BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004K21

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234181.1|  PI-phospholipase C PLC4                            312   4e-99   Solanum lycopersicum
ref|XP_009790378.1|  PREDICTED: phosphoinositide phospholipase C 4      311   2e-98   Nicotiana sylvestris
ref|XP_006344048.1|  PREDICTED: phosphoinositide phospholipase C ...    310   4e-98   Solanum tuberosum [potatoes]
emb|CAA72681.1|  1-phosphatidylinositol-4,5-bisphosphate phosphod...    309   8e-98   Nicotiana rustica [wild tobacco]
emb|CDP09195.1|  unnamed protein product                                308   2e-97   Coffea canephora [robusta coffee]
emb|CAA65127.1|  phosphoinositide-specific phospholipase C              308   2e-97   Nicotiana rustica [wild tobacco]
ref|XP_009622729.1|  PREDICTED: phosphoinositide phospholipase C ...    307   4e-97   Nicotiana tomentosiformis
ref|XP_009347256.1|  PREDICTED: phosphoinositide phospholipase C ...    306   9e-97   Pyrus x bretschneideri [bai li]
ref|XP_008355042.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    306   1e-96   
gb|KJB35244.1|  hypothetical protein B456_006G106400                    299   2e-96   Gossypium raimondii
gb|KJB35243.1|  hypothetical protein B456_006G106400                    300   2e-95   Gossypium raimondii
ref|XP_007206576.1|  hypothetical protein PRUPE_ppa020283mg             302   4e-95   Prunus persica
ref|XP_011460953.1|  PREDICTED: phosphoinositide phospholipase C ...    301   6e-95   Fragaria vesca subsp. vesca
ref|XP_004294231.1|  PREDICTED: phosphoinositide phospholipase C ...    301   6e-95   Fragaria vesca subsp. vesca
gb|KJB35242.1|  hypothetical protein B456_006G106400                    300   4e-94   Gossypium raimondii
gb|KCW85435.1|  hypothetical protein EUGRSUZ_B02250                     296   5e-94   Eucalyptus grandis [rose gum]
ref|XP_007016097.1|  Phosphatidylinositol-speciwc phospholipase C4      298   1e-93   
ref|XP_008220865.1|  PREDICTED: phosphoinositide phospholipase C ...    298   1e-93   Prunus mume [ume]
gb|KJB55732.1|  hypothetical protein B456_009G091900                    291   1e-93   Gossypium raimondii
ref|XP_006425071.1|  hypothetical protein CICLE_v10028080mg             298   2e-93   Citrus clementina [clementine]
gb|KHG04158.1|  Phosphoinositide phospholipase C 4 -like protein        297   4e-93   Gossypium arboreum [tree cotton]
gb|ABU53666.1|  phospholipase C                                         296   6e-93   Torenia fournieri [bluewings]
ref|XP_010043428.1|  PREDICTED: phosphoinositide phospholipase C ...    296   6e-93   Eucalyptus grandis [rose gum]
gb|KDO66894.1|  hypothetical protein CISIN_1g007887mg                   295   2e-92   Citrus sinensis [apfelsine]
ref|XP_006488531.1|  PREDICTED: phosphoinositide phospholipase C ...    295   2e-92   Citrus sinensis [apfelsine]
gb|AFN53674.1|  hypothetical protein                                    293   2e-92   Linum usitatissimum
ref|XP_003615684.1|  Phosphoinositide phospholipase C                   288   2e-91   
ref|XP_009399994.1|  PREDICTED: phosphoinositide phospholipase C ...    293   2e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010253735.1|  PREDICTED: phosphoinositide phospholipase C ...    292   2e-91   Nelumbo nucifera [Indian lotus]
ref|XP_008220858.1|  PREDICTED: phosphoinositide phospholipase C ...    292   2e-91   Prunus mume [ume]
ref|XP_010253733.1|  PREDICTED: phosphoinositide phospholipase C ...    292   2e-91   Nelumbo nucifera [Indian lotus]
ref|XP_002525651.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    291   4e-91   Ricinus communis
gb|KJB55734.1|  hypothetical protein B456_009G091900                    291   4e-91   Gossypium raimondii
ref|XP_009402378.1|  PREDICTED: phosphoinositide phospholipase C ...    291   7e-91   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU45716.1|  hypothetical protein MIMGU_mgv1a003401mg                291   8e-91   Erythranthe guttata [common monkey flower]
ref|XP_010937845.1|  PREDICTED: phosphoinositide phospholipase C ...    290   2e-90   Elaeis guineensis
emb|CBI15949.3|  unnamed protein product                                289   2e-90   Vitis vinifera
ref|XP_010937844.1|  PREDICTED: phosphoinositide phospholipase C ...    290   2e-90   Elaeis guineensis
emb|CBI30388.3|  unnamed protein product                                289   3e-90   Vitis vinifera
gb|KHG10595.1|  Phosphoinositide phospholipase C 4                      289   4e-90   Gossypium arboreum [tree cotton]
ref|XP_010264634.1|  PREDICTED: phosphoinositide phospholipase C ...    289   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010264635.1|  PREDICTED: phosphoinositide phospholipase C ...    289   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_002299806.2|  hypothetical protein POPTR_0001s25910g             289   6e-90   
gb|AFO54605.1|  phospholipase C                                         288   6e-90   Populus tomentosa [Chinese white poplar]
ref|XP_002278527.1|  PREDICTED: phosphoinositide phospholipase C ...    288   6e-90   Vitis vinifera
ref|XP_010654153.1|  PREDICTED: phosphoinositide phospholipase C ...    290   8e-90   Vitis vinifera
ref|XP_011043776.1|  PREDICTED: phosphoinositide phospholipase C ...    288   1e-89   Populus euphratica
gb|EYU20012.1|  hypothetical protein MIMGU_mgv1a003407mg                288   1e-89   Erythranthe guttata [common monkey flower]
gb|EPS61000.1|  hypothetical protein M569_13801                         287   2e-89   Genlisea aurea
gb|AES98642.2|  phosphatidylinositol-specific phospholipase C           287   3e-89   Medicago truncatula
ref|XP_008789095.1|  PREDICTED: phosphoinositide phospholipase C ...    283   6e-89   
ref|XP_007208015.1|  hypothetical protein PRUPE_ppa003249mg             286   8e-89   Prunus persica
gb|KDP46490.1|  hypothetical protein JCGZ_08462                         285   1e-88   Jatropha curcas
gb|KDP44771.1|  hypothetical protein JCGZ_01271                         285   1e-88   Jatropha curcas
ref|XP_002533650.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    285   1e-88   Ricinus communis
ref|XP_004490600.1|  PREDICTED: phosphoinositide phospholipase C ...    285   1e-88   Cicer arietinum [garbanzo]
ref|XP_002463446.1|  hypothetical protein SORBIDRAFT_02g044010          285   2e-88   Sorghum bicolor [broomcorn]
ref|XP_008666992.1|  PREDICTED: phosphoinositide-specific phospho...    285   2e-88   
ref|XP_006658176.1|  PREDICTED: phosphoinositide phospholipase C ...    278   2e-88   
ref|XP_010106259.1|  Phosphoinositide phospholipase C 2                 285   2e-88   Morus notabilis
ref|XP_004958809.1|  PREDICTED: phosphoinositide phospholipase C ...    285   2e-88   Setaria italica
ref|XP_010922549.1|  PREDICTED: phosphoinositide phospholipase C ...    284   3e-88   Elaeis guineensis
ref|XP_009380683.1|  PREDICTED: phosphoinositide phospholipase C ...    284   4e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAW81960.1|  phosphatidylinositol-specific phospholipase C 2         282   7e-88   Lilium davidii
ref|XP_008789094.1|  PREDICTED: phosphoinositide phospholipase C ...    283   8e-88   Phoenix dactylifera
ref|XP_010920867.1|  PREDICTED: phosphoinositide phospholipase C ...    283   9e-88   Elaeis guineensis
ref|XP_008789093.1|  PREDICTED: phosphoinositide phospholipase C ...    283   9e-88   Phoenix dactylifera
ref|XP_010920866.1|  PREDICTED: phosphoinositide phospholipase C ...    283   1e-87   Elaeis guineensis
ref|XP_011035945.1|  PREDICTED: phosphoinositide phospholipase C ...    282   2e-87   Populus euphratica
ref|XP_008793309.1|  PREDICTED: phosphoinositide phospholipase C ...    282   2e-87   
ref|XP_009772725.1|  PREDICTED: phosphoinositide phospholipase C ...    281   4e-87   Nicotiana sylvestris
ref|XP_009772724.1|  PREDICTED: phosphoinositide phospholipase C ...    281   4e-87   Nicotiana sylvestris
ref|XP_002316212.1|  phosphoinositide-specific phospholipase C fa...    281   5e-87   Populus trichocarpa [western balsam poplar]
ref|XP_010937846.1|  PREDICTED: phosphoinositide phospholipase C ...    281   5e-87   
ref|XP_003616636.1|  Phosphoinositide phospholipase C                   281   6e-87   Medicago truncatula
ref|XP_006843548.1|  hypothetical protein AMTR_s00007p00065880          281   7e-87   Amborella trichopoda
ref|XP_004490994.1|  PREDICTED: phosphoinositide phospholipase C ...    281   7e-87   Cicer arietinum [garbanzo]
dbj|BAO02533.1|  predicted phospholipase C ortholog                     280   1e-86   Nicotiana alata [flowering tobacco]
gb|EYU22355.1|  hypothetical protein MIMGU_mgv1a003318mg                280   1e-86   Erythranthe guttata [common monkey flower]
emb|CAM92313.1|  phospholipase C                                        280   1e-86   Vigna radiata [mung bean]
emb|CAK32509.1|  phospholipase C                                        280   1e-86   Vigna radiata [mung bean]
gb|AAQ95730.1|  phospholipase C                                         280   1e-86   Vigna radiata [mung bean]
emb|CAK32510.1|  phospholipase C                                        280   1e-86   Vigna radiata [mung bean]
ref|XP_011076692.1|  PREDICTED: phosphoinositide phospholipase C ...    280   1e-86   Sesamum indicum [beniseed]
ref|XP_009120385.1|  PREDICTED: phosphoinositide phospholipase C 4      280   1e-86   Brassica rapa
ref|XP_002269949.1|  PREDICTED: phosphoinositide phospholipase C 2      279   3e-86   Vitis vinifera
gb|ABC50164.1|  phospholipase C                                         279   3e-86   Petunia integrifolia subsp. inflata
ref|XP_007008968.1|  Phospholipase C 2                                  278   4e-86   
emb|CDY71544.1|  BnaUnng04440D                                          276   4e-86   Brassica napus [oilseed rape]
ref|NP_001275400.1|  phosphoinositide phospholipase C 2-like            278   4e-86   Solanum tuberosum [potatoes]
gb|KDP44772.1|  hypothetical protein JCGZ_01272                         271   6e-86   Jatropha curcas
ref|XP_009387528.1|  PREDICTED: phosphoinositide phospholipase C ...    278   6e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387519.1|  PREDICTED: phosphoinositide phospholipase C ...    278   6e-86   
emb|CDY52122.1|  BnaA10g29510D                                          278   6e-86   Brassica napus [oilseed rape]
ref|XP_008805482.1|  PREDICTED: phosphoinositide phospholipase C ...    278   7e-86   Phoenix dactylifera
ref|XP_009387536.1|  PREDICTED: phosphoinositide phospholipase C ...    278   7e-86   
gb|ABJ99758.1|  phospholipase C                                         278   8e-86   Nicotiana tabacum [American tobacco]
ref|XP_009605158.1|  PREDICTED: phosphoinositide phospholipase C ...    278   9e-86   Nicotiana tomentosiformis
ref|XP_009605157.1|  PREDICTED: phosphoinositide phospholipase C ...    278   1e-85   Nicotiana tomentosiformis
ref|XP_010535594.1|  PREDICTED: phosphoinositide phospholipase C ...    275   1e-85   Tarenaya hassleriana [spider flower]
emb|CAM92314.1|  phospholipase C                                        278   1e-85   Vigna radiata [mung bean]
gb|KHG14938.1|  Phosphoinositide phospholipase C 2 -like protein        277   1e-85   Gossypium arboreum [tree cotton]
ref|XP_008233758.1|  PREDICTED: phosphoinositide phospholipase C ...    278   1e-85   Prunus mume [ume]
ref|XP_008233757.1|  PREDICTED: phosphoinositide phospholipase C ...    278   1e-85   Prunus mume [ume]
ref|XP_010920865.1|  PREDICTED: phosphoinositide phospholipase C ...    277   1e-85   Elaeis guineensis
emb|CDY32691.1|  BnaA02g07530D                                          277   1e-85   Brassica napus [oilseed rape]
gb|EMT14453.1|  Phosphoinositide phospholipase C 2                      274   2e-85   
gb|KDO68973.1|  hypothetical protein CISIN_1g007399mg                   271   2e-85   Citrus sinensis [apfelsine]
ref|XP_007220553.1|  hypothetical protein PRUPE_ppa003223mg             277   2e-85   Prunus persica
ref|XP_010534599.1|  PREDICTED: phosphoinositide phospholipase C 2      276   2e-85   Tarenaya hassleriana [spider flower]
ref|XP_004149233.1|  PREDICTED: phosphoinositide phospholipase C ...    276   3e-85   
ref|NP_001234190.1|  PI-phospholipase C PLC3                            276   3e-85   
ref|XP_009344939.1|  PREDICTED: phosphoinositide phospholipase C ...    276   4e-85   Pyrus x bretschneideri [bai li]
emb|CDP14020.1|  unnamed protein product                                276   6e-85   Coffea canephora [robusta coffee]
dbj|BAD95335.1|  phosphoinositide specific phospholipase C              265   6e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535516.1|  PREDICTED: phosphoinositide phospholipase C ...    275   6e-85   Tarenaya hassleriana [spider flower]
ref|XP_009126743.1|  PREDICTED: phosphoinositide phospholipase C 4      276   7e-85   Brassica rapa
ref|XP_009133410.1|  PREDICTED: phosphoinositide phospholipase C ...    276   7e-85   Brassica rapa
gb|ABM90640.1|  phospholipase C                                         276   9e-85   Torenia fournieri [bluewings]
gb|ADR00313.1|  phosphoinositide-specific phospholipase C1              273   9e-85   Triticum aestivum [Canadian hard winter wheat]
gb|AAN75042.1|  phosphoinositide-specific phospholipase C 8             274   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141766.1|  hypothetical protein PHAVU_008G224000g             275   1e-84   Phaseolus vulgaris [French bean]
gb|EYU22354.1|  hypothetical protein MIMGU_mgv1a001900mg                278   1e-84   Erythranthe guttata [common monkey flower]
ref|XP_010233537.1|  PREDICTED: phosphoinositide phospholipase C ...    275   1e-84   Brachypodium distachyon [annual false brome]
ref|XP_006295484.1|  hypothetical protein CARUB_v10024587mg             275   1e-84   Capsella rubella
ref|NP_001235310.1|  phosphoinositide-specific phospholipase C P13      275   1e-84   Glycine max [soybeans]
ref|XP_003562396.1|  PREDICTED: phosphoinositide phospholipase C ...    275   2e-84   Brachypodium distachyon [annual false brome]
ref|XP_009766854.1|  PREDICTED: phosphoinositide phospholipase C ...    271   2e-84   Nicotiana sylvestris
ref|XP_010505719.1|  PREDICTED: phosphoinositide phospholipase C ...    275   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010517422.1|  PREDICTED: phosphoinositide phospholipase C 6      275   2e-84   Camelina sativa [gold-of-pleasure]
gb|AAW81961.1|  phosphatidylinositol-specific phospholipase C 1         273   2e-84   Lilium davidii
ref|XP_008343623.1|  PREDICTED: phosphoinositide phospholipase C ...    275   2e-84   
ref|XP_006411261.1|  hypothetical protein EUTSA_v10016400mg             275   2e-84   
ref|XP_008463239.1|  PREDICTED: phosphoinositide phospholipase C ...    275   2e-84   Cucumis melo [Oriental melon]
emb|CBI15950.3|  unnamed protein product                                273   2e-84   Vitis vinifera
gb|AEK84223.1|  phosphoinositide-specific phospholipase-like protein    275   2e-84   Cucurbita maxima [Boston marrow]
emb|CDX80341.1|  BnaC09g34010D                                          274   2e-84   
ref|XP_009143251.1|  PREDICTED: phosphoinositide phospholipase C 6      275   2e-84   Brassica rapa
ref|XP_011077556.1|  PREDICTED: phosphoinositide phospholipase C ...    274   3e-84   Sesamum indicum [beniseed]
ref|XP_006435740.1|  hypothetical protein CICLE_v10031029mg             274   3e-84   Citrus clementina [clementine]
dbj|BAK01542.1|  predicted protein                                      274   4e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_850327.2|  phosphoinositide phospholipase C 6                    274   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879846.1|  phosphoinositide-specific phospholipase C fa...    274   5e-84   Arabidopsis lyrata subsp. lyrata
ref|XP_006338846.1|  PREDICTED: phosphoinositide phospholipase C ...    273   5e-84   
ref|XP_010508911.1|  PREDICTED: phosphoinositide phospholipase C ...    274   5e-84   Camelina sativa [gold-of-pleasure]
ref|NP_001275075.1|  phosphoinositide phospholipase C 2-like            273   5e-84   Solanum tuberosum [potatoes]
ref|NP_001275298.1|  phosphoinositide phospholipase C 2-like            273   6e-84   Solanum tuberosum [potatoes]
ref|XP_009612249.1|  PREDICTED: phosphoinositide phospholipase C ...    273   8e-84   Nicotiana tomentosiformis
ref|XP_002278839.2|  PREDICTED: phosphoinositide phospholipase C ...    273   8e-84   Vitis vinifera
gb|KDO68971.1|  hypothetical protein CISIN_1g007399mg                   273   1e-83   Citrus sinensis [apfelsine]
ref|XP_007016094.1|  Phosphatidylinositol-speciwc phospholipase C...    273   1e-83   
ref|XP_010520201.1|  PREDICTED: phosphoinositide phospholipase C 4      272   1e-83   Tarenaya hassleriana [spider flower]
