGKPAYGGPAKGGVGAIPGVASFYIPFRNSKGEDGIVLPICLPGPAMERFVWEL  436

Query  190  KKMTK  176
            + M +
Sbjct  437  QSMLR  441



>ref|XP_009336751.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRM-SVMRNILVSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+  S   N LVSDI+R+G+
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSNFLVSDITRVGV  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N   E  +LVP+ LP  +M  F++ ++++T
Sbjct  382  GDVNFGWGQPVFAGPAKAVDLISFYIQHKNN--IEDGILVPMWLPFSAMERFQQGLERIT  439



>ref|XP_002524019.1| hypothetical protein RCOM_1517170 [Ricinus communis]
 gb|EEF38387.1| hypothetical protein RCOM_1517170 [Ricinus communis]
Length=172

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 0/117 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P++YAIELI++AK   + +YV+SV D L+I GRP  +      +SD+  +G 
Sbjct  35   TAEKLLKEPVSYAIELIKKAKADTTREYVQSVADTLLIKGRPHFTTEEAYFMSDVRHMGF  94

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
             ++DFGWG A YAG   +         P  N   E   ++PI LP  +M  F +E+K
Sbjct  95   REVDFGWGRATYAGPINSTPMQCSYYLPFENEKREIGFMLPICLPAQAMERFAKELK  151



>ref|XP_004498016.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=463

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 12/150 (8%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L E P+ YA+EL+R+AK  V+ +Y+ S+ D +V NGRP  +V+R+ LVSD++R G 
Sbjct  318  TAGKLIENPLGYALELVRKAKADVTEEYMHSIADLMVTNGRPHFTVVRSYLVSDVTRAGF  377

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             +++FGWG A+Y G A    GA         P  N   E  +++P+ LP  +M  F +E+
Sbjct  378  GEVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNDKGEEGLVIPVCLPTQAMERFVKEL  437

Query  190  KKMTKFN**HSFN*SSDKQSFYCNLWSTFL  101
                     H  N ++  Q+    L S F+
Sbjct  438  D--------HVLNNNNINQTIKGGLKSGFI  459



>ref|XP_008368021.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=455

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLPSSAMERFQQELERIT  439



>ref|XP_010110383.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26215.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=465

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 77/120 (64%), Gaps = 6/120 (5%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            AK+LCE  + + +EL+++AK +++ DY++SV D +V  GRP  +V  N +VSD +R+G  
Sbjct  329  AKVLCESSLGHVVELVKKAKAEMNEDYIRSVADLMVTRGRPLYAVSGNYIVSDNTRVGFG  388

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHL-SMLIFKREIKKMT  179
             IDFGWG  ++ G A A    +F       +  E+ V+VPI LP + +M  F++E+KKMT
Sbjct  389  DIDFGWGLPVFGGPAKALSLISFYV-----AYEEKGVVVPICLPTVRAMDRFEQELKKMT  443



>ref|XP_008645066.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Zea mays]
 gb|AFW69437.1| hypothetical protein ZEAMMB73_463683 [Zea mays]
Length=448

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC   + +A++L+R+AK  V+ DY+ SV D +V+ GRP  +V R  +VSD+S  G 
Sbjct  322  TAGELCAGDLGFALDLVRKAKTAVTYDYLLSVADLMVLTGRPLFAVSRTYIVSDVSHAGF  381

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + +DFGWG+A+Y G A    G       +  R K N   E   +VPI LP  +M  F+ E
Sbjct  382  KSVDFGWGEAVYGGPAKGGEGPLLGVTNYFSRAK-NGKGEEGTVVPICLPKDAMEKFQLE  440

Query  193  IKKMT  179
            ++ +T
Sbjct  441  VEGLT  445



>ref|XP_006351055.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = -2

Query  529  LLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKI  350
            LLC   +TYA+EL+++ K+ +S +Y+KSV + +VI GRP +S   N +VS    +G ++ 
Sbjct  319  LLCSNSLTYAVELVKKLKDHMSEEYIKSVTNLMVIKGRPELSKSWNFIVSVNRSVGFDEF  378

Query  349  DFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            DFGWG  I+ G + A    + +  P +N   E+ +LV ISLP L+M  F++ + KMT
Sbjct  379  DFGWGKPIFGGVSEAISYIS-IGIPVNNEKGEKGILVAISLPPLAMEKFQKIVYKMT  434



>ref|XP_004305015.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVM-RNILVSDISRIG  362
            TA++LC++P+ YA+EL++EAK K++ +Y++S  D + I G P +++   N ++SD +R G
Sbjct  325  TAEILCKQPLGYAVELVKEAKGKMNKEYIQSCADLMAIRGWPPLTLAGNNFILSDNTRTG  384

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            + ++DFGWG  + AG A +    +F  R  +N   +  +LVPI LP   +  F++E++ +
Sbjct  385  VGEVDFGWGRPVVAGPAKSVNLISFYVR-DNNQKEKHGILVPICLPFSCVDRFEQELRSL  443



>ref|XP_002466979.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
 gb|EER93977.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
Length=465

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 71/125 (57%), Gaps = 8/125 (6%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L   P+ YA+EL++ AK +V+ +Y++SV D +V+ GRP  + +R  L SD+++ G 
Sbjct  317  TAGELAASPLGYAVELVKRAKGEVNVEYMRSVADLMVLRGRPHFTAVRAYLASDVTKAGF  376

Query  358  EKIDFGWGD------aiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKR  197
              +DFGWG       A     A     + F+  P  N+  E  ++VP+ LP L+M  F +
Sbjct  377  GDLDFGWGKPVYGGPAKGGVGAIPGVASFFI--PFKNAKGEDGIVVPMCLPGLAMETFVQ  434

Query  196  EIKKM  182
            E+ K+
Sbjct  435  EMGKL  439



>ref|XP_007209120.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
 gb|EMJ10319.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
Length=460

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGR-PRMSVMRNILVSDISRIGL  359
            AK +C  P+ YA+EL+ +AK  V+ +Y++SV D + I GR P+  +  N +VSD SR G 
Sbjct  321  AKDVCTNPLGYALELVMKAKATVNEEYMRSVADLMEIRGRLPKYPLTGNFIVSDTSRAGF  380

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             ++ FGWG  ++ G A A    +F  + K N+  E  VLVPI LP   M  F++E+++MT
Sbjct  381  GEVSFGWGKPVFGGPAKALDLISFYVQHKCNN--EEGVLVPICLPLSDMERFQQELERMT  438



>ref|XP_007209131.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
 gb|EMJ10330.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
Length=450

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNI-LVSDISRIG  362
            T +LLC  P+ Y +EL+R++K ++  +Y++S+ DF VI GRP + +  N+ +VSD    G
Sbjct  322  TVELLCASPLGYGVELVRKSKAQMDKEYMQSLADFFVIRGRPPLPMGWNVFIVSDNRHTG  381

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
              + D GWG  ++AG A A    +F  R  +N   E   LVPI LP  S+  F+ E+KKM
Sbjct  382  FGEFDVGWGRPLFAGLARAFSMISFYVR-DNNQEEEFGTLVPICLPSTSLERFEEELKKM  440

Query  181  T  179
            T
Sbjct  441  T  441



>ref|XP_006446264.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
 gb|ESR59504.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
Length=464

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGR-PRMSVMRNILVSDISRIGLEKI  350
            LC  P+ YA+ L+++AK ++S ++++S  D + + GR PR ++  N +VSD+S++G ++I
Sbjct  329  LCNNPLGYAVALVKKAKVEMSEEHIRSAADLMEVKGRRPRHAIKGNYIVSDLSKVGFDRI  388

Query  349  DFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            D GWG  ++AG A A    +FL R +     E   L+PI LP  SM  F+ E+K+M +
Sbjct  389  DLGWGKPVFAGIAGAKSIFSFLNRCQKEDG-ETGTLIPIRLPRPSMKKFEEELKRMIQ  445



>ref|XP_008678444.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Zea mays]
 gb|AFW61772.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=459