emb|CDY27998.1|  BnaC05g44000D                                          271   1e-83   Brassica napus [oilseed rape]
ref|NP_001236167.1|  phosphatidylinositol-specific phospholipase C      272   2e-83   
ref|XP_003600904.1|  Phosphoinositide phospholipase C                   272   2e-83   Medicago truncatula
gb|KFK36899.1|  hypothetical protein AALP_AA4G187200                    272   3e-83   Arabis alpina [alpine rockcress]
ref|XP_009147001.1|  PREDICTED: phosphoinositide phospholipase C 2      271   3e-83   Brassica rapa
ref|NP_001235324.1|  phosphoinositide-specific phospholipase C P25      270   3e-83   Glycine max [soybeans]
emb|CAA75546.2|  phospholipase C                                        271   3e-83   Pisum sativum [garden pea]
emb|CDY35983.1|  BnaA05g29670D                                          271   3e-83   Brassica napus [oilseed rape]
gb|KHG13942.1|  Phosphoinositide phospholipase C 2 -like protein        271   4e-83   Gossypium arboreum [tree cotton]
emb|CDY07623.1|  BnaA03g18880D                                          271   4e-83   Brassica napus [oilseed rape]
emb|CDY07057.1|  BnaA04g22580D                                          271   4e-83   
ref|XP_002533649.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    271   4e-83   Ricinus communis
ref|XP_010534598.1|  PREDICTED: phosphoinositide phospholipase C 6      271   4e-83   Tarenaya hassleriana [spider flower]
gb|AIG51130.1|  phospholipase C                                         270   5e-83   Gossypium hirsutum [American cotton]
gb|AAF33824.1|AF223573_1  phospholipase C2                              271   5e-83   Nicotiana tabacum [American tobacco]
gb|EEC82741.1|  hypothetical protein OsI_27447                          271   5e-83   Oryza sativa Indica Group [Indian rice]
ref|XP_010689668.1|  PREDICTED: phosphoinositide phospholipase C 6      270   5e-83   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN36373.1|  Phosphoinositide phospholipase C 2                      270   6e-83   Glycine soja [wild soybean]
gb|KHN20845.1|  Phosphoinositide phospholipase C 2                      270   6e-83   Glycine soja [wild soybean]
emb|CDY60344.1|  BnaC03g72360D                                          271   6e-83   Brassica napus [oilseed rape]
ref|XP_009783759.1|  PREDICTED: phosphoinositide phospholipase C ...    276   6e-83   Nicotiana sylvestris
gb|KFK38259.1|  phosphoinositide phospholipase c 2                      270   7e-83   Arabis alpina [alpine rockcress]
emb|CDY61706.1|  BnaC04g56690D                                          271   7e-83   Brassica napus [oilseed rape]
ref|XP_002311223.1|  phosphoinositide-specific phospholipase C fa...    270   7e-83   Populus trichocarpa [western balsam poplar]
ref|XP_007163546.1|  hypothetical protein PHAVU_001G243300g             270   8e-83   Phaseolus vulgaris [French bean]
gb|EYU26667.1|  hypothetical protein MIMGU_mgv1a003464mg                270   8e-83   Erythranthe guttata [common monkey flower]
ref|XP_006356459.1|  PREDICTED: phosphoinositide phospholipase C ...    276   9e-83   Solanum tuberosum [potatoes]
gb|AAK01711.1|AF332874_1  phosphoinositide-specific phospholipase C     270   9e-83   Oryza sativa Indica Group [Indian rice]
emb|CDP06481.1|  unnamed protein product                                270   9e-83   Coffea canephora [robusta coffee]
ref|XP_003552353.1|  PREDICTED: phosphoinositide phospholipase C ...    270   9e-83   Glycine max [soybeans]
ref|NP_001067028.1|  Os12g0562400                                       257   1e-82   
ref|XP_006401052.1|  hypothetical protein EUTSA_v10013042mg             270   1e-82   Eutrema salsugineum [saltwater cress]
gb|AAM90315.1|  phospholipase C                                         270   1e-82   Pisum sativum [garden pea]
emb|CDP14022.1|  unnamed protein product                                270   1e-82   Coffea canephora [robusta coffee]
ref|XP_004500491.1|  PREDICTED: phosphoinositide phospholipase C ...    270   1e-82   Cicer arietinum [garbanzo]
ref|XP_004500490.1|  PREDICTED: phosphoinositide phospholipase C ...    270   1e-82   Cicer arietinum [garbanzo]
ref|NP_001060735.1|  Os07g0694000                                       270   1e-82   
emb|CDX74806.1|  BnaA05g05520D                                          270   1e-82   
ref|XP_010318244.1|  PREDICTED: phosphoinositide phospholipase C ...    276   1e-82   
emb|CAC81703.2|  phospholipase C                                        260   2e-82   Oryza sativa [red rice]
ref|XP_002316213.2|  phosphoinositide-specific phospholipase C fa...    270   2e-82   
ref|XP_010106260.1|  Phosphoinositide phospholipase C 6                 270   2e-82   Morus notabilis
ref|XP_010658272.1|  PREDICTED: phosphoinositide phospholipase C 6      269   2e-82   Vitis vinifera
ref|XP_011046045.1|  PREDICTED: phosphoinositide phospholipase C ...    269   2e-82   Populus euphratica
gb|KJB67579.1|  hypothetical protein B456_010G197900                    269   2e-82   Gossypium raimondii
ref|NP_001234203.1|  PI-phospholipase C PLC1                            269   2e-82   Solanum lycopersicum
ref|XP_009123935.1|  PREDICTED: phosphoinositide phospholipase C 2      269   2e-82   Brassica rapa
ref|XP_010067519.1|  PREDICTED: phosphoinositide phospholipase C ...    269   2e-82   Eucalyptus grandis [rose gum]
ref|XP_010685546.1|  PREDICTED: phosphoinositide phospholipase C ...    269   2e-82   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY20520.1|  BnaC04g05240D                                          269   2e-82   Brassica napus [oilseed rape]
gb|KHN48566.1|  Phosphoinositide phospholipase C 2                      269   2e-82   Glycine soja [wild soybean]
ref|XP_002311222.1|  phosphoinositide-specific phospholipase C fa...    269   3e-82   
ref|XP_009586599.1|  PREDICTED: phosphoinositide phospholipase C ...    269   3e-82   Nicotiana tomentosiformis
ref|XP_011045853.1|  PREDICTED: phosphoinositide phospholipase C ...    269   3e-82   Populus euphratica
dbj|BAE71237.1|  putative phosphoinositide specific phospholipase C     269   3e-82   Trifolium pratense [peavine clover]
ref|XP_010464460.1|  PREDICTED: phosphoinositide phospholipase C ...    268   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010505720.1|  PREDICTED: phosphoinositide phospholipase C ...    256   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010461812.1|  PREDICTED: phosphoinositide phospholipase C 2      268   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_011469918.1|  PREDICTED: phosphoinositide phospholipase C ...    268   4e-82   Fragaria vesca subsp. vesca
ref|XP_006407765.1|  hypothetical protein EUTSA_v10020359mg             268   4e-82   Eutrema salsugineum [saltwater cress]
gb|KFK27404.1|  hypothetical protein AALP_AA8G378600                    268   4e-82   Arabis alpina [alpine rockcress]
ref|XP_006297293.1|  hypothetical protein CARUB_v10013310mg             268   5e-82   Capsella rubella
ref|XP_011469919.1|  PREDICTED: phosphoinositide phospholipase C ...    268   5e-82   Fragaria vesca subsp. vesca
ref|XP_010486390.1|  PREDICTED: phosphoinositide phospholipase C ...    268   5e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010685545.1|  PREDICTED: phosphoinositide phospholipase C ...    268   5e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010486391.1|  PREDICTED: phosphoinositide phospholipase C ...    268   6e-82   Camelina sativa [gold-of-pleasure]
ref|XP_007016095.1|  Phosphatidylinositol-speciwc phospholipase C...    268   6e-82   
ref|NP_187464.1|  phosphoinositide phospholipase C 2                    267   7e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010689655.1|  PREDICTED: phosphoinositide phospholipase C 2      267   9e-82   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY22153.1|  BnaC01g39480D                                          267   1e-81   Brassica napus [oilseed rape]
gb|KHG10596.1|  Phosphoinositide phospholipase C 4                      268   1e-81   Gossypium arboreum [tree cotton]
ref|XP_003600780.1|  Phosphoinositide phospholipase C                   266   1e-81   Medicago truncatula
ref|XP_010031218.1|  PREDICTED: phosphoinositide phospholipase C ...    264   1e-81   Eucalyptus grandis [rose gum]
gb|KJB55726.1|  hypothetical protein B456_009G091700                    267   2e-81   Gossypium raimondii
ref|XP_007008969.1|  Phosphoinositide-specific phospholipase C fa...    267   2e-81   
gb|ABR16299.1|  unknown                                                 267   2e-81   Picea sitchensis
ref|XP_002526337.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    266   2e-81   
gb|ABR16641.1|  unknown                                                 267   2e-81   Picea sitchensis
gb|AAD26119.1|AF108123_1  phosphoinositide-specific phospholipase C     266   2e-81   Brassica napus [oilseed rape]
ref|XP_011084908.1|  PREDICTED: phosphoinositide phospholipase C 6      266   2e-81   Sesamum indicum [beniseed]
ref|XP_011042811.1|  PREDICTED: phosphoinositide phospholipase C ...    266   2e-81   Populus euphratica
ref|XP_008369254.1|  PREDICTED: phosphoinositide phospholipase C ...    266   2e-81   Malus domestica [apple tree]
ref|XP_008369255.1|  PREDICTED: phosphoinositide phospholipase C ...    266   3e-81   Malus domestica [apple tree]
ref|XP_002884682.1|  predicted protein                                  265   3e-81   
gb|KFK27411.1|  hypothetical protein AALP_AA8G379300                    266   5e-81   Arabis alpina [alpine rockcress]
gb|KFK27410.1|  hypothetical protein AALP_AA8G379300                    266   5e-81   Arabis alpina [alpine rockcress]
ref|NP_001234197.1|  PI-phospholipase C PLC2                            265   5e-81   Solanum lycopersicum
ref|XP_009794867.1|  PREDICTED: phosphoinositide phospholipase C ...    265   7e-81   Nicotiana sylvestris
ref|XP_006664643.1|  PREDICTED: phosphoinositide phospholipase C ...    264   7e-81   
ref|XP_009586600.1|  PREDICTED: phosphoinositide phospholipase C ...    264   7e-81   Nicotiana tomentosiformis
ref|XP_009586601.1|  PREDICTED: phosphoinositide phospholipase C ...    264   7e-81   Nicotiana tomentosiformis
gb|AJA33385.1|  phosphatidylinositol phospholipase C 5                  265   8e-81   Solanum lycopersicum
ref|XP_010322097.1|  PREDICTED: PI-phospholipase C PLC2 isoform X1      264   8e-81   
gb|AAF33823.1|AF223351_1  phospholipase C1                              265   8e-81   Nicotiana tabacum [American tobacco]
ref|XP_009783480.1|  PREDICTED: phosphoinositide phospholipase C ...    264   8e-81   Nicotiana sylvestris
ref|XP_006338847.1|  PREDICTED: phosphoinositide phospholipase C ...    265   9e-81   
ref|XP_009783481.1|  PREDICTED: phosphoinositide phospholipase C ...    264   9e-81   Nicotiana sylvestris
ref|XP_009783482.1|  PREDICTED: phosphoinositide phospholipase C ...    264   1e-80   Nicotiana sylvestris
ref|XP_009369167.1|  PREDICTED: phosphoinositide phospholipase C ...    265   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_009369166.1|  PREDICTED: phosphoinositide phospholipase C ...    265   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_004138421.1|  PREDICTED: phosphoinositide phospholipase C ...    264   1e-80   Cucumis sativus [cucumbers]
ref|XP_010031216.1|  PREDICTED: phosphoinositide phospholipase C ...    264   2e-80   Eucalyptus grandis [rose gum]
gb|KJB67580.1|  hypothetical protein B456_010G198000                    264   2e-80   Gossypium raimondii
gb|ACF93733.1|  phospholipase C                                         264   2e-80   Spinacia oleracea
ref|XP_010031217.1|  PREDICTED: phosphoinositide phospholipase C ...    264   2e-80   Eucalyptus grandis [rose gum]
gb|KJB67581.1|  hypothetical protein B456_010G198000                    264   3e-80   Gossypium raimondii
ref|NP_001234176.1|  PI-phospholipase C PLC5                            263   3e-80   
gb|AIU41540.1|  phosphatidylinositol phospholipase C 7                  263   3e-80   Solanum lycopersicum
gb|KHG08567.1|  Phosphoinositide phospholipase C 6 -like protein        263   4e-80   Gossypium arboreum [tree cotton]
ref|XP_009385550.1|  PREDICTED: phosphoinositide phospholipase C ...    263   4e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF95389.1|  phosphoinositide-specific phospholipase C, putati...    259   8e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006403400.1|  hypothetical protein EUTSA_v10010330mg             259   8e-80   
ref|XP_006290813.1|  hypothetical protein CARUB_v10016918mg             262   8e-80   Capsella rubella
gb|KDO68972.1|  hypothetical protein CISIN_1g007399mg                   263   8e-80   Citrus sinensis [apfelsine]
gb|AAM61037.1|  unknown                                                 249   9e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001032097.1|  phosphoinositide phospholipase C 4                 259   9e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279487.1|  hypothetical protein CARUB_v10026125mg             262   1e-79   Capsella rubella
gb|KDP46487.1|  hypothetical protein JCGZ_08459                         261   1e-79   Jatropha curcas
gb|EAY83519.1|  hypothetical protein OsI_38731                          261   2e-79   Oryza sativa Indica Group [Indian rice]
gb|ABA98951.2|  phospholipase C, putative, expressed                    261   2e-79   Oryza sativa Japonica Group [Japonica rice]
emb|CBI22792.3|  unnamed protein product                                260   2e-79   Vitis vinifera
ref|XP_010653296.1|  PREDICTED: phosphoinositide phospholipase C ...    260   2e-79   
ref|XP_010031215.1|  PREDICTED: phosphoinositide phospholipase C ...    258   3e-79   Eucalyptus grandis [rose gum]
gb|KCW50478.1|  hypothetical protein EUGRSUZ_J00208                     261   3e-79   Eucalyptus grandis [rose gum]
ref|XP_010253909.1|  PREDICTED: phosphoinositide phospholipase C ...    260   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_007218974.1|  hypothetical protein PRUPE_ppa003890mg             259   3e-79   
gb|AAW22878.1|  putative phospholipase C                                260   3e-79   Solanum lycopersicum
gb|KFK34832.1|  hypothetical protein AALP_AA5G198900                    260   4e-79   
ref|XP_010253908.1|  PREDICTED: phosphoinositide phospholipase C ...    260   5e-79   
ref|XP_010483472.1|  PREDICTED: phosphoinositide phospholipase C ...    260   6e-79   
gb|AAL23439.1|  phosphoinositide-specific phospholipase C4              260   6e-79   
ref|XP_010483471.1|  PREDICTED: phosphoinositide phospholipase C ...    260   7e-79   
ref|XP_002876343.1|  hypothetical protein ARALYDRAFT_486035             259   7e-79   
ref|XP_003579061.1|  PREDICTED: phosphoinositide phospholipase C ...    259   8e-79   
ref|XP_006435739.1|  hypothetical protein CICLE_v10031019mg             260   8e-79   
ref|NP_200678.2|  phosphoinositide phospholipase C 4                    260   9e-79   
ref|XP_010443621.1|  PREDICTED: phosphoinositide phospholipase C ...    259   9e-79   
ref|XP_008441466.1|  PREDICTED: phosphoinositide phospholipase C 6      259   1e-78   
ref|XP_010443620.1|  PREDICTED: phosphoinositide phospholipase C ...    259   1e-78   
ref|NP_001049792.2|  Os03g0289300                                       259   1e-78   
ref|XP_010454132.1|  PREDICTED: phosphoinositide phospholipase C ...    259   1e-78   
ref|XP_010454117.1|  PREDICTED: phosphoinositide phospholipase C ...    259   2e-78   
dbj|BAJ91552.1|  predicted protein                                      258   3e-78   
ref|XP_010031214.1|  PREDICTED: phosphoinositide phospholipase C ...    258   4e-78   
gb|EEC75018.1|  hypothetical protein OsI_11098                          259   4e-78   
gb|EEE58849.1|  hypothetical protein OsJ_10440                          259   5e-78   
ref|XP_010650898.1|  PREDICTED: phosphoinositide phospholipase C 2      258   6e-78   
ref|NP_001235296.1|  phosphoinositide-specific phospholipase C P12      256   6e-78   
ref|NP_191153.1|  phosphoinositide phospholipase C 7                    257   6e-78   
gb|EYU20013.1|  hypothetical protein MIMGU_mgv1a0236392mg               252   8e-78   
ref|XP_009385549.1|  PREDICTED: phosphoinositide phospholipase C ...    256   8e-78   
ref|XP_004170339.1|  PREDICTED: phosphoinositide phospholipase C ...    254   8e-78   
ref|XP_008457370.1|  PREDICTED: phosphoinositide phospholipase C ...    256   9e-78   
gb|AAW22879.1|  putative phospholipase C                                256   1e-77   
ref|XP_002442641.1|  hypothetical protein SORBIDRAFT_08g000360          256   1e-77   
gb|EPS72762.1|  hypothetical protein M569_01992                         256   1e-77   
ref|XP_008457371.1|  PREDICTED: phosphoinositide phospholipase C ...    256   1e-77   
ref|XP_010427395.1|  PREDICTED: phosphoinositide phospholipase C 7      256   2e-77   
ref|XP_009380684.1|  PREDICTED: phosphoinositide phospholipase C ...    254   2e-77   
gb|KHN20846.1|  Phosphoinositide phospholipase C 6                      256   2e-77   
ref|XP_009344925.1|  PREDICTED: phosphoinositide phospholipase C ...    256   2e-77   
ref|XP_006425074.1|  hypothetical protein CICLE_v10028054mg             256   2e-77   
ref|XP_006575538.1|  PREDICTED: phosphoinositide phospholipase C ...    256   3e-77   
gb|KCW50476.1|  hypothetical protein EUGRSUZ_J00207                     256   3e-77   
ref|XP_010922548.1|  PREDICTED: phosphoinositide phospholipase C ...    255   3e-77   
emb|CDX72188.1|  BnaC08g26860D                                          255   4e-77   
ref|XP_002866286.1|  phosphoinositide-specific phospholipase C fa...    255   4e-77   
gb|KHN48565.1|  Phosphoinositide phospholipase C 6                      255   5e-77   
gb|KDO66896.1|  hypothetical protein CISIN_1g007473mg                   255   5e-77   
ref|XP_006488532.1|  PREDICTED: phosphoinositide phospholipase C ...    255   6e-77   
gb|KCW52484.1|  hypothetical protein EUGRSUZ_J01884                     251   6e-77   
emb|CDY01144.1|  BnaA04g06750D                                          251   6e-77   
gb|KGN65808.1|  hypothetical protein Csa_1G531180                       254   6e-77   
ref|XP_002525652.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    254   7e-77   
ref|XP_004978423.1|  PREDICTED: phosphoinositide phospholipase C ...    254   8e-77   
ref|XP_010516185.1|  PREDICTED: phosphoinositide phospholipase C ...    254   8e-77   
ref|XP_004153207.1|  PREDICTED: phosphoinositide phospholipase C ...    254   1e-76   
emb|CDY70294.1|  BnaCnng67650D                                          253   1e-76   
gb|KJB74323.1|  hypothetical protein B456_011G288000                    253   1e-76   
ref|XP_010516186.1|  PREDICTED: phosphoinositide phospholipase C ...    253   2e-76   
ref|XP_003558159.2|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    255   2e-76   
ref|XP_010031224.1|  PREDICTED: phosphoinositide phospholipase C 6      253   2e-76   
ref|XP_009116286.1|  PREDICTED: phosphoinositide phospholipase C 7      253   3e-76   
emb|CBI15948.3|  unnamed protein product                                254   3e-76   
emb|CDY27254.1|  BnaA09g35480D                                          253   3e-76   
emb|CAC13988.1|  phosphoinositide-specific phospholipase C              254   3e-76   
ref|XP_006649906.1|  PREDICTED: phosphoinositide phospholipase C ...    253   3e-76   
ref|XP_008369253.1|  PREDICTED: phosphoinositide phospholipase C ...    253   4e-76   
gb|KDP44118.1|  hypothetical protein JCGZ_05585                         251   4e-76   
ref|XP_009139611.1|  PREDICTED: phosphoinositide phospholipase C ...    252   5e-76   
ref|XP_007205014.1|  hypothetical protein PRUPE_ppa003685mg             251   5e-76   
ref|XP_008645133.1|  PREDICTED: phosphoinositide phospholipase C ...    252   7e-76   
gb|AFW69669.1|  phospholipase                                           252   8e-76   
gb|ACG25330.1|  phospholipase C                                         252   8e-76   
ref|XP_009347255.1|  PREDICTED: phosphoinositide phospholipase C ...    251   1e-75   
ref|XP_008220880.1|  PREDICTED: phosphoinositide phospholipase C ...    251   1e-75   
ref|XP_008220872.1|  PREDICTED: phosphoinositide phospholipase C ...    251   1e-75   
ref|XP_008666225.1|  PREDICTED: phosphoinositide phospholipase C ...    248   2e-75   
ref|XP_009369165.1|  PREDICTED: phosphoinositide phospholipase C ...    251   2e-75   
ref|XP_009142132.1|  PREDICTED: phosphoinositide phospholipase C ...    251   2e-75   
ref|XP_010032978.1|  PREDICTED: phosphoinositide phospholipase C ...    250   2e-75   
ref|XP_004977637.1|  PREDICTED: phosphoinositide phospholipase C ...    250   3e-75   
dbj|BAK03802.1|  predicted protein                                      250   3e-75   
gb|AAQ95731.1|  phospholipase C                                         246   4e-75   
gb|AES99591.2|  phosphoinositide-specific phospholipase C family ...    249   6e-75   
emb|CDY47356.1|  BnaCnng14930D                                          249   7e-75   
ref|XP_003569051.1|  PREDICTED: phosphoinositide phospholipase C ...    249   9e-75   
ref|XP_011076690.1|  PREDICTED: phosphoinositide phospholipase C ...    248   1e-74   
ref|NP_001105254.1|  phospholipase C                                    248   2e-74   
gb|ACF87551.1|  unknown                                                 247   2e-74   
gb|EMS61451.1|  Phosphoinositide phospholipase C 2                      249   3e-74   
ref|NP_001108119.1|  phosphoinositide-specific phospholipase C          247   3e-74   
gb|EMT28639.1|  Phosphoinositide phospholipase C 4                      249   4e-74   
gb|ADR00312.1|  phosphoinositide-specific phospholipase C2              247   4e-74   
ref|XP_002468043.1|  hypothetical protein SORBIDRAFT_01g038540          247   5e-74   
ref|XP_004490993.1|  PREDICTED: phosphoinositide phospholipase C ...    247   6e-74   
gb|EMT14267.1|  Phosphoinositide phospholipase C 2                      247   7e-74   
ref|XP_007163545.1|  hypothetical protein PHAVU_001G243200g             246   7e-74   
ref|XP_007163544.1|  hypothetical protein PHAVU_001G243200g             246   8e-74   
gb|AFY98823.1|  phospholipase C                                         246   8e-74   
tpg|DAA44847.1|  TPA: hypothetical protein ZEAMMB73_367335              246   9e-74   
ref|XP_008805492.1|  PREDICTED: phosphoinositide phospholipase C ...    243   1e-73   
ref|XP_011043778.1|  PREDICTED: phosphoinositide phospholipase C ...    246   1e-73   
ref|XP_011043777.1|  PREDICTED: phosphoinositide phospholipase C ...    246   1e-73   
ref|XP_011043779.1|  PREDICTED: phosphoinositide phospholipase C ...    245   2e-73   
ref|XP_004145255.1|  PREDICTED: phosphoinositide phospholipase C ...    246   2e-73   
gb|KHN36374.1|  Phosphoinositide phospholipase C 6                      245   2e-73   
ref|XP_003552358.1|  PREDICTED: phosphoinositide phospholipase C ...    245   2e-73   
ref|XP_006601952.1|  PREDICTED: phosphoinositide phospholipase C ...    245   2e-73   
gb|EPS71356.1|  hypothetical protein M569_03403                         246   2e-73   
dbj|BAJ96221.1|  predicted protein                                      245   2e-73   
gb|KHN34718.1|  Phosphoinositide phospholipase C 6                      244   2e-73   
ref|XP_003538468.2|  PREDICTED: phosphoinositide phospholipase C ...    245   4e-73   
ref|XP_002299804.2|  hypothetical protein POPTR_0001s25930g             245   6e-73   
ref|XP_010535381.1|  PREDICTED: phosphoinositide phospholipase C ...    242   7e-73   
ref|XP_011460955.1|  PREDICTED: phosphoinositide phospholipase C 2      243   8e-73   
ref|XP_003616632.1|  Phosphoinositide phospholipase C                   244   9e-73   
ref|XP_010032979.1|  PREDICTED: phosphoinositide phospholipase C 2      244   9e-73   
ref|XP_002866285.1|  predicted protein                                  243   1e-72   
ref|NP_001130835.1|  uncharacterized protein LOC100191939               235   2e-72   
ref|XP_010535374.1|  PREDICTED: phosphoinositide phospholipase C ...    242   3e-72   
tpg|DAA46574.1|  TPA: hypothetical protein ZEAMMB73_610036              230   3e-72   
gb|AAB41107.1|  phosphoinositide-specific phospholipase C               241   6e-72   
ref|XP_008384797.1|  PREDICTED: phosphoinositide phospholipase C ...    241   6e-72   
gb|KCW52486.1|  hypothetical protein EUGRSUZ_J01885                     241   6e-72   
ref|XP_010032977.1|  PREDICTED: phosphoinositide phospholipase C ...    241   7e-72   
ref|XP_004960369.1|  PREDICTED: phosphoinositide phospholipase C ...    241   7e-72   
ref|XP_006401053.1|  hypothetical protein EUTSA_v10013061mg             240   2e-71   
gb|EEC78444.1|  hypothetical protein OsI_18294                          240   2e-71   
ref|NP_001054531.1|  Os05g0127200                                       240   2e-71   
gb|KEH34793.1|  phosphoinositide-specific phospholipase C family ...    235   4e-71   
ref|XP_010454096.1|  PREDICTED: phosphoinositide phospholipase C ...    239   6e-71   
ref|XP_010685544.1|  PREDICTED: phosphoinositide phospholipase C ...    238   7e-71   
ref|XP_004490601.1|  PREDICTED: phosphoinositide phospholipase C ...    238   9e-71   
ref|XP_010454105.1|  PREDICTED: phosphoinositide phospholipase C ...    239   9e-71   
ref|XP_009385551.1|  PREDICTED: phosphoinositide phospholipase C ...    237   1e-70   
ref|XP_003544293.1|  PREDICTED: phosphoinositide phospholipase C ...    238   2e-70   
ref|NP_200677.2|  phosphoinositide phospholipase C 5                    238   2e-70   
ref|XP_006280227.1|  hypothetical protein CARUB_v10026144mg             238   2e-70   
ref|XP_006654000.1|  PREDICTED: phosphoinositide phospholipase C ...    237   3e-70   
ref|XP_009120384.1|  PREDICTED: phosphoinositide phospholipase C 5      237   3e-70   
ref|XP_010483470.1|  PREDICTED: phosphoinositide phospholipase C ...    237   3e-70   
ref|XP_010443613.1|  PREDICTED: phosphoinositide phospholipase C ...    237   4e-70   
ref|XP_007016093.1|  Phospholipase C 2, putative                        237   4e-70   
gb|AFW88328.1|  hypothetical protein ZEAMMB73_233763                    237   4e-70   
ref|XP_008658028.1|  PREDICTED: uncharacterized protein LOC100191...    237   5e-70   
emb|CDY52121.1|  BnaA10g29500D                                          236   6e-70   
gb|EMS52842.1|  Phosphoinositide phospholipase C 7                      235   7e-70   
ref|XP_006488535.1|  PREDICTED: phosphoinositide phospholipase C ...    236   7e-70   
gb|ACL53796.1|  unknown                                                 238   7e-70   
ref|XP_008658027.1|  PREDICTED: uncharacterized protein LOC100191...    238   7e-70   
ref|XP_003616633.1|  Phosphoinositide phospholipase C                   237   8e-70   
ref|XP_006488536.1|  PREDICTED: phosphoinositide phospholipase C ...    236   8e-70   
gb|EMT03430.1|  Phosphoinositide phospholipase C 6                      243   8e-70   
ref|XP_003600903.1|  Phosphoinositide phospholipase C                   236   9e-70   
ref|XP_006425075.1|  hypothetical protein CICLE_v10028087mg             236   1e-69   
ref|XP_007141767.1|  hypothetical protein PHAVU_008G224100g             236   1e-69   
ref|XP_003600894.1|  Phosphoinositide phospholipase C                   236   1e-69   
emb|CDX80342.1|  BnaC09g34000D                                          235   2e-69   
gb|EMS57551.1|  Phosphoinositide phospholipase C 6                      240   3e-69   
tpg|DAA44843.1|  TPA: rhodanese-like family protein                     238   3e-69   
gb|KHG10597.1|  Phosphoinositide phospholipase C 2 -like protein        233   5e-69   
gb|KJB55725.1|  hypothetical protein B456_009G091600                    233   1e-68   
ref|XP_010685543.1|  PREDICTED: phosphoinositide phospholipase C ...    233   1e-68   
ref|XP_004490990.1|  PREDICTED: phosphoinositide phospholipase C ...    233   1e-68   
ref|XP_004500489.1|  PREDICTED: phosphoinositide phospholipase C ...    231   7e-68   
ref|XP_003615686.1|  Phosphoinositide phospholipase C                   231   7e-68   
ref|XP_009120383.1|  PREDICTED: phosphoinositide phospholipase C 1      230   8e-68   
gb|KFK27408.1|  hypothetical protein AALP_AA8G379100                    230   1e-67   
ref|XP_002525653.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    230   1e-67   
gb|KDP46488.1|  hypothetical protein JCGZ_08460                         230   1e-67   
ref|XP_010454072.1|  PREDICTED: phosphoinositide phospholipase C ...    229   2e-67   
ref|XP_002439212.1|  hypothetical protein SORBIDRAFT_09g002320          230   2e-67   
ref|XP_006401054.1|  hypothetical protein EUTSA_v10013134mg             229   3e-67   
ref|NP_568881.1|  phosphoinositide phospholipase C 1                    229   3e-67   
gb|AAC05023.1|  phosphoinositol-specific phospholipase C delta          228   3e-67   
ref|XP_006843549.1|  hypothetical protein AMTR_s00007p00067740          229   4e-67   
ref|XP_010483467.1|  PREDICTED: phosphoinositide phospholipase C 1      228   5e-67   
ref|XP_010443612.1|  PREDICTED: phosphoinositide phospholipase C ...    228   6e-67   
ref|XP_010541457.1|  PREDICTED: phosphoinositide phospholipase C ...    228   7e-67   
ref|XP_007142207.1|  hypothetical protein PHAVU_008G261100g             228   8e-67   
ref|XP_004307643.1|  PREDICTED: phosphoinositide phospholipase C 6      229   9e-67   
ref|XP_010541455.1|  PREDICTED: phosphoinositide phospholipase C ...    228   9e-67   
ref|XP_010541456.1|  PREDICTED: phosphoinositide phospholipase C ...    228   1e-66   
ref|XP_002866283.1|  ATPLC1                                             227   1e-66   
emb|CAN62452.1|  hypothetical protein VITISV_032539                     228   2e-66   
ref|XP_008806127.1|  PREDICTED: phosphoinositide phospholipase C ...    224   2e-66   
dbj|BAA97337.1|  phosphoinositide-specific phospholipase C-line         231   2e-66   
ref|XP_009132032.1|  PREDICTED: phosphoinositide phospholipase C ...    226   3e-66   
gb|KHG11557.1|  Phosphoinositide phospholipase C 2 -like protein        226   4e-66   
emb|CDY61028.1|  BnaAnng17370D                                          227   4e-66   
ref|XP_006280254.1|  hypothetical protein CARUB_v10026170mg             226   5e-66   
emb|CDY02827.1|  BnaC02g10620D                                          222   4e-65   
gb|KHN34719.1|  Phosphoinositide phospholipase C 6                      223   6e-65   
ref|XP_003518307.2|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    221   1e-64   
ref|XP_006437477.1|  hypothetical protein CICLE_v10030935mg             223   2e-64   
ref|XP_006484628.1|  PREDICTED: phosphoinositide phospholipase C ...    223   2e-64   
ref|XP_006601953.1|  PREDICTED: phosphoinositide phospholipase C ...    222   4e-64   
emb|CDY32694.1|  BnaA02g07560D                                          219   4e-64   
emb|CDX71156.1|  BnaC03g12400D                                          221   7e-64   
ref|XP_009610392.1|  PREDICTED: phosphoinositide phospholipase C ...    219   9e-64   
emb|CDY65008.1|  BnaA06g40830D                                          214   9e-64   
ref|XP_006350841.1|  PREDICTED: phosphoinositide phospholipase C ...    220   9e-64   
gb|KHN20847.1|  Phosphoinositide phospholipase C 6                      220   1e-63   
ref|XP_002983412.1|  hypothetical protein SELMODRAFT_180165             220   1e-63   
ref|XP_007141768.1|  hypothetical protein PHAVU_008G224200g             219   2e-63   
ref|XP_007141769.1|  hypothetical protein PHAVU_008G224200g             219   2e-63   
ref|XP_009768994.1|  PREDICTED: phosphoinositide phospholipase C ...    217   3e-63   
ref|XP_002960627.1|  hypothetical protein SELMODRAFT_75628              218   3e-63   
ref|XP_009768988.1|  PREDICTED: phosphoinositide phospholipase C ...    218   4e-63   
emb|CDY52120.1|  BnaA10g29490D                                          217   6e-63   
ref|XP_009101938.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    218   6e-63   
ref|XP_007163543.1|  hypothetical protein PHAVU_001G243100g             219   6e-63   
ref|XP_011032114.1|  PREDICTED: phosphoinositide phospholipase C ...    218   8e-63   
emb|CDX80344.1|  BnaC09g33980D                                          217   1e-62   
ref|XP_002314099.2|  hypothetical protein POPTR_0009s05130g             217   1e-62   
ref|XP_002866805.1|  ATPLC1                                             216   2e-62   
emb|CAB37509.1|  phosphoinositide-specific phospholipase C              214   4e-62   
ref|XP_010446364.1|  PREDICTED: phosphoinositide phospholipase C ...    215   4e-62   
ref|NP_195565.2|  putative phosphoinositide phospholipase C 3           214   8e-62   
ref|XP_010323007.1|  PREDICTED: PI-phospholipase C PLC6 isoform X3      214   9e-62   
ref|XP_009610393.1|  PREDICTED: phosphoinositide phospholipase C ...    213   1e-61   
gb|KHN20848.1|  Phosphoinositide phospholipase C 6                      210   1e-61   
ref|XP_010323006.1|  PREDICTED: PI-phospholipase C PLC6 isoform X2      214   2e-61   
ref|NP_001234284.1|  PI-phospholipase C PLC6                            214   2e-61   
ref|XP_010323005.1|  PREDICTED: PI-phospholipase C PLC6 isoform X1      213   2e-61   
ref|XP_009610391.1|  PREDICTED: phosphoinositide phospholipase C ...    213   2e-61   
ref|XP_010431796.1|  PREDICTED: phosphoinositide phospholipase C ...    211   3e-61   