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 74/124 (60%), Gaps = 6/124 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  +P+ YA+EL++ AK +V+ +Y++SV D +V+ GRP  +V+R  L SD+++ G 
Sbjct  317  TAGDLVAKPLGYAVELVKRAKGEVNVEYMRSVADLMVLRGRPHFTVVRAYLASDLTKAGF  376

Query  358  EKIDFGWGD-----aiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGWG+         G  T+   ATFL  P  N+  E  ++VP+ LP  +M  F +E
Sbjct  377  SNLDFGWGNPVYGGPANVGVGTSPGMATFLV-PCKNAKGEDGIIVPMCLPGPAMETFVKE  435

Query  193  IKKM  182
            +  +
Sbjct  436  MGTL  439



>ref|XP_009336752.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRM-SVMRNILVSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+  S   N LVSDI+R+G+
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSNFLVSDITRVGV  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N   E  +LVP+ LP  +M   ++E++++T
Sbjct  382  GDVNFGWGQPVFAGPAKAVDLISFYIQHKNN--IEDGILVPMWLPFSAMERGQQELERIT  439



>ref|XP_004294711.1| PREDICTED: methanol O-anthraniloyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = -2

Query  532  KLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEK  353
            K LCE P+ YA+EL+ +AK +V+ +Y++SV D +V+ GRP  +   N LVSD  R GL +
Sbjct  326  KQLCESPLGYAVELVMKAKAEVNEEYMRSVADLMVLRGRPPYTSAGNFLVSDNRRTGLGE  385

Query  352  IDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            ++ GWG  +++G   A    +F  + K     E  +LV + LP  SM  F++E++KMT
Sbjct  386  VNLGWGKPVFSGPPKALSNISFYVQHKKEK--EDGILVSVCLPLWSMKRFQQELEKMT  441



>ref|XP_008364483.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=437

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRN-ILVSDISRIGL  359
            A+ LC+ P  YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   +  +VSD +R G 
Sbjct  300  AEPLCKNPXGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYFIVSDTTRAGF  359

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F+ E++++T
Sbjct  360  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLPFSAMERFQEELERIT  417

Query  178  K  176
            +
Sbjct  418  Q  418



>gb|KJB80923.1| hypothetical protein B456_013G121600 [Gossypium raimondii]
Length=448

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 75/117 (64%), Gaps = 1/117 (1%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            L + P+ YA++L+++AK KV+ +Y+KS +D LV  GRP + ++ + +VSD++R   +++D
Sbjct  324  LTQNPLEYALKLVKQAKTKVTEEYMKSTMDLLVTRGRPNVKLVGSYIVSDLTRAKFKEVD  383

Query  346  FGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            FGWG+A++ G  T     +F   P  N   E  ++VP+ LP  +M  F +E++ M K
Sbjct  384  FGWGEAVFMGPETCWELISFY-IPSKNKKGEDEIIVPVCLPASTMKSFVKELEDMMK  439



>ref|XP_006376283.1| hypothetical protein POPTR_0013s11650g [Populus trichocarpa]
 gb|ERP54080.1| hypothetical protein POPTR_0013s11650g [Populus trichocarpa]
Length=424

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC+ P+ YA+EL+R  K +++ +Y+KSV D +V+ GRP ++ + N +V+D+SR GL 
Sbjct  305  AGLLCQSPLGYALELVRRQKTQMNEEYIKSVADLMVLKGRPHITSIWNFIVADVSRAGLG  364

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSM  212
             +DFGWG  IY G   A      +     NS  E  +++PI LP   M
Sbjct  365  DVDFGWGKPIYGGPTGAIPYIISILGRFKNSKGEDGIVIPIWLPQPIM  412



>ref|XP_002264599.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Vitis vinifera]
 emb|CBI26419.3| unnamed protein product [Vitis vinifera]
Length=459

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 72/125 (58%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            +A  LC  P+ YA++L++ AKN V  +Y+KSV D +V  GR   +V+R+ LVSD++R G 
Sbjct  317  SAGKLCRNPLEYALDLVKGAKNSVDQEYMKSVADLMVSTGRRHFTVVRSYLVSDLTRAGF  376

Query  358  EKIDFGWGDaiyagsataayg----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG A+Y G+A    G          P  N   E  ++VP  LP  +M IF +E+
Sbjct  377  GDVDFGWGKAVYGGAAKGGVGAIPGVASFYIPFRNHKGEDGIVVPFCLPAAAMEIFVKEL  436

Query  190  KKMTK  176
              + K
Sbjct  437  NSLLK  441



>ref|XP_004301775.1| PREDICTED: methanol O-anthraniloyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVM-RNILVSDISRIG  362
            TA++LC++P+ YA+EL++EAK K++ +Y++S  D + I G P +++   N ++SD +R G
Sbjct  324  TAEILCKQPLGYAVELVKEAKGKMNKEYIQSCADLMAIRGWPPLTLAGNNFILSDNTRTG  383

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            + ++DFGWG  + AG A +    +F  R  +N   +  +LVPI LP   +  F++E++ +
Sbjct  384  VGEVDFGWGRPVVAGPAKSVNLISFYVR-DNNQKEKYGILVPICLPFSCVDRFEQELRSL  442



>ref|XP_006446263.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
 gb|ESR59503.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
Length=456

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRP-RMSVMRNILVSDISRIGL  359
            A+ LC+ PI YA+EL+++AK +++ +Y++S  D +VI GR  + S   N +VSD+  +GL
Sbjct  318  AEQLCKNPIGYAVELVKKAKAQMNEEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGL  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
              +DFGWG  IYAG+A A    +F  +   N + E  +LVPI LP  +M   + E+K +
Sbjct  378  GDVDFGWGKPIYAGTAGAVAVISFFTK-YQNKNGEPGILVPICLPQSAMERLQEELKGL  435



>gb|KHN31434.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=471

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LCE P  YA+ELI + K +V+ +Y+ SV D +V NGR   + +R+ +VSD+   G 
Sbjct  316  TAGKLCENPFGYAVELINKLKGEVTEEYMHSVADLMVTNGRCLFTTVRSFIVSDLRHFGF  375

Query  358  EKIDFGWGDaiyagsataayg---aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
            ++IDFGWG A+Y G A    G   A F      N+  E  +L+PI LP  +M  F  E+ 
Sbjct  376  KQIDFGWGRALYGGVAKGGAGPFPAVFYLMAHKNAKGEEGILLPIWLPAKAMDKFANELD  435

Query  187  KM  182
             M
Sbjct  436  HM  437



>ref|XP_004290447.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Fragaria vesca 
subsp. vesca]
Length=463

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 74/125 (59%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC+ P+ +A+EL++ AK  V+ +Y++S+ D +VI GRP  +V+   LVSD++R G 
Sbjct  320  TAAKLCKNPLGFALELVKSAKADVTEEYMQSLADLMVIRGRPHFTVVGTYLVSDVTRAGF  379

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG A Y G A    GA         P  +++ E  ++VP+ LP  +M  F +E+
Sbjct  380  GDVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRDNNGEDGIVVPVCLPAPAMERFVKEL  439

Query  190  KKMTK  176
              M K
Sbjct  440  DGMLK  444



>ref|XP_009374085.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=458

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK  V+ +Y++S+ D +VI GRP  +V+ + L+SD++R G 
Sbjct  315  TAWRLCNNPLGYALELVRKAKAHVTEEYMRSLADLMVIKGRPHFTVVNSYLMSDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             ++DFGWG A Y G      GA         P  ++  E  ++VP+ LP  +M  F +E+
Sbjct  375  GEVDFGWGKAAYGGPGEGGVGAIPGVASFYIPFRDNIGEDGIVVPVCLPAAAMERFIKEL  434

Query  190  KKM  182
              M
Sbjct  435  DAM  437



>ref|XP_003521737.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=475

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LCE P  YA+ELI + K +V+ +Y+ SV D +V NGR   + +R+ +VSD+   G 
Sbjct  320  TAGKLCENPFGYAVELINKLKGEVTEEYMHSVADLMVTNGRCLFTTVRSFIVSDLRHFGF  379

Query  358  EKIDFGWGDaiyagsataayg---aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
            ++IDFGWG A+Y G A    G   A F      N+  E  +L+PI LP  +M  F  E+ 
Sbjct  380  KQIDFGWGRALYGGVAKGGAGPFPAVFYLMAHKNAKGEEGILLPIWLPAKAMDKFANELD  439

Query  187  KM  182
             M
Sbjct  440  HM  441



>ref|NP_001275839.1| alcohol acyl transferase [Citrus sinensis]
 gb|ABW81204.1| alcohol acyl transferase [Citrus sinensis]
Length=456

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRP-RMSVMRNILVSDISRIGL  359
            A+ LC+ PI YA+EL+++AK +++ +Y++S  D +VI GR  + S   N +VSD+  +GL
Sbjct  318  AEQLCKNPIGYAVELVKKAKAQMNEEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGL  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
              +DFGWG  IYAG+A A    +F  +   N + E  +LVPI LP  +M   + E+K +
Sbjct  378  GDVDFGWGKPIYAGTAGAVAVISFFTK-YQNKNGEPGILVPICLPQSAMERLQEELKGL  435



>ref|XP_006350348.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=453

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 74/120 (62%), Gaps = 0/120 (0%)
 Frame = -2

Query  529  LLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKI  350
            LLC  P+TYAIELI++AKN+V+ +Y+KS+ D++VIN R   +   N L+++ + +GL+++
Sbjct  324  LLCSNPLTYAIELIKQAKNQVNEEYIKSLADYMVINRRRTWTKSWNFLITNDAILGLDEV  383

Query  349  DFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTKFN  170
            DFGWG  I  G   + +         + +  E+S+++ I+LP  +M  F+  I   T  N
Sbjct  384  DFGWGKPILGGVDRSPFSFASFFWSFNKNIGEKSIVIAINLPQQAMEKFQHLIHNFTSKN  443



>ref|NP_001266678.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
 gb|ACG41596.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=458

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 74/124 (60%), Gaps = 6/124 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  +P+ YA+EL++ AK +V+ +Y++SV D +V+ GRP  +V+R  L SD+++ G 
Sbjct  316  TAGDLVAKPLGYAVELVKRAKGEVNVEYMRSVADLMVLRGRPHFTVVRAYLASDLTKAGF  375

Query  358  EKIDFGWGD-----aiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGWG+         G  T+   ATFL  P  N+  E  ++VP+ LP  +M  F +E
Sbjct  376  GNLDFGWGNPVYGGPANVGVGTSPGLATFLV-PCKNAKGEDGIIVPMCLPGPAMETFVKE  434

Query  193  IKKM  182
            +  +
Sbjct  435  MGTL  438



>ref|XP_006470570.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRP-RMSVMRNILVSDISRIGL  359
            A+ LC+ PI YA+EL+++AK +++ +Y++S  D +VI GR  + S   N +VSD+  +GL
Sbjct  318  AEQLCKNPIGYAVELVKKAKAQMNEEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGL  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
              +DFGWG  IYAG+A A    +F  +   N + E  +LVPI LP  +M   + E+K +
Sbjct  378  GDVDFGWGKPIYAGTAGAVAVISFFTK-YQNKNGEPGILVPICLPQSAMERLQEELKGL  435



>emb|CAA94432.1| unknown [Cucumis melo]
Length=455

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA++LIR+AK K + +Y+KS +D +VI GRP  +V+ + ++SD++RIG+
Sbjct  311  TAAKLCGNPLGYAVDLIRKAKAKATMEYIKSTVDLMVIKGRPYFTVVGSFMMSDLTRIGV  370

Query  358  EKIDFGWG  335
            E +DFGWG
Sbjct  371  ENVDFGWG  378



>ref|XP_008462821.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=462

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA++LIR+AK K + +Y+KS +D +VI GRP  +V+ + ++SD++RIG+
Sbjct  318  TAAKLCGNPLGYAVDLIRKAKAKATMEYIKSTVDLMVIKGRPYFTVVGSFMMSDLTRIGV  377

Query  358  EKIDFGWG  335
            E +DFGWG
Sbjct  378  ENVDFGWG  385



>gb|AGW30203.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG   A    +F  + K+N+  E  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPVFAGPVKALDLISFYVQHKNNA--EDGILVPMCLPSSAMERFQQELERIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>ref|XP_009778012.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=461

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 74/116 (64%), Gaps = 1/116 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC  P+TYA++L+++ K++++ +Y++S+ D +VI GRP ++   N ++SD    G +
Sbjct  323  AGLLCSNPLTYAVDLVKKVKDQMNEEYIRSLADLMVIKGRPELTKSWNFIISDNRSAGFD  382

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
            ++DFGWG  I+ G   A    +F   P  N+  E+ +L+ ISLP L+M  F+  ++
Sbjct  383  EVDFGWGVPIFGGVPKAISVISFC-LPLKNNMGEKGILIAISLPPLAMKKFQEIVQ  437



>ref|XP_008779984.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Phoenix 
dactylifera]
Length=460

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 7/126 (6%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
             A  L   P+ YA+EL+R+AK  V+ +Y++SV D +V+ GRP  ++ R  LVSD++R G 
Sbjct  317  AAGRLSRSPLGYALELVRKAKASVTDEYMQSVADLMVLRGRPHFAMARTYLVSDVTRAGF  376

Query  358  EKIDFGWGDa-----iyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            E +DFGWG+        AG       A+F    ++    E  +LVP+ LP  +M  F+ E
Sbjct  377  EAVDFGWGEGVYGGPASAGVGAVPGVASFYTWHRNKG--EEGILVPMCLPGPAMERFQME  434

Query  193  IKKMTK  176
            ++ +T+
Sbjct  435  MESLTE  440



>gb|AGW30201.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPMGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E + +T
Sbjct  382  GDVNFGWGQPVFAGPAKALDLVSFYVQHKNN--TEDGILVPMCLPSSAMERFQQEFEMIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>ref|XP_008391402.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPMGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  I+AG A A    +F  + K+NS  E  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPIFAGPAKALDLISFYVQHKNNS--EDGILVPMCLPFSAMERFQQELERIT  439



>ref|XP_011009229.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=456

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 73/121 (60%), Gaps = 0/121 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  +PI YA+EL+R+AK  ++ +Y++S    +V  GRP  +V    +VSD+  +G 
Sbjct  319  TAGELSRKPIGYALELVRKAKADMTEEYMRSTASLMVSKGRPLFTVPGTYIVSDLRHVGF  378

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            EK+DFGWG+AIY G+A AA        P +N   E  ++VP  LP  ++  F +E++ M 
Sbjct  379  EKVDFGWGNAIYGGTAKAAPELASFYIPFTNKKGEDGIVVPFCLPSPAVERFYKELEGML  438

Query  178  K  176
            K
Sbjct  439  K  439



>ref|XP_010644225.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=195

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A +LC+ P+ +AI L+++AK ++S DY+KSV D +VI GRP  + + N +VSD++R G E
Sbjct  103  AGMLCKNPLEFAIRLVKKAKVEMSQDYIKSVADLMVIKGRPLFTQLGNYIVSDVTRAGFE  162

Query  355  KIDFGWG  335
            ++DFGWG
Sbjct  163  EVDFGWG  169



>gb|AAR99826.1| alcohol acyl transferase [Malus domestica]
Length=470

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPMGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  I+AG A A    +F  + K+NS  E  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPIFAGPAKALDLISFYVQHKNNS--EDGILVPMCLPFSAMERFQQELERIT  439



>ref|XP_006368249.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
 gb|ERP64818.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
Length=459

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC+ P+ Y +EL++E KN++S +Y +S +D LVI G+ +   +R+ +++D +R+   
Sbjct  322  AGLLCKNPLEYGLELVKEIKNRLSEEYTRSAIDLLVIKGKKQYRTVRDFVIADTTRVPFG  381

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +ID GWG  +Y G A A    +F  + K N   E  ++V +SLP   M  F++E+ KM 
Sbjct  382  EIDLGWGKPVYGGPAGAIKDVSFFAKFK-NGKGEDGIVVQVSLPWQIMERFQKELAKMA  439