>ref|NP_001234181.1| PI-phospholipase C PLC4 [Solanum lycopersicum]
 gb|ABW81000.1| PI-phospholipase C PLC4 [Solanum lycopersicum]
Length=587

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 173/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMFR NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  397  GWMHGAQMVAFNMQGYGRALWLMHGMFRANGGCGYVKKPDFLLSIGPNNEVFDPKAKLPV  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTK KED WTPVW
Sbjct  457  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEVMKKTKTKEDKWTPVW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTC+PVSEL+PGI AV LCNRKGE YN
Sbjct  517  DEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCIPVSELKPGIHAVPLCNRKGEIYN  576

Query  210  SVRLLMRFTFV  178
            S RLLMRF F+
Sbjct  577  SARLLMRFEFI  587



>ref|XP_009790378.1| PREDICTED: phosphoinositide phospholipase C 4 [Nicotiana sylvestris]
Length=588

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 174/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMFR+NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  398  GWMHGAQMVAFNMQGYGRALWLMHGMFRSNGGCGYVKKPDFLLNVGPNNEVFDPKAKLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTK KED WTPVW
Sbjct  458  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADELMKKTKAKEDKWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTC+PVSEL+PGI AV LC+RKGE Y+
Sbjct  518  DEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCIPVSELKPGIHAVPLCDRKGEKYS  577

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  578  SARLLMRFEFV  588



>ref|XP_006344048.1| PREDICTED: phosphoinositide phospholipase C 4-like [Solanum tuberosum]
Length=587

 Score =   310 bits (794),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 172/191 (90%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMF+ NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  397  GWMHGAQMVAFNMQGYGRALWLMHGMFKANGGCGYVKKPDFLLSVGPNNEVFDPKAKLPV  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTK KED WTPVW
Sbjct  457  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKTKEDIWTPVW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTC+PVSEL+PGI  V LCNRKGE YN
Sbjct  517  DEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCIPVSELKPGIHTVPLCNRKGEKYN  576

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  577  SARLLMRFEFV  587



>emb|CAA72681.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Nicotiana 
rustica]
Length=588

 Score =   309 bits (792),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 174/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMFR+NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  398  GWMHGAQMVAFNMQGYGRALWLMHGMFRSNGGCGYVKKPDFLLNVGPNNEVFDPKAKLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTK KED WTPVW
Sbjct  458  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKTKEDKWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTC+P+SEL+PGI AV LC+RKGE Y+
Sbjct  518  DEAFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCIPISELKPGIHAVPLCDRKGEKYS  577

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  578  SVRLLMRFEFV  588



>emb|CDP09195.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 171/191 (90%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             WMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     +VF P+   PV
Sbjct  403  SWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLMKIGPNGQVFYPKEKQPV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMGDGWHLDFKQTHFD+YSPPDFYTRVGIAGVPAD  M KTKKKEDNWTP+W
Sbjct  463  KTTLKVKVYMGDGWHLDFKQTHFDMYSPPDFYTRVGIAGVPADVVMKKTKKKEDNWTPIW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSEL+PGI A+ LC+ KGE YN
Sbjct  523  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELKPGIHAIPLCDHKGEKYN  582

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  583  SVRLLMRFEFV  593



>emb|CAA65127.1| phosphoinositide-specific phospholipase C [Nicotiana rustica]
Length=588

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 173/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMF +NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  398  GWMHGAQMVAFNMQGYGRALWLMHGMFSSNGGCGYVKKPDFLLNVGPNNEVFDPKAKLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTK KED WTPVW
Sbjct  458  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKTKEDKWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTC+PVSEL+PGI AV LC+RKGE Y+
Sbjct  518  DEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCIPVSELKPGIHAVPLCDRKGEKYS  577

Query  210  SVRLLMRFTFV  178
            S RLLMRF F+
Sbjct  578  SARLLMRFEFI  588



>ref|XP_009622729.1| PREDICTED: phosphoinositide phospholipase C 4-like [Nicotiana 
tomentosiformis]
 gb|ABP57375.1| phosphoinositide-specific phospholipase C [Nicotiana tabacum]
Length=588

 Score =   307 bits (787),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 172/191 (90%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMFR+NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  398  GWMHGAQMVAFNMQGYGRALWLMHGMFRSNGGCGYVKKPDFLLNVGPNNEVFDPKAKLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTK KED WTPVW
Sbjct  458  KITLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKTKEDKWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELALLRIE HEYDMSEKDDFAGQTC+P+SEL+PGI AV LC+RKGE ++
Sbjct  518  DEEFTFPLTVPELALLRIEAHEYDMSEKDDFAGQTCIPISELKPGIHAVPLCDRKGEKFS  577

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  578  SARLLMRFEFV  588



>ref|XP_009347256.1| PREDICTED: phosphoinositide phospholipase C 4-like [Pyrus x bretschneideri]
Length=588

 Score =   306 bits (784),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 175/191 (92%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPDF++K     +VFDP+ATLPV
Sbjct  398  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDFIMKADSDYQVFDPKATLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVW
Sbjct  458  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            EEEFTFPLTVPELALLR+EVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKG  YN
Sbjct  518  EEEFTFPLTVPELALLRVEVHEYDMSEKDDFGGQTCLPVSELRQGIRAVPLFDRKGVKYN  577

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  578  SVRLLMRFEFV  588



>ref|XP_008355042.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide phospholipase 
C 4-like [Malus domestica]
Length=588

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 174/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPDF++K     +VFDP+A LPV
Sbjct  398  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDFIMKADSDNQVFDPKANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVW
Sbjct  458  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            EEEFTFPLTVPELALLR+EVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKG  YN
Sbjct  518  EEEFTFPLTVPELALLRVEVHEYDMSEKDDFGGQTCLPVSELRQGIRAVPLFDRKGVKYN  577

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  578  SVRLLMRFEFV  588



>gb|KJB35244.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=375

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 173/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR LWLM GMFR+NGGCGYVKKPDFL+       VF+P+A LPV
Sbjct  185  GWMHGAQMVAFNMQGYGRYLWLMHGMFRSNGGCGYVKKPDFLMNVNPNGSVFNPKADLPV  244

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVW
Sbjct  245  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVW  304

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPL VPELALLR+EVHEYDMSE+DDFAGQTCLPVSEL+PGIRAV L NRKGE +N
Sbjct  305  DEEFVFPLRVPELALLRVEVHEYDMSERDDFAGQTCLPVSELKPGIRAVPLFNRKGEKFN  364

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  365  SVRLLMRFEFI  375



>gb|KJB35243.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=482

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 173/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR LWLM GMFR+NGGCGYVKKPDFL+       VF+P+A LPV
Sbjct  292  GWMHGAQMVAFNMQGYGRYLWLMHGMFRSNGGCGYVKKPDFLMNVNPNGSVFNPKADLPV  351

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVW
Sbjct  352  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVW  411

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPL VPELALLR+EVHEYDMSE+DDFAGQTCLPVSEL+PGIRAV L NRKGE +N
Sbjct  412  DEEFVFPLRVPELALLRVEVHEYDMSERDDFAGQTCLPVSELKPGIRAVPLFNRKGEKFN  471

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  472  SVRLLMRFEFI  482



>ref|XP_007206576.1| hypothetical protein PRUPE_ppa020283mg [Prunus persica]
 gb|EMJ07775.1| hypothetical protein PRUPE_ppa020283mg [Prunus persica]
Length=587

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 172/190 (91%), Gaps = 4/190 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKE----VFDPRAtlpvk  568
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPDF++ E    +FDP+A LPVK
Sbjct  398  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDFIMNESDNQIFDPKAKLPVK  457

Query  567  ktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWE  388
            KTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVWE
Sbjct  458  KTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVWE  517

Query  387  EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNS  208
            EEFTFPL VPELALLR+EVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKG  YNS
Sbjct  518  EEFTFPLRVPELALLRVEVHEYDMSEKDDFGGQTCLPVSELRQGIRAVPLFDRKGTKYNS  577

Query  207  VRLLMRFTFV  178
            VRLLM+F F+
Sbjct  578  VRLLMQFEFI  587



>ref|XP_011460953.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=585

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 171/188 (91%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV--KEVFDPRAtlpvkkt  562
            GWMHGAQMVAFNMQGYG+SLWLM GMFR NGGCGYVKKPDF++  +++FDP+A L VKKT
Sbjct  398  GWMHGAQMVAFNMQGYGKSLWLMHGMFRANGGCGYVKKPDFVMNDEQIFDPKAKLTVKKT  457

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVWEEE
Sbjct  458  LKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEVMKKTKKKEDDWTPVWEEE  517

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            FTFPL VPELALLRIEVHEYDMSEKDDF GQTCLP+SEL+ GI A+ L NRKGE YNSVR
Sbjct  518  FTFPLRVPELALLRIEVHEYDMSEKDDFGGQTCLPISELKQGIHALPLFNRKGEKYNSVR  577

Query  201  LLMRFTFV  178
            LLMRF F 
Sbjct  578  LLMRFEFT  585



>ref|XP_004294231.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=588

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 171/188 (91%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV--KEVFDPRAtlpvkkt  562
            GWMHGAQMVAFNMQGYG+SLWLM GMFR NGGCGYVKKPDF++  +++FDP+A L VKKT
Sbjct  401  GWMHGAQMVAFNMQGYGKSLWLMHGMFRANGGCGYVKKPDFVMNDEQIFDPKAKLTVKKT  460

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVWEEE
Sbjct  461  LKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEVMKKTKKKEDDWTPVWEEE  520

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            FTFPL VPELALLRIEVHEYDMSEKDDF GQTCLP+SEL+ GI A+ L NRKGE YNSVR
Sbjct  521  FTFPLRVPELALLRIEVHEYDMSEKDDFGGQTCLPISELKQGIHALPLFNRKGEKYNSVR  580

Query  201  LLMRFTFV  178
            LLMRF F 
Sbjct  581  LLMRFEFT  588



>gb|KJB35242.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=591

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 173/191 (91%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR LWLM GMFR+NGGCGYVKKPDFL+       VF+P+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRYLWLMHGMFRSNGGCGYVKKPDFLMNVNPNGSVFNPKADLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVW
Sbjct  461  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPL VPELALLR+EVHEYDMSE+DDFAGQTCLPVSEL+PGIRAV L NRKGE +N
Sbjct  521  DEEFVFPLRVPELALLRVEVHEYDMSERDDFAGQTCLPVSELKPGIRAVPLFNRKGEKFN  580

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  581  SVRLLMRFEFI  591



>gb|KCW85435.1| hypothetical protein EUGRSUZ_B02250 [Eucalyptus grandis]
Length=479

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 165/190 (87%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR LWLM GMFR NGGCGYVKKPDFL+      EVFDP+A L V
Sbjct  289  GWMHGAQMVAFNMQGYGRFLWLMHGMFRANGGCGYVKKPDFLMSLGPKNEVFDPKAKLDV  348

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTL V VYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAD  M KTKK ED+WTPVW
Sbjct  349  KKTLTVTVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADTVMKKTKKIEDDWTPVW  408

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EF+FPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSEL+ GIRA+ L +RKGE  +
Sbjct  409  NQEFSFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELKSGIRAIPLYDRKGEKLS  468

Query  210  SVRLLMRFTF  181
            S RLLMRF F
Sbjct  469  SARLLMRFDF  478



>ref|XP_007016097.1| Phosphatidylinositol-speciwc phospholipase C4 [Theobroma cacao]
 gb|EOY33716.1| Phosphatidylinositol-speciwc phospholipase C4 [Theobroma cacao]
Length=591

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 172/191 (90%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKP+FL+      +VFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPEFLMNVDPDGQVFDPKAKLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFD YSPPDFYTRVGIAGVP DE M KTKKKED+WTPVW
Sbjct  461  KKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFYTRVGIAGVPDDEIMKKTKKKEDDWTPVW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF  PLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSEL+PGIRAV L +RKGE  N
Sbjct  521  DEEFALPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELKPGIRAVPLFDRKGEKLN  580

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  581  SVRLLMRFEFV  591



>ref|XP_008220865.1| PREDICTED: phosphoinositide phospholipase C 4-like [Prunus mume]
Length=587

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 171/190 (90%), Gaps = 4/190 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKE----VFDPRAtlpvk  568
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPDF++ E    +FDP+A LPVK
Sbjct  398  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDFIMNESDNQIFDPKAKLPVK  457

Query  567  ktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWE  388
            KTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVWE
Sbjct  458  KTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVWE  517

Query  387  EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNS  208
            EEFTFPL VPELALLR+EVHEYDMSEKDDF GQTCLPVSELR GI AV L +RKG  YNS
Sbjct  518  EEFTFPLRVPELALLRVEVHEYDMSEKDDFGGQTCLPVSELRQGICAVPLFDRKGTKYNS  577

Query  207  VRLLMRFTFV  178
            VRLLM+F F+
Sbjct  578  VRLLMQFEFI  587



>gb|KJB55732.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
 gb|KJB55733.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
Length=367

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-EVFDPRAtlpvkktl  559
            GWMHGAQM+AFNMQGYGRSLWLMQGMFR NGGCGYVKKPDFL+  +    RA LPVKK L
Sbjct  181  GWMHGAQMIAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFLMNVDANSERAKLPVKKRL  240

Query  558  kvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEEF  379
            +VKVYMGDGWHLDFK THFD YSPPDFYT+VGIAGVP DE M KTK KEDNWTPVW+EEF
Sbjct  241  RVKVYMGDGWHLDFKHTHFDTYSPPDFYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEF  300

Query  378  TFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVRL  199
            TFPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSEL+ GIRAV L +RKGE  NS RL
Sbjct  301  TFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELKQGIRAVPLFDRKGEKLNSTRL  360

Query  198  LMRFTFV  178
            LMRF FV
Sbjct  361  LMRFDFV  367



>ref|XP_006425071.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 ref|XP_006425072.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 gb|ESR38311.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 gb|ESR38312.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
Length=586

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 172/191 (90%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHG QMVAFNMQGYGR++WLM GMFR+NGGCGYVKKPD L+      +VF+P+ TLPV
Sbjct  396  GWMHGTQMVAFNMQGYGRAMWLMHGMFRSNGGCGYVKKPDLLMNVGPDGQVFNPKETLPV  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLK+KVYMGDGWHLDFKQTHFDLYSPPDFY +VGIAGVPAD+ M KTK KEDNWTPVW
Sbjct  456  KKTLKIKVYMGDGWHLDFKQTHFDLYSPPDFYCKVGIAGVPADQIMKKTKPKEDNWTPVW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            E+EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSEL+PGIRAV L +RKGE  N
Sbjct  516  EQEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELKPGIRAVPLSDRKGEMLN  575

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  576  SVRLLMRFDFV  586



>gb|KHG04158.1| Phosphoinositide phospholipase C 4 -like protein [Gossypium arboreum]
Length=591

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 172/191 (90%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQMVAFNMQGYGR LWLM GMFR+NGGCGYVKKPDFL+       VF+P+A LPV
Sbjct  401  GWMLGAQMVAFNMQGYGRYLWLMHGMFRSNGGCGYVKKPDFLMNVNPNGSVFNPKADLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADE M KTKKKED+WTPVW
Sbjct  461  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADEIMKKTKKKEDDWTPVW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPL VPELALLR+EVHEYDMSEKDDFAGQTCLPVSEL+PGIRAV L NRKGE +N
Sbjct  521  DEEFAFPLRVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELKPGIRAVPLFNRKGEKFN  580

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  581  SVRLLMRFEFI  591



>gb|ABU53666.1| phospholipase C [Torenia fournieri]
Length=583

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 167/188 (89%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV--KEVFDPRAtlpvkkt  562
            GW+HGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPD  +   ++FDP+A   VKKT
Sbjct  396  GWLHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDIFMDSNQLFDPKAEYSVKKT  455

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVKVYMGDGWH+DFKQTHFD YSPPDFYTR+GIAG PADE M KTKKKEDNW PVW EE
Sbjct  456  LKVKVYMGDGWHMDFKQTHFDAYSPPDFYTRIGIAGAPADEMMKKTKKKEDNWAPVWNEE  515

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F FPLTV E+A+LRIEVHEYDMSEKDDFAGQTCLPVSE +PGIRAV +C+RKGE YNSVR
Sbjct  516  FEFPLTVSEIAILRIEVHEYDMSEKDDFAGQTCLPVSESKPGIRAVPICDRKGEKYNSVR  575

Query  201  LLMRFTFV  178
            LLMRF FV
Sbjct  576  LLMRFEFV  583



>ref|XP_010043428.1| PREDICTED: phosphoinositide phospholipase C 4-like [Eucalyptus 
grandis]
 gb|KCW85434.1| hypothetical protein EUGRSUZ_B02250 [Eucalyptus grandis]
Length=588

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 165/190 (87%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR LWLM GMFR NGGCGYVKKPDFL+      EVFDP+A L V
Sbjct  398  GWMHGAQMVAFNMQGYGRFLWLMHGMFRANGGCGYVKKPDFLMSLGPKNEVFDPKAKLDV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTL V VYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAD  M KTKK ED+WTPVW
Sbjct  458  KKTLTVTVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPADTVMKKTKKIEDDWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EF+FPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSEL+ GIRA+ L +RKGE  +
Sbjct  518  NQEFSFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELKSGIRAIPLYDRKGEKLS  577

Query  210  SVRLLMRFTF  181
            S RLLMRF F
Sbjct  578  SARLLMRFDF  587



>gb|KDO66894.1| hypothetical protein CISIN_1g007887mg [Citrus sinensis]
Length=586

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHG QMVAFNMQGYGR++WLM GMFR+NGGCGYVKKPD  +      +VF+P+  LPV
Sbjct  396  GWMHGTQMVAFNMQGYGRAMWLMHGMFRSNGGCGYVKKPDLQMNVGPDGQVFNPKEILPV  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLK+KVYMGDGWHLDFKQTHFDLYSPPDFY +VGIAGVPAD+ M KTK KEDNWTPVW
Sbjct  456  KKTLKIKVYMGDGWHLDFKQTHFDLYSPPDFYCKVGIAGVPADQIMKKTKPKEDNWTPVW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            E+EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSEL+PGIRAV L +RKGE  N
Sbjct  516  EQEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELKPGIRAVPLSDRKGEMLN  575

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  576  SVRLLMRFDFV  586



>ref|XP_006488531.1| PREDICTED: phosphoinositide phospholipase C 4-like [Citrus sinensis]
Length=586

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHG QMVAFNMQGYGR++WLM GMFR+NGGCGYVKKPD  +      +VF+P+  LPV
Sbjct  396  GWMHGTQMVAFNMQGYGRAMWLMHGMFRSNGGCGYVKKPDLQMNVGPDGQVFNPKEILPV  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLK+KVYMGDGWHLDFKQTHFDLYSPPDFY +VGIAGVPAD+ M KTK KEDNWTPVW
Sbjct  456  KKTLKIKVYMGDGWHLDFKQTHFDLYSPPDFYCKVGIAGVPADQIMKKTKPKEDNWTPVW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            E+EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSEL+PGIRAV L +RKGE  N
Sbjct  516  EQEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELKPGIRAVPLSDRKGEMLN  575

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  576  SVRLLMRFDFV  586



>gb|AFN53674.1| hypothetical protein [Linum usitatissimum]
Length=530

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 169/188 (90%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GWMHGAQMVAFNMQGYGR+LWLM GMFR+NGGCGYVKKPD L+   ++F+P++ LPVKKT
Sbjct  343  GWMHGAQMVAFNMQGYGRALWLMHGMFRSNGGCGYVKKPDILMNPDKLFNPKSQLPVKKT  402

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVKVY GDGWHLDFKQTHFD YSPPDFYTRVGIAGVP D  M KT+ KED+WTPVW EE
Sbjct  403  LKVKVYSGDGWHLDFKQTHFDKYSPPDFYTRVGIAGVPDDVVMKKTEVKEDDWTPVWNEE  462

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            FTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIRAV L +RKGE YNSV+
Sbjct  463  FTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRAVPLFSRKGEKYNSVK  522

Query  201  LLMRFTFV  178
            LLMRF FV
Sbjct  523  LLMRFEFV  530



>ref|XP_003615684.1| Phosphoinositide phospholipase C [Medicago truncatula]
Length=424

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMFR+NG CGYVKKPDFL+      EVF+P+  L V
Sbjct  234  GWMHGAQMVAFNMQGYGRNLWLMHGMFRSNGECGYVKKPDFLMNVGPNNEVFNPKDKLEV  293

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVK+Y+GDGW +DFKQTHFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  294  KKTLKVKIYVGDGWSMDFKQTHFDSYSPPDFYARVGIAGVPADVTMKKTKTIEDNWIPTW  353

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            EEEFTFPLTVPELALLR+EVHEYDMSE DDFAGQTCLP++EL+ GIRAV L +RKGE YN
Sbjct  354  EEEFTFPLTVPELALLRVEVHEYDMSETDDFAGQTCLPITELKQGIRAVPLYDRKGEKYN  413

Query  210  SVRLLMRFTFV  178
            SVRLLM+F F+
Sbjct  414  SVRLLMKFDFI  424



>ref|XP_009399994.1| PREDICTED: phosphoinositide phospholipase C 6-like [Musa acuminata 
subsp. malaccensis]
Length=592

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 168/191 (88%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQG+FR NGGCG+V+KPDFL+K     EVFDP A+LPV
Sbjct  402  GWMHGAQMVAFNMQGYGRSLWLMQGLFRANGGCGFVRKPDFLMKVGPHGEVFDPEASLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMGDGW +DF QTHFD YSPPDFYT+VGIAGVPAD KM KTK  EDNWTPVW
Sbjct  462  KITLKVKVYMGDGWRMDFSQTHFDAYSPPDFYTKVGIAGVPADTKMKKTKIIEDNWTPVW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            EEEF+FPLTVPELALLR+EVHEYDMS+KDDF GQTCLPV ELRPGIRAV L +RKG  Y 
Sbjct  522  EEEFSFPLTVPELALLRVEVHEYDMSDKDDFGGQTCLPVWELRPGIRAVPLHDRKGNKYK  581

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  582  SVRLLMRFQFV  592



>ref|XP_010253735.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nelumbo nucifera]
Length=586

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM+GAQMVA NMQGYGRSLWLM GMFR NGGCGYVKKPDFL+      +VFDP+A    
Sbjct  396  GWMYGAQMVALNMQGYGRSLWLMHGMFRANGGCGYVKKPDFLLNAGPHNKVFDPKAKSQT  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV+VYMG+GW+ DFK+THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNWTPVW
Sbjct  456  KKTLKVRVYMGEGWNYDFKRTHFDAYSPPDFYTRVGIAGVPADSVMKKTKIIEDNWTPVW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPE+ALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L NRKGE Y 
Sbjct  516  DEEFTFPLTVPEMALLRIEVHEYDMSEKDDFGGQTCLPVSELRTGIRAVPLHNRKGEQYK  575

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  576  SVKLLMRFDFI  586



>ref|XP_008220858.1| PREDICTED: phosphoinositide phospholipase C 4-like [Prunus mume]
Length=589

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 169/190 (89%), Gaps = 4/190 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK----EVFDPRAtlpvk  568
            GWMHGAQMVAFNMQGYGRSLWLMQGMFR NGGCGYVKKPDF++K    +VFDP+A LPVK
Sbjct  400  GWMHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFVMKNLDNQVFDPKANLPVK  459

Query  567  ktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWE  388
            KTLKVKVYMGDGWHLDFK THFDLYSPPDFYTRVGIAGVPADE M +T+KKED WTP WE
Sbjct  460  KTLKVKVYMGDGWHLDFKHTHFDLYSPPDFYTRVGIAGVPADEIMKRTQKKEDIWTPSWE  519

Query  387  EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNS  208
            EEFTF LTVPELALLR+EVHE+D+SEKDDF GQTC P+SEL  GIRAV L +RKG  YNS
Sbjct  520  EEFTFQLTVPELALLRVEVHEHDLSEKDDFGGQTCFPISELEQGIRAVPLFDRKGNKYNS  579

Query  207  VRLLMRFTFV  178
            +RLLMRF F+
Sbjct  580  IRLLMRFQFI  589



>ref|XP_010253733.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nelumbo nucifera]
Length=587

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM+GAQMVA NMQGYGRSLWLM GMFR NGGCGYVKKPDFL+      +VFDP+A    
Sbjct  397  GWMYGAQMVALNMQGYGRSLWLMHGMFRANGGCGYVKKPDFLLNAGPHNKVFDPKAKSQT  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV+VYMG+GW+ DFK+THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNWTPVW
Sbjct  457  KKTLKVRVYMGEGWNYDFKRTHFDAYSPPDFYTRVGIAGVPADSVMKKTKIIEDNWTPVW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPE+ALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L NRKGE Y 
Sbjct  517  DEEFTFPLTVPEMALLRIEVHEYDMSEKDDFGGQTCLPVSELRTGIRAVPLHNRKGEQYK  576

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  577  SVKLLMRFDFI  587



>ref|XP_002525651.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF36769.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=578

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 166/191 (87%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             WMHGAQMVAFNMQGYGR+LWLM GMFR NG CGYVKKPD L+      EVF+P+A LP+
Sbjct  388  AWMHGAQMVAFNMQGYGRALWLMHGMFRANGSCGYVKKPDILMNVGPHGEVFNPKAKLPI  447

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFK THFDLYSPPDFYTRVGIAGVPAD KM KTK KEDNWTPVW
Sbjct  448  KKTLKVKVYMGDGWHLDFKPTHFDLYSPPDFYTRVGIAGVPADVKMEKTKIKEDNWTPVW  507

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQ C PVSELRPGIRAV L +RKG+  N
Sbjct  508  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQICFPVSELRPGIRAVPLFDRKGKKLN  567

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  568  SSRLLMRFEFV  578



>gb|KJB55734.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
Length=583

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-EVFDPRAtlpvkktl  559
            GWMHGAQM+AFNMQGYGRSLWLMQGMFR NGGCGYVKKPDFL+  +    RA LPVKK L
Sbjct  397  GWMHGAQMIAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFLMNVDANSERAKLPVKKRL  456

Query  558  kvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEEF  379
            +VKVYMGDGWHLDFK THFD YSPPDFYT+VGIAGVP DE M KTK KEDNWTPVW+EEF
Sbjct  457  RVKVYMGDGWHLDFKHTHFDTYSPPDFYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEF  516

Query  378  TFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVRL  199
            TFPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSEL+ GIRAV L +RKGE  NS RL
Sbjct  517  TFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELKQGIRAVPLFDRKGEKLNSTRL  576

Query  198  LMRFTFV  178
            LMRF FV
Sbjct  577  LMRFDFV  583



>ref|XP_009402378.1| PREDICTED: phosphoinositide phospholipase C 6-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   291 bits (745),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 166/191 (87%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGRSLWLM G ++ NGGCGY+KKPDFLVK     EVFDP+A LPV
Sbjct  401  GWIHGAQMVAFNMQGYGRSLWLMHGFYKANGGCGYIKKPDFLVKAGPNNEVFDPKAVLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVK+YMGDGW +DF QTHFD YSPPDFYTRVGIAGVPAD  M KTK  EDNWTPVW
Sbjct  461  KKTLKVKIYMGDGWRMDFSQTHFDAYSPPDFYTRVGIAGVPADTVMKKTKTIEDNWTPVW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTF LTVPELALLRIEVHEYDMSEKDDF GQTC+PVSELRPGIRAV L + KG  +N
Sbjct  521  DEEFTFTLTVPELALLRIEVHEYDMSEKDDFGGQTCIPVSELRPGIRAVPLFDHKGNKFN  580

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  581  SVKLLMRFVFV  591



>gb|EYU45716.1| hypothetical protein MIMGU_mgv1a003401mg [Erythranthe guttata]
Length=587

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 167/191 (87%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGR LWLMQGMFR+NGGCGYVKKPDFL+      +VFDP+    V
Sbjct  397  GWLHGAQMVAFNMQGYGRYLWLMQGMFRSNGGCGYVKKPDFLMNIDSNNKVFDPKTKSLV  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWH+ FKQTHFD YSPPDFYTRVGIAG PADE M KTKKKED+WTPVW
Sbjct  457  KKTLKVKVYMGDGWHMAFKQTHFDSYSPPDFYTRVGIAGAPADEIMKKTKKKEDDWTPVW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSEL+ GIRAV L +RKGE  N
Sbjct  517  GEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELKSGIRAVPLFDRKGEKLN  576

Query  210  SVRLLMRFTFV  178
            SVRLLMRF  +
Sbjct  577  SVRLLMRFEIL  587