>ref|XP_006470747.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=468

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRP-RMSVMRNILVSDISRIGL  359
            A+ LC+ PI YA+EL+++AK +++ +Y++S  D +VI GR  + S   N +VSD+  +GL
Sbjct  330  AEQLCKNPIGYAVELVKKAKAQMNEEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGL  389

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIK  188
              +DFGWG  IYAG+A A    +F  +   N + E  +LVPI LP  +M   + E+K
Sbjct  390  GDVDFGWGKPIYAGTAGAVAVISFFTK-YQNKNGEPGILVPICLPQSAMERLQEELK  445



>ref|XP_008384757.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D  V+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLXVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLPSSAMERFQQELERIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>gb|AAG13627.1|AC078840_18 putative hypersensitivity-related (hsr)protein [Oryza sativa 
Japonica Group]
 gb|ABB47848.2| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=553

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 6/126 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L  RP+ YA+EL+R AK +VS +Y++SV D +V  GRP  +V+R  LVSD+++ G 
Sbjct  327  TAGELRARPLGYAVELVRAAKGEVSVEYMRSVADLMVQRGRPHFTVVRAYLVSDVTKAGF  386

Query  358  EKIDFGWGD-----aiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGWG          G       A+FL  P  N+  E  ++VP+ LP  +M  F  E
Sbjct  387  GDLDFGWGKPAYGGPAKGGVGAIPGVASFL-IPFKNAKGEDGIVVPMCLPGPAMDKFVEE  445

Query  193  IKKMTK  176
            + K+ K
Sbjct  446  MGKLMK  451



>gb|AFK36385.1| unknown [Medicago truncatula]
Length=459

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L E P+ YA+EL+++AK+ V+ +Y+ SV D +VI GRP  +V+R+ LV D++R G 
Sbjct  315  TAGKLMENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHFTVVRSYLVFDVTRAGF  374

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              ++FGWG A+Y G A    GA         P  N+  E  +++P+ LP  +M  F +E+
Sbjct  375  GDVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPLCLPAQAMEKFVKEL  434

Query  190  KKMTKFN  170
              + K N
Sbjct  435  DSVLKNN  441



>ref|XP_006878645.1| hypothetical protein AMTR_s00011p00264700 [Amborella trichopoda]
 gb|ERM94790.1| hypothetical protein AMTR_s00011p00264700 [Amborella trichopoda]
Length=154

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 74/117 (63%), Gaps = 8/117 (7%)
 Frame = -2

Query  514  PITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKIDFGWG  335
            P+ YA+EL+R+A+ +VS DY++SV   +V+ GRP  +V+   LVSD+ R GL ++DFGWG
Sbjct  34   PLGYALELVRKAQEEVSDDYMRSVAALMVMRGRPHYTVVNTYLVSDLRRAGLREVDFGWG  93

Query  334  Daiyagsataayga------TFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             A+Y G A A  GA       F+   K+    E +V +PI LP  +M  F RE+K+M
Sbjct  94   KAVYGGLAKAGVGAIPGILSCFMAF-KNMQGVEGTV-IPICLPEAAMPRFTRELKRM  148



>ref|XP_009589917.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
tomentosiformis]
Length=444

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = -2

Query  529  LLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKI  350
            LLC   ++YA+EL+++ K+ ++ +Y++SV D +VI GRP +S   N +VSD   +  +++
Sbjct  316  LLCSSSLSYAVELVKKVKDHMNEEYIRSVADLMVIKGRPELSKSWNFIVSDNRSVRFDEV  375

Query  349  DFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            DFGWG  I+ G   A    +F   P  N   E+ +L+ ISLP L+M  F+  +  MT
Sbjct  376  DFGWGKPIFGGVPKAISFISFC-VPVKNDKGEKGILIAISLPPLAMEKFQEAVYNMT  431



>ref|XP_004244681.1| PREDICTED: methanol O-anthraniloyltransferase [Solanum lycopersicum]
 gb|AGK82804.1| alcohol acyltransferase 2 [Solanum lycopersicum]
Length=447

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC   +TYA+EL+++ K  ++ +Y+KS+ + +VI GRP++S   N +VSD   +G +
Sbjct  318  AGLLCSNSLTYAVELVKKLKYDMNEEYIKSLTNLMVIKGRPKLSKSWNFIVSDNRFVGFD  377

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +IDFGWG  I+ G +      + +  P +N   E+ +LV ISLP L+M  F++ +  M 
Sbjct  378  EIDFGWGKPIFGGVSEKISLIS-IGIPINNEKGEKGILVAISLPPLAMEKFQKIVYNMN  435



>ref|XP_002524024.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF38392.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=434

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A+ LC++PI YA+EL+R+AK  V+ +Y++SV D +VI  RP  +++R  LVS + ++ L+
Sbjct  301  AEDLCQKPIGYALELVRKAKANVTEEYMRSVADLMVIRCRPWYTMVRTFLVSGVGKLRLD  360

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++DFGWG A+Y G A     +  +   K     E  VLV + LP L+M  F +E+  M K
Sbjct  361  EVDFGWGRALYGGPAKGNVASFHIAYRKKEG--EDGVLVTLCLPKLAMQRFVKELDSMLK  418



>gb|AGK82816.1| alcohol acyltransferase 2 [Solanum pimpinellifolium]
Length=447

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC   +TYA+EL+++ K  ++ +Y+KS+ + +VI GRP++S   N +VSD   +G +
Sbjct  318  AGLLCSNSLTYAVELVKKLKYDMNEEYIKSLTNLMVIKGRPKLSKSWNFIVSDNRFVGFD  377

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +IDFGWG  I+ G +      + +  P +N   E+ +LV ISLP L+M  F++ +  M 
Sbjct  378  EIDFGWGKPIFGGVSEKISLIS-IGIPINNEKGEKGILVAISLPPLAMEKFQKIVYNMN  435



>gb|AAN85436.1| acyltransferase 2 [Capsicum chinense]
Length=453

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 76/122 (62%), Gaps = 1/122 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC   +TYA+EL+++ K+ ++ +Y+KS++D + I GRP ++   N +VSD   IGL+
Sbjct  323  AGLLCSNSLTYAVELVKKVKDHMNEEYIKSLIDLMAIKGRPELTKSWNFIVSDNRSIGLD  382

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++ FGWG  I+ G A A    +F   P  N   ++ +L+ ISLP ++M  F+  + K++ 
Sbjct  383  EVGFGWGRPIFGGVAKAISFISF-GVPVKNDKGDKGILIAISLPPMAMKKFEEVVYKVSS  441

Query  175  FN  170
             N
Sbjct  442  KN  443



>gb|ACU24193.1| unknown [Glycine max]
Length=348

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 3/118 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LCE+P+ YA++LI++A+ +VS +Y+ SV+D +   GRP  +V+R+ LV D +  G  
Sbjct  217  AGDLCEKPLEYAVQLIQKARGEVSEEYIDSVVDLMASEGRPLFTVVRSCLVLDTTEAGFR  276

Query  355  KIDFGWGDaiyagsataayg---aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             +DFGWG+A+Y G A A  G   A     P  N+  E  +LV I LP   M  F +E+
Sbjct  277  NLDFGWGNALYGGMAVAGAGAFPAVNFHVPSQNAKGEEGILVLICLPSQVMKAFAKEL  334



>gb|EYU41390.1| hypothetical protein MIMGU_mgv1a009242mg [Erythranthe guttata]
Length=348

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 68/125 (54%), Gaps = 4/125 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P  YA+EL+ +AK K + ++VKSV D +VI GRP  +++ N  VSD+  +G 
Sbjct  216  TAESLSKNPFHYAVELVMKAKTKATEEHVKSVADLMVIRGRPHFTLVGNYAVSDVRHLGF  275

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +DFGWG         G        +    P  N   E  ++VPISL   +M +F RE+
Sbjct  276  GDVDFGWGKPVYGGPAKGEVGVVPELSSYYIPFKNKKGENGIIVPISLQKNAMDVFVREL  335

Query  190  KKMTK  176
            + M K
Sbjct  336  EIMLK  340



>ref|XP_008359513.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Malus domestica]
Length=309

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA+EL+R+AK   + ++++S+   +VI GRP  +V+ + ++SD++R G 
Sbjct  171  TAGRLCNNPLGYALELVRKAKADXTEEHMRSLAALMVIKGRPHFTVVNSYVMSDLTRAGF  230

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             ++DFGWG A Y G A     A++   P  ++  E  ++VP+ LP ++M  F +E+  M
Sbjct  231  REVDFGWGKAAYGGPAKGRVVASYY-IPFRDNRGEDGIVVPVCLPAVAMEKFIKELDAM  288



>gb|EYU26841.1| hypothetical protein MIMGU_mgv1a011322mg [Erythranthe guttata]
Length=285

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            L   P  YA+ELIR+ K+ V+ +Y++S+ D LVI GRP  +V+R+ +VSD++R G+  +D
Sbjct  145  LSSNPFEYALELIRKTKSDVTEEYMRSLADLLVIRGRPHFTVVRSYVVSDLTRAGIGDLD  204

Query  346  FGWGDaiyagsata------aygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKK  185
            FGWG A+  G A                 P  N   E  ++VP+ LP  +M +F +E++ 
Sbjct  205  FGWGKAVSGGPAKCDVGAIPGVALASFYIPFKNKKGENGIVVPVCLPADAMEVFVKELEM  264

Query  184  M  182
            M
Sbjct  265  M  265



>ref|XP_006361592.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC  P+T A+EL+++ K+ ++ +YVKS+ D +VI GRP+++   N L+SD    G +
Sbjct  318  AGLLCSNPLTNAVELVKKVKDHLNEEYVKSMTDLMVIKGRPQITKSWNFLISDNRYAGFD  377

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            + DFGWG+ I+ G   A    +F    K N   E+ VL+ ISLP L+M    ++I KMT 
Sbjct  378  EFDFGWGNPIFGGVPKATSFISFGVSVK-NDKGEKGVLIAISLPPLAMKKL-QDIYKMTF  435

Query  175  FN  170
             N
Sbjct  436  TN  437



>gb|ACF07921.1| alcohol acyl transferase [Prunus armeniaca]
Length=453

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNI-LVSDISRIG  362
            T +LLC  P+ Y +EL+R++K ++  +Y++++ DF VI GRP + +  N+ +VSD    G
Sbjct  328  TVELLCASPLGYGVELVRKSKAQMDKEYMQTLADFFVIRGRPPLPMGWNVFIVSDNRHTG  387

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            L + D GWG  ++AG A AA   +F  R  +N   E   LVPI LP   +  F+ E+KKM
Sbjct  388  LGEFDVGWGRPLFAGLARAASMISFYVR-DNNQEEEFGTLVPICLPSTCLDRFEEELKKM  446

Query  181  T  179
            T
Sbjct  447  T  447



>ref|XP_011085894.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=444

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 75/126 (60%), Gaps = 6/126 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P+ YA+EL+R+ K  V+ +Y+KSV D +VI GRP  +V+R  LVS++   G 
Sbjct  300  TAEKLSKNPLGYALELVRKTKADVTEEYMKSVADLMVIRGRPFFTVVRTYLVSNVIHAGF  359

Query  358  EKIDFGWGDaiyagsataa-----ygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
              +DFGWG+A Y G A           +F    K+N   E  ++VPI L   +M +F +E
Sbjct  360  GDVDFGWGNAAYGGPAKGGIDPVLGVVSFYVASKNNKG-ENGIVVPICLAANAMEVFVKE  418

Query  193  IKKMTK  176
            ++KM K
Sbjct  419  LEKMLK  424



>dbj|BAJ92444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 72/122 (59%), Gaps = 6/122 (5%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            LC  P++YA++L++EAK++V+ +Y++SV D +V  GRP  +V+R  L SD+++ G   +D
Sbjct  345  LCANPLSYAVKLVKEAKSEVNVEYMRSVADLMVQRGRPHFTVVRAYLASDVTKAGFGDLD  404

Query  346  FGW-----GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            FGW     G     G       A+FL  P  N+  E  +++P+ LP  +M  F  E+ K+
Sbjct  405  FGWGRPVYGGPAKGGVGAIPGVASFL-IPFKNAKGEDGIVIPMCLPGPAMDRFVEEMGKL  463

Query  181  TK  176
             +
Sbjct  464  LR  465



>gb|KHN16174.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=338

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 69/115 (60%), Gaps = 3/115 (3%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            LCE+P+ YA++LI++A+ +VS +Y+ SV D +   GRP  +V+R+ LV D +  G   +D
Sbjct  210  LCEKPLEYAVQLIQKARGEVSEEYIDSVADLMASEGRPLFTVVRSCLVLDTTEAGFRNLD  269

Query  346  FGWGDaiyagsataayg---aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            FGWG+A+Y G A A  G   A     P  N+  E  +LV I LP   M  F +E+
Sbjct  270  FGWGNALYGGMAVAGAGAFPAVNFHVPSQNAKGEEGILVLICLPSQVMKAFAKEL  324



>ref|XP_002438993.1| hypothetical protein SORBIDRAFT_10g029610 [Sorghum bicolor]
 gb|EER90360.1| hypothetical protein SORBIDRAFT_10g029610 [Sorghum bicolor]
Length=450

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 72/125 (58%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC   + +A+EL++ AK+ V+ DY+ SV D +V+ GRP   + R  +VSDIS  G 
Sbjct  324  TAGELCGGDLGFALELVKMAKSAVTYDYLVSVADLMVLTGRPLFELSRTYIVSDISHAGF  383

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + IDFGWG+A+Y G A    G       +  R K N   E   +VPI LP  +M  F+ E
Sbjct  384  KSIDFGWGEAVYGGPAKGGEGPLPGVTNYFSRAK-NGKGEEGTVVPICLPKDAMEKFQLE  442

Query  193  IKKMT  179
            ++ +T
Sbjct  443  VEGLT  447



>gb|KDP39567.1| hypothetical protein JCGZ_02587 [Jatropha curcas]
Length=444

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  PI YA+EL+R+AK  V+ +Y++SV D +V+ GRP+ +++R+ LVS  +++  +
Sbjct  314  AGDLCGNPIGYALELVRKAKTNVTEEYMRSVADLMVVKGRPKFTMVRSFLVSGAAKMRFD  373

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            ++DFGWG A+Y G A     +  +     N   E  V+V + LP L+M  F +E+  + K
Sbjct  374  EVDFGWGRAVYGGPAMGHVASFHIA--GRNKKGEDGVIVTLCLPRLAMQRFVKELDSLLK  431



>ref|XP_011007950.1| PREDICTED: LOW QUALITY PROTEIN: methanol O-anthraniloyltransferase-like 
[Populus euphratica]
Length=279

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A LLC+ P+ YA+EL+   K +++ +Y+KSV D LV+ GRP  + + N L++D++R+GL 
Sbjct  207  AGLLCQSPLGYALELVTRLKTQMNEEYIKSVADLLVLKGRPHYTTVGNFLIADVTRLGLG  266

Query  355  KIDFGWG  335
             IDFGWG
Sbjct  267  DIDFGWG  273



>gb|AHC32224.2| alcohol acyl transferase 1 [Eriobotrya japonica]
Length=459

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPR-MSVMRNILVSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ +      +VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYLYTGSYFIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A     F  + K+N  TE  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPVFAGPAKAVDLFRFYVQHKNN--TEDGILVPMCLPSSAMERFQQELERIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>emb|CAN68586.1| hypothetical protein VITISV_027876 [Vitis vinifera]
Length=345

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            LC+ P+ YA+EL+++ K ++S +Y+KS+   +VI GRP  +     ++SD +R+  + +D
Sbjct  223  LCKNPLGYAVELVKKVKAEMSEEYIKSLAALMVIKGRPLYTRTGFFIISDNTRVDFQDVD  282

Query  346  FGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            FGWG  +Y G A A+   +F  R + NS  E  ++VPI LP   M  F++E+K+M
Sbjct  283  FGWGKPLYGGLAKASSLISFFLRFR-NSKGEEGIVVPIQLPLPVMERFEQEVKRM  336