>ref|XP_010937845.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Elaeis guineensis]
Length=598

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM G ++ NGGCGYVKKPDFL+K     EVF P A + V
Sbjct  404  GWMHGAQMVAFNMQGYGRSLWLMHGFYKANGGCGYVKKPDFLLKTGPDGEVFYPTANVAV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DFKQTHFD YSPPDFYTRVGIAGVPAD  M KTK  ED+WTPVW
Sbjct  464  KKTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTRVGIAGVPADTVMKKTKAIEDDWTPVW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIR V L +RKG  + 
Sbjct  524  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRTVPLFDRKGMKFK  583

Query  210  SVRLLMRFTFV*VCC  166
            SV+LLM+F FV  CC
Sbjct  584  SVKLLMQFEFV-GCC  597



>emb|CBI15949.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGR LWLM GMFR NGGCGYVKKPDFL+      +VF+PR  LPV
Sbjct  360  GWTHGAQMVAFNMQGYGRYLWLMHGMFRANGGCGYVKKPDFLMNVGPNNQVFNPRVKLPV  419

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFY RVGIAGVP DE M KTK KED WTPVW
Sbjct  420  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYARVGIAGVPGDEVMKKTKTKEDKWTPVW  479

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLR+EVHEYD+SEKDDFAGQTCLP+SEL+PGIRAV L NRKGE + 
Sbjct  480  NEEFQFPLTVPELALLRVEVHEYDLSEKDDFAGQTCLPISELKPGIRAVPLFNRKGEMFC  539

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  540  SARLLMRFEFV  550



>ref|XP_010937844.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Elaeis guineensis]
Length=599

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM G ++ NGGCGYVKKPDFL+K     EVF P A + V
Sbjct  405  GWMHGAQMVAFNMQGYGRSLWLMHGFYKANGGCGYVKKPDFLLKTGPDGEVFYPTANVAV  464

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DFKQTHFD YSPPDFYTRVGIAGVPAD  M KTK  ED+WTPVW
Sbjct  465  KKTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTRVGIAGVPADTVMKKTKAIEDDWTPVW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIR V L +RKG  + 
Sbjct  525  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRTVPLFDRKGMKFK  584

Query  210  SVRLLMRFTFV*VCC  166
            SV+LLM+F FV  CC
Sbjct  585  SVKLLMQFEFV-GCC  598



>emb|CBI30388.3| unnamed protein product [Vitis vinifera]
Length=581

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGY R LWLMQGMFR NGGCGYVKKPD L+K     +VFDP+A LPV
Sbjct  391  GWMHGAQMVAFNMQGYDRPLWLMQGMFRANGGCGYVKKPDLLLKVGPHDKVFDPKANLPV  450

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMG+GWHLDF  THFD+YSPPDFYT+VGIAGVPAD  M KTK  ED+WTP W
Sbjct  451  KTTLKVKVYMGEGWHLDFHHTHFDIYSPPDFYTKVGIAGVPADSLMKKTKAVEDDWTPTW  510

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLT PELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L N+KGE YN
Sbjct  511  NEEFEFPLTAPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRTGIRAVPLHNQKGEKYN  570

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  571  SVKLLMRFEFV  581



>gb|KHG10595.1| Phosphoinositide phospholipase C 4 [Gossypium arboreum]
Length=583

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKEVFD-PRAtlpvkktl  559
            GWMHGAQM+AFNMQGYGRSLWLMQGMFR NGGCGYVKKPDFL+    +  RA LPVKK L
Sbjct  397  GWMHGAQMIAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFLMNVGANGERAKLPVKKRL  456

Query  558  kvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEEF  379
            +VKVYMGDGWHLDFK THFD YSPPDFYT+VGIAGVP DE M KTK KEDNWTPVW+EEF
Sbjct  457  RVKVYMGDGWHLDFKHTHFDTYSPPDFYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEF  516

Query  378  TFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVRL  199
            TFPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSEL+ GIRAV L +RKGE  NS RL
Sbjct  517  TFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELKQGIRAVPLFDRKGEKLNSTRL  576

Query  198  LMRFTFV  178
            LMRF FV
Sbjct  577  LMRFDFV  583



>ref|XP_010264634.1| PREDICTED: phosphoinositide phospholipase C 2 isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 168/188 (89%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GWM+GAQMVA NMQGYGRSLWLM GMFRTNGGCGYVKKPDFL+   + FDP+ATLPVKKT
Sbjct  400  GWMYGAQMVALNMQGYGRSLWLMHGMFRTNGGCGYVKKPDFLLNANKAFDPKATLPVKKT  459

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LK++VYMG+GW+ DFK+THFD YSPPDFYTRVGIAGVPAD  M KTK  ED+WTPVW+EE
Sbjct  460  LKMRVYMGEGWNFDFKRTHFDNYSPPDFYTRVGIAGVPADSVMKKTKTIEDDWTPVWDEE  519

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKGE Y+SV+
Sbjct  520  FEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRTGIRAVPLHSRKGEKYSSVK  579

Query  201  LLMRFTFV  178
            LLMRF FV
Sbjct  580  LLMRFQFV  587



>ref|XP_010264635.1| PREDICTED: phosphoinositide phospholipase C 2 isoform X2 [Nelumbo 
nucifera]
Length=586

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 168/188 (89%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GWM+GAQMVA NMQGYGRSLWLM GMFRTNGGCGYVKKPDFL+   + FDP+ATLPVKKT
Sbjct  399  GWMYGAQMVALNMQGYGRSLWLMHGMFRTNGGCGYVKKPDFLLNANKAFDPKATLPVKKT  458

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LK++VYMG+GW+ DFK+THFD YSPPDFYTRVGIAGVPAD  M KTK  ED+WTPVW+EE
Sbjct  459  LKMRVYMGEGWNFDFKRTHFDNYSPPDFYTRVGIAGVPADSVMKKTKTIEDDWTPVWDEE  518

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKGE Y+SV+
Sbjct  519  FEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRTGIRAVPLHSRKGEKYSSVK  578

Query  201  LLMRFTFV  178
            LLMRF FV
Sbjct  579  LLMRFQFV  586



>ref|XP_002299806.2| hypothetical protein POPTR_0001s25910g [Populus trichocarpa]
 gb|EEE84611.2| hypothetical protein POPTR_0001s25910g [Populus trichocarpa]
Length=586

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGR LWLM GMFR+NGGCG+VKKPDFL+K     EVF+P+   PV
Sbjct  394  GWTHGAQMVAFNMQGYGRYLWLMNGMFRSNGGCGFVKKPDFLMKGGPHGEVFNPKTKFPV  453

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KK+LKVKVYMGDGWHLDFK THFD YSPPDFYTRVGIAGVP D  M KTK KEDNWTPVW
Sbjct  454  KKSLKVKVYMGDGWHLDFKPTHFDSYSPPDFYTRVGIAGVPGDAIMKKTKIKEDNWTPVW  513

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF F LTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELRPGIRAV L +RKGE  N
Sbjct  514  DEEFIFQLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVPLFDRKGEKLN  573

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  574  SSRLLMRFEFV  584



>gb|AFO54605.1| phospholipase C [Populus tomentosa]
Length=586

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKE-----VFDPRAtlpv  571
            GW HGAQMVAFNMQGYGR LWLM GMFR+NGGCG+VKKPDFL+KE     VF+P+   PV
Sbjct  394  GWTHGAQMVAFNMQGYGRYLWLMNGMFRSNGGCGFVKKPDFLMKEGPHGEVFNPKTKFPV  453

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KK+LKVKVYMGDGWHLDFKQTHFD YSPPDFYTRVGIAGVP D  M KTK KEDNWTPVW
Sbjct  454  KKSLKVKVYMGDGWHLDFKQTHFDSYSPPDFYTRVGIAGVPGDAIMKKTKIKEDNWTPVW  513

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF F LTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE  N
Sbjct  514  DEEFIFLLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRSGIRAVPLFDRKGEKLN  573

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  574  SSRLLMRFEFV  584



>ref|XP_002278527.1| PREDICTED: phosphoinositide phospholipase C 4-like [Vitis vinifera]
Length=588

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGR LWLM GMFR NGGCGYVKKPDFL+      +VF+PR  LPV
Sbjct  398  GWTHGAQMVAFNMQGYGRYLWLMHGMFRANGGCGYVKKPDFLMNVGPNNQVFNPRVKLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFY RVGIAGVP DE M KTK KED WTPVW
Sbjct  458  KKTLKVKVYMGDGWHLDFKQTHFDLYSPPDFYARVGIAGVPGDEVMKKTKTKEDKWTPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLR+EVHEYD+SEKDDFAGQTCLP+SEL+PGIRAV L NRKGE + 
Sbjct  518  NEEFQFPLTVPELALLRVEVHEYDLSEKDDFAGQTCLPISELKPGIRAVPLFNRKGEMFC  577

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  578  SARLLMRFEFV  588



>ref|XP_010654153.1| PREDICTED: phosphoinositide phospholipase C 2-like [Vitis vinifera]
Length=666

 Score =   290 bits (743),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGY R LWLMQGMFR NGGCGYVKKPD L+K     +VFDP+A LPV
Sbjct  476  GWMHGAQMVAFNMQGYDRPLWLMQGMFRANGGCGYVKKPDLLLKVGPHDKVFDPKANLPV  535

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMG+GWHLDF  THFD+YSPPDFYT+VGIAGVPAD  M KTK  ED+WTP W
Sbjct  536  KTTLKVKVYMGEGWHLDFHHTHFDIYSPPDFYTKVGIAGVPADSLMKKTKAVEDDWTPTW  595

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLT PELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L N+KGE YN
Sbjct  596  NEEFEFPLTAPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRTGIRAVPLHNQKGEKYN  655

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  656  SVKLLMRFEFV  666



>ref|XP_011043776.1| PREDICTED: phosphoinositide phospholipase C 4-like [Populus euphratica]
Length=586

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGR LWLM GMFR+NGGCG+VKKPDFL+K     EVF+P+   PV
Sbjct  394  GWTHGAQMVAFNMQGYGRYLWLMNGMFRSNGGCGFVKKPDFLMKGGPHGEVFNPKTKFPV  453

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KK+LKVKVYMGDGWHLDFK THFD YSPPDFYTRVGIAGVP D  M +TK KEDNWTPVW
Sbjct  454  KKSLKVKVYMGDGWHLDFKPTHFDSYSPPDFYTRVGIAGVPDDAIMKRTKIKEDNWTPVW  513

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF F LTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELRPGIRAV L +RKGE  N
Sbjct  514  DEEFIFQLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVPLFDRKGEKLN  573

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  574  SSRLLMRFEFV  584



>gb|EYU20012.1| hypothetical protein MIMGU_mgv1a003407mg [Erythranthe guttata]
Length=587

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLW+M GMF+ NGGCGYVKKPDFL+K     EVFDPRATLPV
Sbjct  397  GWMHGAQMVAFNMQGYGRSLWVMHGMFKANGGCGYVKKPDFLLKADSYGEVFDPRATLPV  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  457  KTTLRVTVYMGEGWYFDFRHTHFDAYSPPDFYARVGIAGVPADTIMKKTKTLEDNWIPNW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPV+ELR GIRAV L +RKGE YN
Sbjct  517  DEVFEFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVNELRKGIRAVPLSSRKGEKYN  576

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  577  SVKLLMRFEFV  587



>gb|EPS61000.1| hypothetical protein M569_13801, partial [Genlisea aurea]
Length=587

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV--KEVFDPRAtlpvkkt  562
            GW+HGAQMVAFNMQGYGRSLWLMQGMFR NGGCG+VKKPDFL+   +VFDP+A L VK+T
Sbjct  401  GWLHGAQMVAFNMQGYGRSLWLMQGMFRGNGGCGFVKKPDFLMNASDVFDPKAKLHVKRT  460

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVKVYMGDGWH+DFK THFDLYSPPDFYT VGIAG P DE M KTKKKEDNWTPVW+EE
Sbjct  461  LKVKVYMGDGWHMDFKPTHFDLYSPPDFYTVVGIAGAPGDEAMKKTKKKEDNWTPVWDEE  520

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F FPL+VPE+ALLRIEVHEYDM+EKDDFAGQ CLPVSELR GIRAV LC+RKGE   SVR
Sbjct  521  FAFPLSVPEVALLRIEVHEYDMTEKDDFAGQICLPVSELRSGIRAVPLCDRKGERLKSVR  580

Query  201  LLMRF  187
            LL+RF
Sbjct  581  LLVRF  585



>gb|AES98642.2| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=594

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGR+LWLM GMFR+NG CGYVKKPDFL+      EVF+P+  L V
Sbjct  404  GWMHGAQMVAFNMQGYGRNLWLMHGMFRSNGECGYVKKPDFLMNVGPNNEVFNPKDKLEV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVK+Y+GDGW +DFKQTHFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  464  KKTLKVKIYVGDGWSMDFKQTHFDSYSPPDFYARVGIAGVPADVTMKKTKTIEDNWIPTW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            EEEFTFPLTVPELALLR+EVHEYDMSE DDFAGQTCLP++EL+ GIRAV L +RKGE YN
Sbjct  524  EEEFTFPLTVPELALLRVEVHEYDMSETDDFAGQTCLPITELKQGIRAVPLYDRKGEKYN  583

Query  210  SVRLLMRFTFV  178
            SVRLLM+F F+
Sbjct  584  SVRLLMKFDFI  594



>ref|XP_008789095.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Phoenix dactylifera]
Length=491

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLM G ++ NGGCGYVKKPDFL+K     EVF P A LPV
Sbjct  301  GWMHGAQMVAFNMQGHGRSLWLMHGFYKANGGCGYVKKPDFLLKTGPNREVFHPTANLPV  360

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW  DF QTHFD YSPPDFYTRVGIAGVPAD  M KTK  ED+WTPVW
Sbjct  361  KKTLKVKVYMGDGWRKDFSQTHFDAYSPPDFYTRVGIAGVPADAVMKKTKAIEDDWTPVW  420

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIRAV L +RKG  + 
Sbjct  421  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRAVPLFDRKGMKFK  480

Query  210  SVRLLMRFTFV  178
            SV+LL+RF FV
Sbjct  481  SVKLLVRFEFV  491



>ref|XP_007208015.1| hypothetical protein PRUPE_ppa003249mg [Prunus persica]
 gb|EMJ09214.1| hypothetical protein PRUPE_ppa003249mg [Prunus persica]
Length=589

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 168/190 (88%), Gaps = 4/190 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK----EVFDPRAtlpvk  568
            GWMHGAQMVAFNMQGYGRSLWLMQGMFR NGGCGYVKKPDF++K    +VF P+A LPVK
Sbjct  400  GWMHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFVMKNLDNQVFYPKANLPVK  459

Query  567  ktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWE  388
            KTLKVKVYMGDGWHLDFK THFDLYSPPDFYTRVGIAGVPADE M +TKKKED WTP WE
Sbjct  460  KTLKVKVYMGDGWHLDFKHTHFDLYSPPDFYTRVGIAGVPADEIMKQTKKKEDIWTPSWE  519

Query  387  EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNS  208
            EEFTF L VPELALLR+EVHE+D+SEKDDF GQTC P+SEL+ GIRAV L +RKG  YN+
Sbjct  520  EEFTFQLKVPELALLRVEVHEHDLSEKDDFGGQTCFPISELKQGIRAVPLFDRKGNKYNT  579

Query  207  VRLLMRFTFV  178
            +RLLMRF F+
Sbjct  580  IRLLMRFHFI  589



>gb|KDP46490.1| hypothetical protein JCGZ_08462 [Jatropha curcas]
Length=588

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             WMHGAQMVAFNMQGYGR+LWLM GMFR NGGCGYVKKPDFL+      EVF+P+A LPV
Sbjct  398  AWMHGAQMVAFNMQGYGRALWLMHGMFRANGGCGYVKKPDFLMNVGPHGEVFNPKANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWHLDFK THFD+YSPPDFYTRVGIAGVPAD K+ KTK KEDNWTP+W
Sbjct  458  KKTLKVKVYMGDGWHLDFKPTHFDMYSPPDFYTRVGIAGVPADVKVEKTKIKEDNWTPIW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQ C PVSELR GIRA+ L +RKG+   
Sbjct  518  GEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQACFPVSELRQGIRAIPLFDRKGKKLP  577

Query  210  SVRLLMRFTFV  178
            S RLL RF FV
Sbjct  578  SARLLFRFDFV  588