>gb|KEH40971.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=461

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 4/127 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L E P+ YA+ L+++AK  V+ +Y+ S+ D +VI GRP  +V+++ LVSD++R G 
Sbjct  317  TAGKLIENPLAYALNLVKKAKANVTQEYMHSIADLMVIKGRPHFNVVKSYLVSDVTRGGF  376

Query  358  EKIDFGWG----DaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
            EK+D+GWG         G+     G      P  N+  E  +++P   P+  M  F +E+
Sbjct  377  EKVDYGWGKPIYGGPARGADGDIPGLASFHIPFKNAKGEEGLVIPFYFPNQVMERFVKEM  436

Query  190  KKMTKFN  170
              + K N
Sbjct  437  DSVLKSN  443



>gb|KCW84616.1| hypothetical protein EUGRSUZ_B01447 [Eucalyptus grandis]
Length=315

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            +A  LC+ P+ YA+EL+++AK +V+ + +KS+ D +VI GRP  + +R+ +VSD ++ G 
Sbjct  177  SAGKLCQNPLGYALELVKKAKAEVTEESMKSLADLMVIRGRPHFTKVRSFVVSDATKAGF  236

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              +DFGWG A+Y G        +F     +N   E S+LVP+ LP  +M  F  E++   
Sbjct  237  GDVDFGWGKAVYGGPVRGTLLVSF-HILFTNRQGETSILVPVCLPAPAMQRFVLELEASL  295

Query  178  K  176
            K
Sbjct  296  K  296



>ref|XP_002319767.1| transferase family protein [Populus trichocarpa]
 gb|EEE95690.1| transferase family protein [Populus trichocarpa]
 gb|AJD25144.1| benzoyl-CoA:salicyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=459

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 73/126 (58%), Gaps = 6/126 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L E+P  YA+EL+R+AK  V+ +Y++SV   +V  GRP  +V+R  LVSD+   G 
Sbjct  318  TAGELSEKPFGYALELVRKAKADVTEEYMRSVASLMVTKGRPHFTVVRAYLVSDLRSAGF  377

Query  358  EKIDFGWGDaiyagsataay-----gaTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            E +DFGWG+AIY G+A          A+FL  P  N   E  ++VP  LP  +M  F  E
Sbjct  378  EVVDFGWGNAIYGGAAKGGVGAIPGVASFL-IPFKNKKGENGIVVPFCLPAPAMERFVEE  436

Query  193  IKKMTK  176
            +  M K
Sbjct  437  LDGMLK  442



>gb|AAS48090.1| alcohol acyl transferase [Pyrus communis]
Length=442

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   + L VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  ++AG A A    +F  + K+N   E  +LVP+ LP  +M  F++E++++T
Sbjct  382  GDVNFGWGQPVFAGPAKALDLISFYVQHKNN--IEDGILVPMCLPSSAMERFQQELERIT  439



>gb|EYU41389.1| hypothetical protein MIMGU_mgv1a006154mg [Erythranthe guttata]
Length=455

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            L   P  YA+ELIR+ K+ V+ +Y++S+ D LVI GRP  +V+R+ +VSD++R G+  +D
Sbjct  317  LSSNPFEYALELIRKTKSDVTEEYMRSLADLLVIRGRPHFTVVRSYVVSDLTRAGIGDLD  376

Query  346  FGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            FGWG A+  G A    GA         P  N   E  ++VP+ LP  +M +F +E++ M
Sbjct  377  FGWGKAVSGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPVCLPADAMEVFVKELEMM  435



>ref|XP_003574156.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Brachypodium 
distachyon]
Length=463

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 70/125 (56%), Gaps = 6/125 (5%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC RP+ +A+EL+R AK++V  +Y++SV D +V  GRP  +V+R  L SD+++ G  
Sbjct  324  AGELCARPLAHAVELVRRAKSEVDVEYMRSVADLMVQRGRPHFTVVRAYLASDVTKAGFG  383

Query  355  KIDFGW-----GDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             +DFGW     G     G       A+FL  P  N   E  ++VP+ LP  +M  F  E+
Sbjct  384  DLDFGWGRPVYGGPAKGGVGAIPGVASFLI-PFKNGKGEDGIVVPMCLPGPAMDKFVVEM  442

Query  190  KKMTK  176
             ++ +
Sbjct  443  ARLLR  447



>ref|XP_011085897.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=465

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 78/126 (62%), Gaps = 5/126 (4%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSV-MRNILVSDISRIG  362
            TA  LC++P+ +A+EL+ +AK+KV+ DY+KSV D +VI GRP  +  MR  +VSD++ +G
Sbjct  319  TAGNLCKQPLDFALELVMKAKSKVTEDYIKSVADLMVIRGRPHFAFDMRTYVVSDVAYLG  378

Query  361  LEKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
             E ++ G G  ++ G A A  G       L  P  N+  E+  LVPI LP  +M +F +E
Sbjct  379  SENLEIGGGSPVFCGPAKAGVGVIPGLGSLNIPFKNNKGEKGKLVPICLPANAMEVFVKE  438

Query  193  IKKMTK  176
            ++ + K
Sbjct  439  LETIVK  444



>ref|XP_010110389.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26221.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=493

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  532  KLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEK  353
            ++LCE  + + +EL+++AK ++S DY+KSV D +V  GRP  +V  N  VSD +R+G  +
Sbjct  330  RVLCESSLGHVVELVKKAKAEMSEDYIKSVADLMVTRGRPLHAVSGNYFVSDNTRVGYGE  389

Query  352  IDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHL-SMLIFKREIKKM  182
            IDFGWG  ++ G A A    +F    +     E+ V+VPI LP + +M  F++E+KKM
Sbjct  390  IDFGWGLPVFGGPAKALSFISFYV--EYEEKGEKGVVVPICLPTVRAMDRFEQELKKM  445



>ref|XP_010045975.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
Length=354

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            +A  LC+ P+ YA+EL+++AK +V+ + +KS+ D +VI GRP  + +R+ +VSD ++ G 
Sbjct  216  SAGKLCQNPLGYALELVKKAKAEVTEESMKSLADLMVIRGRPHFTKVRSFVVSDATKAGF  275

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              +DFGWG A+Y G        +F     +N   E S+LVP+ LP  +M  F  E++   
Sbjct  276  GDVDFGWGKAVYGGPVRGTLLVSF-HILFTNRQGETSILVPVCLPAPAMQRFVLELEASL  334

Query  178  K  176
            K
Sbjct  335  K  335



>gb|EYU41386.1| hypothetical protein MIMGU_mgv1a006089mg [Erythranthe guttata]
Length=458

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (60%), Gaps = 4/119 (3%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            L   P  YA+ELIR+ K+ V+ +Y++S+ D +VI GRP  +V+R+ LVSD++  G   +D
Sbjct  317  LSTNPFEYALELIRKTKSDVTEEYMRSLADMMVIRGRPHFTVVRSYLVSDVTHAGFGDVD  376

Query  346  FGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            FGWG A Y G A    GA         P  N + E  ++VP+ LP  +M +F +E++ M
Sbjct  377  FGWGKAAYGGPAKGGVGAIPGVASFYIPFKNKNGENGIVVPVCLPADAMEVFVKELEMM  435



>ref|XP_007208844.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
 gb|EMJ10043.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
Length=558

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGR-PRMSVMRNILVSDISRIGL  359
            AK +C  P+ YA+EL+ +AK  V+ +Y++SV D + I GR P+  +  N +VSD SR G 
Sbjct  322  AKAVCTNPLGYALELVMKAKATVNEEYMRSVADLMEIRGRLPKYPLTGNFIVSDTSRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             ++ FGWG  ++ G A A    +F  + K N+  E  VLVPI LP   M  F++E+++MT
Sbjct  382  GEVSFGWGKPVFGGPAKALDLISFYVQHKCNN--EEGVLVPICLPLSDMERFQQELERMT  439



>emb|CBI29212.3| unnamed protein product [Vitis vinifera]
Length=399

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            LC+ P+ YA+EL+++ K ++S +Y+KS+   +VI GRP  +     ++SD +R+  + +D
Sbjct  238  LCKNPLGYAVELVKKVKAEMSEEYIKSLAALMVIKGRPLYTRTGFFIISDNTRVDFQDVD  297