>gb|KDP44771.1| hypothetical protein JCGZ_01271 [Jatropha curcas]
Length=591

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMF+ NGGCGYVKKPDFL+K     EVFDPRA LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMHGMFKANGGCGYVKKPDFLLKPNSNGEVFDPRAKLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMG+GW+ DFK+THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW PVW
Sbjct  461  KTTLKVKVYMGEGWYYDFKRTHFDAYSPPDFYARVGIAGVPADTIMKKTKTLEDNWIPVW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSE+  GIRA+ L ++KG  YN
Sbjct  521  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSEISRGIRAIPLHDQKGVKYN  580

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  581  SVKLLMRFDFV  591



>ref|XP_002533650.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF28738.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=594

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLMQGMFR NGGCGYVKKPDFL+K     EVFDPRA LPV
Sbjct  404  GWMHGAQMVAFNMQGHGRSLWLMQGMFRANGGCGYVKKPDFLLKSGPHGEVFDPRAKLPV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMG+GW+ DF +THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW PVW
Sbjct  464  KTTLKVKVYMGEGWYYDFDRTHFDAYSPPDFYARVGIAGVPADTIMKKTKTLEDNWIPVW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLR+EVHEYDMSEKDDF GQ+CLPVSELR GIRA+ L +RKG  YN
Sbjct  524  NEEFEFPLTVPELALLRVEVHEYDMSEKDDFGGQSCLPVSELRKGIRAIPLHDRKGVKYN  583

Query  210  SVRLLMRFTFV  178
            SV+LL+RF FV
Sbjct  584  SVKLLVRFDFV  594



>ref|XP_004490600.1| PREDICTED: phosphoinositide phospholipase C 4-like [Cicer arietinum]
Length=593

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG++LWLM GMFR+NGGCGYVKKPDFL+      EVF+P+  L V
Sbjct  403  GWMHGAQMVAFNMQGYGKNLWLMNGMFRSNGGCGYVKKPDFLMNVGPNNEVFNPKDKLQV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVK+Y+GDGW +DFKQTHFD YSPPDFY RVGIAGVP D  M KTK  EDNW P W
Sbjct  463  KKTLKVKIYVGDGWRMDFKQTHFDSYSPPDFYARVGIAGVPDDVTMKKTKIIEDNWIPAW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELALLR+EVHEYDMSE DDFAGQTCLP++EL+ GIRAV L +RKGE YN
Sbjct  523  DEEFTFPLTVPELALLRVEVHEYDMSETDDFAGQTCLPIAELKQGIRAVPLFDRKGEKYN  582

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  583  SVRLLMRFDFI  593



>ref|XP_002463446.1| hypothetical protein SORBIDRAFT_02g044010 [Sorghum bicolor]
 gb|EER99967.1| hypothetical protein SORBIDRAFT_02g044010 [Sorghum bicolor]
Length=607

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   +VFDPR   PVKK
Sbjct  419  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTEPQVFDPREPQPVKK  478

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DFKQTHFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW PVWEE
Sbjct  479  TLKVKVYMGDGWRMDFKQTHFDQYSPPDFYTRVGIAGVPADSVMKKTKAIEDNWMPVWEE  538

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF+FPLTVPE+ALLR+EVHEYDMSEKDDF GQT LPVSELRPGIRAV L +RKG  YN+V
Sbjct  539  EFSFPLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSELRPGIRAVALFDRKGNKYNNV  598

Query  204  RLLMRFTFV  178
            +LLMRF F 
Sbjct  599  KLLMRFEFA  607



>ref|XP_008666992.1| PREDICTED: phosphoinositide-specific phospholipase C isoform 
X1 [Zea mays]
 ref|XP_008666993.1| PREDICTED: phosphoinositide-specific phospholipase C isoform 
X1 [Zea mays]
 tpg|DAA41848.1| TPA: hypothetical protein ZEAMMB73_100644 [Zea mays]
Length=587

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   +VFDPR   PVKK
Sbjct  399  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTEPQVFDPREPQPVKK  458

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DFKQTHFD YSPPDFYTRVGIAGVPAD  M KT   EDNWTPVWE+
Sbjct  459  TLKVKVYMGDGWRMDFKQTHFDQYSPPDFYTRVGIAGVPADSVMKKTNAIEDNWTPVWEK  518

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF+FPLTVPELALLR+EVHEYDMSEKDDF GQT LPVSELRPGIRAV L +RKG  YN V
Sbjct  519  EFSFPLTVPELALLRVEVHEYDMSEKDDFGGQTVLPVSELRPGIRAVALFDRKGMKYNHV  578

Query  204  RLLMRFTFV  178
            +LLMRF F 
Sbjct  579  KLLMRFEFA  587



>ref|XP_006658176.1| PREDICTED: phosphoinositide phospholipase C 2-like [Oryza brachyantha]
Length=373

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 159/188 (85%), Gaps = 3/188 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   EVFDP+  L  KK
Sbjct  185  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQSEPEVFDPKKVLSPKK  244

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DFKQTHFD YSPPDFY RVGIAGVPAD  M KT+  EDNW PVWEE
Sbjct  245  TLKVKVYMGDGWRMDFKQTHFDQYSPPDFYARVGIAGVPADSVMKKTRAIEDNWVPVWEE  304

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF FPLTVPE+ALLR+EVHEYDMSEKDDF GQT LPVSEL PGIRAV L +RKG  Y +V
Sbjct  305  EFAFPLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSELLPGIRAVSLFDRKGNMYKNV  364

Query  204  RLLMRFTF  181
            +LLMRF F
Sbjct  365  KLLMRFEF  372



>ref|XP_010106259.1| Phosphoinositide phospholipase C 2 [Morus notabilis]
 gb|EXC09416.1| Phosphoinositide phospholipase C 2 [Morus notabilis]
Length=591

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMF +NGGCGYVKKP+FL+K     EVFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMHGMFTSNGGCGYVKKPEFLLKTGPHNEVFDPKAKLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF+ THFD YSPPDFYTR+GIAGVPAD  M KTK  EDNW P W
Sbjct  461  KTTLKVTVYMGEGWYYDFRHTHFDAYSPPDFYTRIGIAGVPADTVMKKTKTLEDNWIPAW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQ CLPVSELR GIRA+ L +RKGE Y 
Sbjct  521  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQACLPVSELRKGIRAIPLHDRKGEKYR  580

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  581  SVKLLMRFDFV  591



>ref|XP_004958809.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Setaria italica]
 ref|XP_004958810.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Setaria italica]
Length=601

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   EVFDPR   PVKK
Sbjct  413  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTEPEVFDPRERQPVKK  472

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVY+GDGW +DFKQTHFD YSPPDFY RVGIAGVPAD  M KT+  EDNW PVWEE
Sbjct  473  TLKVKVYLGDGWRMDFKQTHFDQYSPPDFYARVGIAGVPADSMMKKTRAIEDNWVPVWEE  532

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EFTFPLTVPE+ALLR+EVHEYDMSEKDDF GQT LPVSELRPGIRAV L +RKG  YN V
Sbjct  533  EFTFPLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSELRPGIRAVALFDRKGNQYNHV  592

Query  204  RLLMRFTFV  178
            +LLMRF FV
Sbjct  593  KLLMRFEFV  601



>ref|XP_010922549.1| PREDICTED: phosphoinositide phospholipase C 6-like [Elaeis guineensis]
Length=587

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM G FR NGGCGY+KKPDFL+K     ++FDP+ + PV
Sbjct  397  GWMHGAQMVAFNMQGYGRSLWLMHGFFRANGGCGYIKKPDFLLKAGPDGQLFDPKKSFPV  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMGDGW +DFKQTHFD YSPPDFYT+VGIAGVPAD  M KT+  ED+WTPVW
Sbjct  457  KTTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTKVGIAGVPADTVMKKTRTIEDDWTPVW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELA+LRIEV EYD+SEKDDF GQTCLP SELR GIRAV LC+RKG  + 
Sbjct  517  DEEFSFPLTVPELAVLRIEVCEYDISEKDDFGGQTCLPASELRSGIRAVPLCDRKGMKFK  576

Query  210  SVRLLMRFTFV  178
            SVRLLMRF FV
Sbjct  577  SVRLLMRFEFV  587



>ref|XP_009380683.1| PREDICTED: phosphoinositide phospholipase C 2-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGRSLWLM G ++ NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  403  GWIHGAQMVAFNMQGYGRSLWLMHGFYKANGGCGYVKKPDFLLSTGSNNEVFDPKAILPV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DFK+THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW PVW
Sbjct  463  KKTLKVKVYMGDGWSMDFKKTHFDPYSPPDFYTRVGIAGVPADATMKKTKAIEDNWIPVW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELA+LRIEVHEYDMSEKDDFAGQ CLPVSEL+PGIRAV L +RKG  + 
Sbjct  523  DEEFVFPLTVPELAVLRIEVHEYDMSEKDDFAGQNCLPVSELKPGIRAVPLLDRKGMKFK  582

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F 
Sbjct  583  SVKLLMRFEFA  593



>gb|AAW81960.1| phosphatidylinositol-specific phospholipase C 2 [Lilium davidii]
Length=543

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 161/194 (83%), Gaps = 5/194 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLW MQG +R NGGCGYVKKP FL+      EVF+P+A LP 
Sbjct  343  GWMHGAQMVAFNMQGFGRSLWRMQGFYRANGGCGYVKKPHFLLNNGPHGEVFNPKAKLPA  402

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KK LKVKVYMGDGW +DFK THFD YSPPDFYTRVGIAGVPAD  M KT+  ED+WTPVW
Sbjct  403  KKILKVKVYMGDGWRMDFKSTHFDTYSPPDFYTRVGIAGVPADCTMKKTRTIEDDWTPVW  462

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EE  FPLTVPELALLRIEVHEYDMS+KDDF GQTCLPVSEL+PGIRAV L  RKG  Y 
Sbjct  463  DEELVFPLTVPELALLRIEVHEYDMSDKDDFGGQTCLPVSELKPGIRAVPLFTRKGVKYR  522

Query  210  SVRLLMRFTFV*VC  169
            SVRLL+RF F+  C
Sbjct  523  SVRLLVRFEFLTDC  536



>ref|XP_008789094.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Phoenix dactylifera]
Length=601

 Score =   283 bits (725),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLM G ++ NGGCGYVKKPDFL+K     EVF P A LPV
Sbjct  411  GWMHGAQMVAFNMQGHGRSLWLMHGFYKANGGCGYVKKPDFLLKTGPNREVFHPTANLPV  470

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW  DF QTHFD YSPPDFYTRVGIAGVPAD  M KTK  ED+WTPVW
Sbjct  471  KKTLKVKVYMGDGWRKDFSQTHFDAYSPPDFYTRVGIAGVPADAVMKKTKAIEDDWTPVW  530

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIRAV L +RKG  + 
Sbjct  531  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRAVPLFDRKGMKFK  590

Query  210  SVRLLMRFTFV  178
            SV+LL+RF FV
Sbjct  591  SVKLLVRFEFV  601



>ref|XP_010920867.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Elaeis guineensis]
Length=592

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 162/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG GRSLWLM G ++ NGGCGYVKKPDFL+K     EVFD +A L V
Sbjct  402  GWMHGAQMVAFNMQGNGRSLWLMHGFYKANGGCGYVKKPDFLLKTGPKNEVFDHKANLRV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF QTHFD YSPPDFYTRVGIAGVP D  M KT+  ED+WTPVW
Sbjct  462  KRTLKVKVYMGDGWRMDFSQTHFDTYSPPDFYTRVGIAGVPRDSVMKKTRAIEDDWTPVW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIRAV L +RKG  + 
Sbjct  522  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRAVPLFDRKGMKFK  581

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  582  SVKLLMRFEFV  592



>ref|XP_008789093.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Phoenix dactylifera]
Length=602

 Score =   283 bits (725),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLM G ++ NGGCGYVKKPDFL+K     EVF P A LPV
Sbjct  412  GWMHGAQMVAFNMQGHGRSLWLMHGFYKANGGCGYVKKPDFLLKTGPNREVFHPTANLPV  471

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW  DF QTHFD YSPPDFYTRVGIAGVPAD  M KTK  ED+WTPVW
Sbjct  472  KKTLKVKVYMGDGWRKDFSQTHFDAYSPPDFYTRVGIAGVPADAVMKKTKAIEDDWTPVW  531

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIRAV L +RKG  + 
Sbjct  532  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRAVPLFDRKGMKFK  591

Query  210  SVRLLMRFTFV  178
            SV+LL+RF FV
Sbjct  592  SVKLLVRFEFV  602



>ref|XP_010920866.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Elaeis guineensis]
Length=593

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 162/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG GRSLWLM G ++ NGGCGYVKKPDFL+K     EVFD +A L V
Sbjct  403  GWMHGAQMVAFNMQGNGRSLWLMHGFYKANGGCGYVKKPDFLLKTGPKNEVFDHKANLRV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF QTHFD YSPPDFYTRVGIAGVP D  M KT+  ED+WTPVW
Sbjct  463  KRTLKVKVYMGDGWRMDFSQTHFDTYSPPDFYTRVGIAGVPRDSVMKKTRAIEDDWTPVW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELRPGIRAV L +RKG  + 
Sbjct  523  NEEFTFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRPGIRAVPLFDRKGMKFK  582

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  583  SVKLLMRFEFV  593



>ref|XP_011035945.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=588

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLW+MQGMFR NGGCG+VKKPDFL+K     EVFDP+A LPV
Sbjct  398  GWMHGAQMVAFNMQGHGRSLWMMQGMFRANGGCGFVKKPDFLLKSGPDGEVFDPKAKLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            +KTLKVK+YMG+GW+ DF  THFD YSPPDFY RVGIAGVPAD  M KT+  EDNW PVW
Sbjct  458  QKTLKVKIYMGEGWYYDFHHTHFDAYSPPDFYVRVGIAGVPADTGMKKTRTLEDNWIPVW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRA+ L +RKGE YN
Sbjct  518  DEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVRELREGIRALPLHDRKGEKYN  577

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  578  SVKLLVRLEFV  588



>ref|XP_008793309.1| PREDICTED: phosphoinositide phospholipase C 2-like [Phoenix dactylifera]
Length=597

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 161/189 (85%), Gaps = 4/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK----EVFDPRAtlpvk  568
            GWM+GAQMVA NMQGYGR+LWL+ GMFR NGGCGYVKKPDFL+      VFDP+ TLPVK
Sbjct  398  GWMYGAQMVALNMQGYGRALWLVHGMFRANGGCGYVKKPDFLLDNDPDHVFDPKGTLPVK  457

Query  567  ktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWE  388
            K LKV+VYMGDGW  DF  THFD YSPPDFYTRVGIAGVPAD  M +TK  EDNWTPVW+
Sbjct  458  KILKVRVYMGDGWRFDFHHTHFDTYSPPDFYTRVGIAGVPADTVMKRTKAIEDNWTPVWD  517

Query  387  EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNS  208
            E+F FPLTVPELALLRIEVHEYDMS+ DDFAGQTCLPVSELRPGIR+V LC+RKGE   S
Sbjct  518  EDFIFPLTVPELALLRIEVHEYDMSDTDDFAGQTCLPVSELRPGIRSVPLCDRKGETLKS  577

Query  207  VRLLMRFTF  181
            V+LLMRF F
Sbjct  578  VKLLMRFEF  586



>ref|XP_009772725.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana sylvestris]
Length=588

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  398  AWTHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPNNQIFDPEANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DFK THFD YSPPDFY ++GIAGVPAD  M KTK  EDNW P W
Sbjct  458  KTTLKVTVFMGEGWYYDFKHTHFDAYSPPDFYAKIGIAGVPADNVMKKTKTLEDNWIPTW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  518  DEKFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGEKYN  577

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  578  SVKLLMRFEFV  588



>ref|XP_009772724.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana sylvestris]
Length=589

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  399  AWTHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPNNQIFDPEANLPV  458

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DFK THFD YSPPDFY ++GIAGVPAD  M KTK  EDNW P W
Sbjct  459  KTTLKVTVFMGEGWYYDFKHTHFDAYSPPDFYAKIGIAGVPADNVMKKTKTLEDNWIPTW  518

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  519  DEKFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGEKYN  578

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  579  SVKLLMRFEFV  589



>ref|XP_002316212.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEF02383.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=587

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLW+MQGMFR NGGCG+VKKPDFL+K     EVFDP+A LPV
Sbjct  397  GWMHGAQMVAFNMQGYGRSLWMMQGMFRANGGCGFVKKPDFLLKSGPHGEVFDPKAKLPV  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            +KTLKVK+YMG+GW+ DF  THFD YSPPDFY RVGIAGVPAD  M KT+  EDNW PVW
Sbjct  457  QKTLKVKIYMGEGWYYDFHHTHFDAYSPPDFYVRVGIAGVPADTGMKKTRTLEDNWIPVW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVP+LALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE YN
Sbjct  517  DEGFEFPLTVPDLALLRIEVHEYDMSEKDDFGGQTCLPVRELREGIRAVPLHDRKGEKYN  576