Query  346  FGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            FGWG  +Y G A A+   +F  R + NS  E  ++VPI LP   M  F++E+K+M
Sbjct  298  FGWGKPLYGGLAKASSLISFFLRFR-NSKGEEGIVVPIQLPLPVMERFEQEVKRM  351



>ref|XP_003563544.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Brachypodium 
distachyon]
Length=453

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 72/125 (58%), Gaps = 6/125 (5%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC   + +A+EL+++AK+ V+ DY+ SV D +V  GRP  ++ R  +VSD+S  G 
Sbjct  326  TAGELCAGGMGFALELVKKAKSAVTYDYLLSVADLMVSRGRPLFALTRTYIVSDVSHAGF  385

Query  358  EKIDFGWGDaiyagsataayg-----aTFLERPKSNSSTERSVLVPISLPHLSMLIFKRE  194
            + +DFGWG+ +Y G A    G       +  R K N   E   +VP+ LP  +M  F+ E
Sbjct  386  KSVDFGWGEPLYGGPAKGGEGPLPGVTNYFSRSK-NGKGEEGTVVPVCLPKDAMEKFQLE  444

Query  193  IKKMT  179
            ++ +T
Sbjct  445  VQGLT  449



>ref|XP_010672751.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 72/123 (59%), Gaps = 4/123 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L   PI YA+ LI++ K+ V+ +Y+ S+ D +V+ GRP  +V+R  +VSD++R G 
Sbjct  328  TAGKLATNPIGYALGLIKKTKSDVTQEYMASLADLMVLKGRPHFTVVRTFVVSDVTRAGF  387

Query  358  EKIDFGWGDaiyagsataayga----TFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
              +D+GWG   Y G A    GA         P  N + ++ ++VP+ LP  +M IF +E+
Sbjct  388  ADLDYGWGPPAYGGPAKGGVGAIPGVASFYIPFKNGNGDKGIVVPLCLPGNAMEIFVKEL  447

Query  190  KKM  182
             K+
Sbjct  448  NKL  450



>ref|XP_006878638.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
 gb|ERM94783.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
Length=476

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 6/116 (5%)
 Frame = -2

Query  514  PITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKIDFGWG  335
            P  YA+EL+R+AK +V+ +Y++SV D +V  GRP  +V+   LVSDI R G  ++DFGWG
Sbjct  324  PFGYAVELVRKAKEEVTDEYMRSVADLMVTKGRPHFTVVNTFLVSDIRRAGFGEVDFGWG  383

Query  334  Daiyagsataa-----ygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             A+Y G+A          A+F    K+    + +V +PI LP  +M  F RE+K+M
Sbjct  384  KAVYGGAAKGGVGAIPGVASFFIAFKNGDGVDGTV-IPICLPEAAMPRFTREVKRM  438



>gb|KGN63335.1| hypothetical protein Csa_2G429070 [Cucumis sativus]
Length=308

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T   LC  P+ YAI+LIR+AK K +A+Y+KS++D +VI GRP ++ + + ++SD++RIG 
Sbjct  171  TVAKLCGNPLGYAIDLIRKAKAKATAEYIKSMVDLMVIKGRPCLTTVGSFIMSDLTRIGF  230

Query  358  EKIDFGW  338
            E +DFGW
Sbjct  231  ENMDFGW  237



>gb|KDP39572.1| hypothetical protein JCGZ_02592 [Jatropha curcas]
Length=329

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 70/123 (57%), Gaps = 0/123 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ + + PI Y +ELIR+AK +   + +KSV D LVI GRP  +V    +VSD+   G 
Sbjct  198  TAEEISKNPIGYGLELIRKAKMEFDRECIKSVADLLVIKGRPHFAVDGTYMVSDVRYAGF  257

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            +++DFGWG+AIY G A A         P      E  +++PI LP  +M  F +E+K + 
Sbjct  258  KEVDFGWGNAIYGGPAKAIPIYASFYVPFERKKGENGIVIPICLPAQAMERFVKELKNLL  317

Query  178  KFN  170
              N
Sbjct  318  DDN  320



>gb|AGW30205.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNIL-VSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D +V+ GRP+ S     L VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLMVLRGRPQYSTTGCYLIVSDNTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG+ ++AG A A    +F  + K+N  TE  +LVP+ L   +M  F++E++++T
Sbjct  382  GDVNFGWGEPVFAGPAKALDLISFYVQHKNN--TEDGILVPMCLSSSAMERFQQELERIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>ref|XP_002270240.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=445

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLEKID  347
            LC+ P+ YA+EL+++ K ++S +Y+KS+   +VI GRP  +     ++SD +R+  + +D
Sbjct  323  LCKNPLGYAVELVKKVKAEMSEEYIKSLAALMVIKGRPLYTRTGFFIISDNTRVDFQDVD  382

Query  346  FGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            FGWG  +Y G A A+   +F  R + NS  E  ++VPI LP   M  F++E+K+M
Sbjct  383  FGWGKPLYGGLAKASSLISFFLRFR-NSKGEEGIVVPIQLPLPVMERFEQEVKRM  436



>emb|CDP17523.1| unnamed protein product [Coffea canephora]
Length=459

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = -2

Query  526  LCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMS-VMRNILVSDISRIGLEKI  350
            LC     YA+EL+++AK++V+ D+++S +D+ V++G+P  S ++++ +VSD SR G++++
Sbjct  323  LCNNSFVYALELVKKAKHQVTEDFIESAIDYSVLHGKPGYSTLLKDWIVSDASRTGIDEV  382

Query  349  DFGWGDaiyagsataaygaTFLERPK-SNSSTERSVLVPISLPHLSMLIFKREIKKMTK  176
            DFGWG  IY G              +  N+  + S++VP+ LP  +M  F++E++KM K
Sbjct  383  DFGWGKPIYGGIMDGGPTFNMAVYSRLRNTQGDDSLVVPVCLPVAAMENFQKEMEKMIK  441



>dbj|BAC58010.1| alcohol acyltransferase [Cucumis melo]
Length=461

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YA++LIR+AK K +      ++DF+VI GRPR + +   ++SDI+RIG 
Sbjct  318  TAAKLCGNPLGYAVDLIRKAKAKATTHLTSPMVDFMVIKGRPRFTELMRFMMSDITRIGF  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKS----NSSTERSVLVPISLPHLSMLIFKREI  191
            E +DFGWG AI+ G      G        S    N   + S++VP+ LP   M  F+  +
Sbjct  378  ENVDFGWGKAIFGGPIIGGCGIIRGMISYSIAFMNRHNKNSLVVPLCLPPPDMESFRANV  437

Query  190  K  188
             
Sbjct  438  H  438



>gb|KJB44361.1| hypothetical protein B456_007G247900 [Gossypium raimondii]
Length=449

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA+ L + P+ YA++L+++AK +VS +YVKSV D +++ GRP   +  + +V+D++R G 
Sbjct  319  TARKLSQNPLGYAVKLVKQAKERVSGEYVKSVADLMMMKGRPHYPMAGSCVVTDVTRAGF  378

Query  358  EKIDFGWGDaiyagsataaygaTF-LERPKSN-SSTERSVLVPISLPHLSMLIFKREIKK  185
            E++DFGWG A+Y G A A  GA      P  N  + +  + + I LP  +M IF +E++ 
Sbjct  379  EEVDFGWGKAVYGGLAKAGLGAKLPAASPCVNLVAIKGGIAISICLPAPAMDIFAKELES  438

Query  184  MTK  176
             +K
Sbjct  439  HSK  441



>gb|KGN63336.1| hypothetical protein Csa_2G430570 [Cucumis sativus]
Length=427

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T   LC  P+ YAI+LIR+AK K +A+Y+KS +D +VI GRP ++ + + ++SD++RIG 
Sbjct  301  TVAKLCGNPLGYAIDLIRKAKAKATAEYIKSTVDLMVIKGRPCLTTVGSFIMSDVTRIGF  360

Query  358  EKIDFGW  338
            E +DFGW
Sbjct  361  ENVDFGW  367



>ref|XP_003536109.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=459

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LCE+P+ YA++LI++A+ +VS +Y+ SV D +   GRP  +V+R+ LV D +  G  
Sbjct  328  AGDLCEKPLEYAVQLIQKARGEVSEEYIDSVADLMASEGRPLFTVVRSCLVLDTTEAGFR  387

Query  355  KIDFGWGDaiyagsataayg---aTFLERPKSNSSTERSVLVPISLPHLSMLIFKREI  191
             +DFGWG+A+Y G A A  G   A     P  N+  E  +LV I LP   M  F +E+
Sbjct  388  NLDFGWGNALYGGMAVAGAGAFPAVNFHVPSQNAKGEEGILVLICLPSQVMKAFAKEL  445



>ref|XP_006446267.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
 gb|ESR59507.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
Length=456

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRP-RMSVMRNILVSDISRIGL  359
            A+ LC+ PI YA+EL+++AK +++ +Y++SV D +VI GR  +     N +VSD+S +G 
Sbjct  318  AEHLCKNPIGYAVELVKKAKAQMNDEYIRSVADLMVIKGRRIKFPTRGNFIVSDLSNLGF  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             ++D GWG  IYAG+A A    +F  +   N + E  + VPI LP   M  F+ E ++M
Sbjct  378  GEVDLGWGKPIYAGTAGAVELISFFVK-HQNKNGEPGIFVPICLPQSVMERFQEEQRRM  435



>ref|XP_004986631.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 72/124 (58%), Gaps = 3/124 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YAIEL+++AK +V  +Y++SV D +V+ GRP +S +R  +VSD+ +   
Sbjct  324  TAGALCANPLGYAIELVKKAKEEVDMEYIRSVADLVVLRGRPPVSFVRTYVVSDVRKAPA  383

Query  358  EKIDFGWGDaiyagsataaygaTFLER---PKSNSSTERSVLVPISLPHLSMLIFKREIK  188
             ++DFGWG  +Y G A       ++       +++  E  + VP+ LP  +M  F  E+ 
Sbjct  384  ARLDFGWGRPVYGGPAEVGGDLAWVASYFVSVTDARGEEGIAVPVCLPRPAMERFAEEMG  443

Query  187  KMTK  176
            K+ +
Sbjct  444  KLLQ  447



>ref|XP_007210147.1| hypothetical protein PRUPE_ppa025118mg [Prunus persica]
 gb|EMJ11346.1| hypothetical protein PRUPE_ppa025118mg [Prunus persica]
Length=321

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNI-LVSDISRIG  362
            T +L+C  P+ Y +EL+R+ K ++  +Y++S+  FLVI GRP   +  N+ +VSD    G
Sbjct  193  TVELVCASPLGYGVELVRKNKAQMGKEYMQSLAHFLVIRGRPPPPMAWNVFIVSDNRHTG  252

Query  361  LEKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
            L + D GWG  +YAG A A +  +F  R ++N   E  +LVPI LP + +  F++E+K+M
Sbjct  253  LGEFDVGWGRPVYAGLARAVHVISFYVR-ENNQEEEFRILVPICLPRMCLERFEQELKRM  311



>ref|XP_008373467.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRN-ILVSDISRIGL  359
            A+ LC+ P+ YA+EL+++AK  ++ +Y++SV D LV+ GRP+ S   +  +VSD +R G 
Sbjct  322  AEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTXSYFIVSDTTRAGF  381

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
              ++FGWG  + AG A A    +F  + K+N  T   +LVP+ LP  +M  F++E++ +T
Sbjct  382  GDVNFGWGRPVIAGPAKALDLISFYIQHKNN--TXDGILVPMCLPFSAMERFQQELEMIT  439

Query  178  K  176
            +
Sbjct  440  Q  440



>ref|XP_009374321.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            T + L + PI YA+EL+++AK K+S +Y+KSV D +V+ GRP  S  RN +V D +R G 
Sbjct  320  TVESLRKNPIGYALELVKQAKAKMSDEYIKSVADLMVMRGRPDFSSARNFVVGDTTRAGF  379

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             ++DFGWG  ++AG A          R K+    E  +LV   LP  +    ++E+K+MT
Sbjct  380  GEVDFGWGKPVFAGPAKCVNMINMYVRHKNKE--ENGILVLTCLPLSAGGGVQQELKRMT  437



>ref|XP_010058390.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=465

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 71/119 (60%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA+EL+++AK  VS +YV+S +D  VI G P  + + + +V+D +++G E
Sbjct  327  AGHLCTSPLGYAVELVKKAKEMVSEEYVRSFIDASVIKGGPNHTTVWDYVVADTTKVGFE  386

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             +DFGWG  +Y G A A    +   + K+    E  ++  I LP  +M  F+ E++KMT
Sbjct  387  AVDFGWGKPVYGGVAGAVPSISIYVKYKTREG-EEGIVAAIMLPERAMRRFQEELEKMT  444



>gb|KCW72709.1| hypothetical protein EUGRSUZ_E01161 [Eucalyptus grandis]
Length=463

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 71/119 (60%), Gaps = 1/119 (1%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGLE  356
            A  LC  P+ YA+EL+++AK  VS +YV+S +D  VI G P  + + + +V+D +++G E
Sbjct  325  AGHLCTSPLGYAVELVKKAKEMVSEEYVRSFIDASVIKGGPNHTTVWDYVVADTTKVGFE  384

Query  355  KIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
             +DFGWG  +Y G A A    +   + K+    E  ++  I LP  +M  F+ E++KMT
Sbjct  385  AVDFGWGKPVYGGVAGAVPSISIYVKYKTREG-EEGIVAAIMLPERAMRRFQEELEKMT  442



>ref|XP_006470571.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = -2

Query  535  AKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRP-RMSVMRNILVSDISRIGL  359
            A+ LC+ PI YA+EL+++AK +++ +Y++SV D +VI GR  +     N +VSD+S +G 
Sbjct  318  AEQLCKNPIGYAVELVKKAKAQMNDEYIRSVADLMVIKGRRIKFPTRGNFIVSDLSNLGF  377

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKM  182
             ++D GWG  IYAG+A A    +F  +   N + E    VPI LP   M  F+ E+++M
Sbjct  378  GEVDLGWGKPIYAGTAGAVELISFFVK-HQNKNGEPGNFVPICLPQSVMERFQEELRRM  435



>ref|XP_002319765.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
 gb|EEE95688.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
Length=440

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  L +RPI YA+EL+++AK  ++ +Y++S    +V  GRP  +V    +VSD+ R G 
Sbjct  319  TAGELSKRPIGYALELVKKAKAGMTEEYMRSTASLMVSKGRPLFTVPGTYIVSDLRRAGF  378

Query  358  EKIDFGWGDaiyagsataaygaTFLERPKSNSSTERSVLVPISLPHLSMLIFKREIKKMT  179
            EK+DFGWG+A+Y G+A A         P +N   E  V+V   LP  +M    +E++ M 
Sbjct  379  EKVDFGWGNALYGGTAKAIPELASFYIPFTNKKGEDGVVVQFCLPAPAMERLFKELEGML  438

Query  178  K  176
            K
Sbjct  439  K  439



>ref|XP_004986643.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 72/124 (58%), Gaps = 3/124 (2%)
 Frame = -2

Query  538  TAKLLCERPITYAIELIREAKNKVSADYVKSVLDFLVINGRPRMSVMRNILVSDISRIGL  359
            TA  LC  P+ YAIEL+++AK +V  +Y++SV D +V+ GRP +S +R  +VSD+ +   
Sbjct  324  TAGALCANPLGYAIELVKKAKEEVDMEYIRSVADLVVLRGRPPVSFVRTYMVSDVRKAPA  383

Query  358  EKIDFGWGDaiyagsataaygaTFLER---PKSNSSTERSVLVPISLPHLSMLIFKREIK  188
             ++DFGWG  +Y G A       ++       +++  E  + VP+ LP  +M  F  E+ 
Sbjct  384  ARLDFGWGRPVYGGPAEVGGDLAWVVSYFVSVTDARGEEGIAVPVCLPRSAMERFAEEMG  443

Query  187  KMTK  176
            K+ +
Sbjct  444  KLLQ  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800