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  577  SVKLLVRLEFV  587



>ref|XP_010937846.1| PREDICTED: phosphoinositide phospholipase C 2-like [Elaeis guineensis]
Length=590

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 159/189 (84%), Gaps = 4/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKEV----FDPRAtlpvk  568
            GWMHGAQMVA NMQGYGR+LWLM GMFR NGGCGYVKKPDFL+  V    FDP+A LPVK
Sbjct  399  GWMHGAQMVALNMQGYGRALWLMHGMFRANGGCGYVKKPDFLLDNVPDRFFDPKAALPVK  458

Query  567  ktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWE  388
            KTLKV+VYMGDGW  DF  THFD YSPPDFYTRVGIAGVPAD  M +T+  EDNWTPVW+
Sbjct  459  KTLKVRVYMGDGWRFDFHHTHFDTYSPPDFYTRVGIAGVPADTVMRRTRAVEDNWTPVWD  518

Query  387  EEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNS  208
            EEF F LTVPELALLR+EVHEYDMSEKDDFAGQTCLPV ELRPGIR V LC+RKGE   S
Sbjct  519  EEFEFRLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVWELRPGIRCVPLCDRKGETLKS  578

Query  207  VRLLMRFTF  181
            V+LLM F F
Sbjct  579  VKLLMHFEF  587



>ref|XP_003616636.1| Phosphoinositide phospholipase C [Medicago truncatula]
 gb|AES99594.1| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=589

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPDFL+      EVFDP+A LPV
Sbjct  399  GWIHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDFLLTTGPDNEVFDPKAKLPV  458

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DFK THFD YSPPDFY RVGIAGVP+D  M KT+  EDNW P W
Sbjct  459  KTTLKVTVYMGEGWYYDFKHTHFDQYSPPDFYARVGIAGVPSDSIMKKTRAIEDNWLPTW  518

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR G+RAV L ++KG+ YN
Sbjct  519  NEVFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGVRAVSLHSQKGDKYN  578

Query  210  SVRLLMRFTF  181
            SV+LLMRF F
Sbjct  579  SVKLLMRFEF  588



>ref|XP_006843548.1| hypothetical protein AMTR_s00007p00065880 [Amborella trichopoda]
 gb|ERN05223.1| hypothetical protein AMTR_s00007p00065880 [Amborella trichopoda]
Length=593

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKE-----VFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQG FR NGGCGYVKKPDFL+       VF+P+   PV
Sbjct  403  GWTHGAQMVAFNMQGYGRSLWLMQGFFRANGGCGYVKKPDFLLSNGPDDNVFNPKQKHPV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLK+KVYMGDGW LDF QTHFD YSPPDFYT+VGIAGVPAD  M KTK  ED+W+PVW
Sbjct  463  KKTLKIKVYMGDGWRLDFDQTHFDTYSPPDFYTKVGIAGVPADNIMKKTKAIEDDWSPVW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF+FPLTVPELALLRIEVHEYDMSEKDDF GQ CLPVSELRPGIRAV L ++KGE   
Sbjct  523  NEEFSFPLTVPELALLRIEVHEYDMSEKDDFGGQNCLPVSELRPGIRAVPLFDKKGEKLK  582

Query  210  SVRLLMRFTFV  178
            SV+LLM+F FV
Sbjct  583  SVKLLMQFEFV  593



>ref|XP_004490994.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cicer arietinum]
Length=588

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGYVKKPDFL++     EVFDP++ LPV
Sbjct  398  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFLLETGPDNEVFDPKSKLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DFK THFD YSPPDFY RVGIAGVP D  M KTK  EDNW P W
Sbjct  458  KTTLKVTVYMGEGWYYDFKHTHFDQYSPPDFYARVGIAGVPNDSIMRKTKAIEDNWLPTW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIR+V L ++KGE YN
Sbjct  518  NEVFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRSVSLHSQKGEKYN  577

Query  210  SVRLLMRFTF  181
            SV+LLMRF F
Sbjct  578  SVKLLMRFEF  587



>dbj|BAO02533.1| predicted phospholipase C ortholog [Nicotiana alata]
Length=588

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  398  AWTHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPDNQIFDPEANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DFK THFD YSPPDFY ++GIAGVPAD  M KTK  EDNW P W
Sbjct  458  KTTLKVTVFMGEGWYYDFKHTHFDAYSPPDFYAKIGIAGVPADNVMKKTKTLEDNWIPTW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E+F FPLTVPELALLR+E+HEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  518  NEKFEFPLTVPELALLRVEIHEYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGEKYN  577

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  578  SVKLLMRFEFV  588



>gb|EYU22355.1| hypothetical protein MIMGU_mgv1a003318mg [Erythranthe guttata]
Length=592

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 160/189 (85%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPDFL+K   EVFDPRATLPVK 
Sbjct  404  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDFLLKGGGEVFDPRATLPVKT  463

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TL+V VYMG+GW+ DF+ THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W+E
Sbjct  464  TLRVTVYMGEGWYYDFRHTHFDTYSPPDFYARVGIAGVPADVVMKKTKTLEDNWIPTWDE  523

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
             F FPLTVPELALLRIEVHEYDMSEKDDFAGQ  LP+SELR GIRAV L + KG  YNSV
Sbjct  524  VFEFPLTVPELALLRIEVHEYDMSEKDDFAGQISLPISELREGIRAVPLHSHKGVRYNSV  583

Query  204  RLLMRFTFV  178
            +LLMRF F+
Sbjct  584  KLLMRFQFI  592



>emb|CAM92313.1| phospholipase C [Vigna radiata]
Length=591

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 162/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     EVFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLLKTGLNNEVFDPKARLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV +YMG+GW  DFK THFD YSPPDFY RVGIAGVP D  M KTK  EDNW+P W
Sbjct  461  KKTLKVTIYMGEGWFHDFKHTHFDQYSPPDFYARVGIAGVPYDTVMKKTKSVEDNWSPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  521  NEEFKFPLSVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRKGEKYH  580

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  581  NVKLLMRFEFI  591



>emb|CAK32509.1| phospholipase C [Vigna radiata]
 emb|CAL59449.1| phospholipase C [Vigna radiata]
Length=591

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 162/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     EVFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLLKTGLNNEVFDPKARLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV +YMG+GW  DFK THFD YSPPDFY RVGIAGVP D  M KTK  EDNW+P W
Sbjct  461  KKTLKVTIYMGEGWFHDFKHTHFDQYSPPDFYARVGIAGVPYDTVMKKTKSVEDNWSPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  521  NEEFKFPLSVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRKGEKYH  580

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  581  NVKLLMRFEFI  591



>gb|AAQ95730.1| phospholipase C [Vigna radiata]
Length=591

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 162/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     EVFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLLKTGLNNEVFDPKARLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV +YMG+GW  DFK THFD YSPPDFY RVGIAGVP D  M KTK  EDNW+P W
Sbjct  461  KKTLKVTIYMGEGWFHDFKHTHFDQYSPPDFYARVGIAGVPYDTVMKKTKSVEDNWSPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  521  NEEFKFPLSVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRKGEKYH  580

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  581  NVKLLMRFEFI  591



>emb|CAK32510.1| phospholipase C [Vigna radiata]
 gb|AIM62180.1| phospholipase C [Vigna radiata]
Length=591

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 162/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     EVFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLLKTGLNNEVFDPKARLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV +YMG+GW  DFK THFD YSPPDFY RVGIAGVP D  M KTK  EDNW+P W
Sbjct  461  KKTLKVTIYMGEGWFHDFKHTHFDQYSPPDFYARVGIAGVPYDTVMKKTKSVEDNWSPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  521  NEEFKFPLSVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRKGEKYH  580

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  581  NVKLLMRFEFI  591



>ref|XP_011076692.1| PREDICTED: phosphoinositide phospholipase C 2-like [Sesamum indicum]
Length=587

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLM GMF+ NGGCGYVKKP+FL++      VFDP+A LPV
Sbjct  397  GWSHGAQMVAFNMQGYGRSLWLMHGMFKANGGCGYVKKPEFLLQADSNGNVFDPKAILPV  456

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DFK THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  457  KTTLRVTVYMGEGWYYDFKHTHFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDNWIPTW  516

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPV ELR GIRAV L +RKGE YN
Sbjct  517  DEVFEFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVRELRQGIRAVPLHSRKGEKYN  576

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  577  SVKLLMRFEFV  587



>ref|XP_009120385.1| PREDICTED: phosphoinositide phospholipase C 4 [Brassica rapa]
Length=589

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQGYGR+LWLMQGMFR NGGCGYVKKPDFL+      EVFDP      
Sbjct  399  GWMSGAQMIAFNMQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGEVFDPNENSHP  458

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGWHLDFK+THFD YSPPDFY RVGIAG PAD+ M KT+ K + WTP+W
Sbjct  459  KKTLKVKVLMGDGWHLDFKKTHFDRYSPPDFYVRVGIAGAPADKAMEKTEVKYNTWTPIW  518

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTF LTVPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKG  YN
Sbjct  519  NEEFTFQLTVPELALLRVEVHEYDNNEKDDFGGQTCLPVSELRQGIRAVPLFNRKGVKYN  578

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  579  STRLLMRFEFV  589



>ref|XP_002269949.1| PREDICTED: phosphoinositide phospholipase C 2 [Vitis vinifera]
 emb|CAN64084.1| hypothetical protein VITISV_006935 [Vitis vinifera]
Length=593

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKE-----VFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLW+M GMF+ NGGCGYVKKPDFL+       VFDP+A LPV
Sbjct  403  GWMHGAQMVAFNMQGYGRSLWIMHGMFKANGGCGYVKKPDFLLNNGSHDGVFDPKAKLPV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF+ THFD YSPPDFY RVGIAGVPAD  M KTK  EDNWTP W
Sbjct  463  KTTLKVTVYMGEGWYFDFRHTHFDAYSPPDFYARVGIAGVPADTIMKKTKTLEDNWTPNW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKG+ Y 
Sbjct  523  DEHFEFPLTVPELALLRVEVHEYDMSEKDDFGGQTCLPVSELRRGIRAVPLFSRKGDKYP  582

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  583  SVKLLMRFEFV  593



>gb|ABC50164.1| phospholipase C [Petunia integrifolia subsp. inflata]
Length=588

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+K     EVFDP A LPV
Sbjct  398  AWTHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDILLKAGPNNEVFDPEANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DF  THFD YSPPDFY ++GIAGVPAD  M KTK  EDNW P W
Sbjct  458  KTTLKVTVFMGEGWYYDFDHTHFDAYSPPDFYAKIGIAGVPADNVMKKTKTLEDNWIPNW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPV+ELR GIRAV L NRKGE YN
Sbjct  518  DETFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVAELRQGIRAVALHNRKGEKYN  577

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  578  SVKLLMRFEFI  588



>ref|XP_007008968.1| Phospholipase C 2 [Theobroma cacao]
 gb|EOY17778.1| Phospholipase C 2 [Theobroma cacao]
Length=586

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 156/190 (82%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMF+ NGGCGYVKKPDFL+K     +VFDP   LPV
Sbjct  392  GWMHGAQMVAFNMQGYGRSLWLMHGMFKANGGCGYVKKPDFLLKSGPHDDVFDPSVRLPV  451

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K  LKV VYMG+GW+ DF  THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  452  KTVLKVTVYMGEGWYHDFHHTHFDAYSPPDFYARVGIAGVPADNVMKKTKTLEDNWVPSW  511

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKG+ YN
Sbjct  512  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRAVPLNSRKGDKYN  571

Query  210  SVRLLMRFTF  181
            SV+LLMRF  
Sbjct  572  SVKLLMRFEL  581



>emb|CDY71544.1| BnaUnng04440D, partial [Brassica napus]
Length=487

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQGYGR+LWLMQGMFR NGGCGYVKKPDFL+      +VFDP      
Sbjct  297  GWMSGAQMIAFNMQGYGRALWLMQGMFRANGGCGYVKKPDFLMSVGPNGQVFDPNENSSP  356

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGWHLDFK+THFDLYSPPDFY RVGIAG PADE M KT+ K D WTP+W
Sbjct  357  KKTLKVKVLMGDGWHLDFKKTHFDLYSPPDFYVRVGIAGAPADETMEKTEVKYDTWTPIW  416

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EFTF LTVPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKG  Y+
Sbjct  417  NQEFTFKLTVPELALLRVEVHEYDANEKDDFGGQTCLPVSELRQGIRAVPLFNRKGVKYS  476

Query  210  SVRLLMRFTFV  178
              RLLMRF FV
Sbjct  477  CTRLLMRFDFV  487



>ref|NP_001275400.1| phosphoinositide phospholipase C 2-like [Solanum tuberosum]
 emb|CAA63954.1| phosphoinositide-specific phospholipase C [Solanum tuberosum]
Length=585

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+K     EVFDP A LPV
Sbjct  395  AWTHGAQMVAFNMQGYGRSLWLMHGMFRGNGGCGYVKKPDILLKAGPNNEVFDPEANLPV  454

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DF+ THFD YSPPDFY R+GIAGV AD  M KTK  EDNW P W
Sbjct  455  KTTLKVTVFMGEGWYYDFEHTHFDAYSPPDFYARIGIAGVDADIVMKKTKTLEDNWIPTW  514

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L NRKGE YN
Sbjct  515  DEQFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVPLHNRKGEKYN  574

Query  210  SVRLLMRFTFV  178
            SV+LL+RF F+
Sbjct  575  SVKLLLRFEFI  585



>gb|KDP44772.1| hypothetical protein JCGZ_01272 [Jatropha curcas]
Length=361

 Score =   271 bits (694),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 155/189 (82%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GWMHGAQM+AFNMQGYG+SLWLM GMFR NGGCGY+KKPDFL+    +VFDP+  L V K
Sbjct  173  GWMHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYLKKPDFLMHKGPDVFDPKRALSVIK  232

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVY+GDGW LDF  THFD YSPPDFYT++ I GVPAD    KTK   DNW P W E
Sbjct  233  TLKVKVYLGDGWRLDFSHTHFDAYSPPDFYTKLYIVGVPADAAKKKTKIICDNWVPAWNE  292

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EFTFPLTVPELALLRIE+ EYDMSEKDDF GQTCLPV ELRPGIR+V L +RKGE +N+ 
Sbjct  293  EFTFPLTVPELALLRIEIREYDMSEKDDFGGQTCLPVPELRPGIRSVPLHDRKGERFNNT  352

Query  204  RLLMRFTFV  178
            RLLM+F FV
Sbjct  353  RLLMKFEFV  361



>ref|XP_009387528.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=590

 Score =   278 bits (712),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGRSLWLM G ++ NGGCGYVKKPDFL++     +VFDP+A LPV
Sbjct  400  GWIHGAQMVAFNMQGYGRSLWLMHGFYKGNGGCGYVKKPDFLLEHGSDNDVFDPKADLPV  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWH DFKQTHFD YSPPDFYTRVGIAGVPAD  M KTK  EDNWTPVW
Sbjct  460  KKTLKVKVYMGDGWHADFKQTHFDSYSPPDFYTRVGIAGVPADTTMKKTKAVEDNWTPVW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEVHE+D S KDDFAGQ CLP+SELR G RAV L +RKG  + 
Sbjct  520  DEEFIFPLTVPELALLRIEVHEHDKSGKDDFAGQICLPISELRRGFRAVPLFDRKGMKFK  579

Query  210  SVRLLMRFTFV  178
            SVR+LMRF FV
Sbjct  580  SVRVLMRFEFV  590



>ref|XP_009387519.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=593

 Score =   278 bits (712),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGRSLWLM G ++ NGGCGYVKKPDFL++     +VFDP+A LPV
Sbjct  403  GWIHGAQMVAFNMQGYGRSLWLMHGFYKGNGGCGYVKKPDFLLEHGSDNDVFDPKADLPV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWH DFKQTHFD YSPPDFYTRVGIAGVPAD  M KTK  EDNWTPVW
Sbjct  463  KKTLKVKVYMGDGWHADFKQTHFDSYSPPDFYTRVGIAGVPADTTMKKTKAVEDNWTPVW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEVHE+D S KDDFAGQ CLP+SELR G RAV L +RKG  + 
Sbjct  523  DEEFIFPLTVPELALLRIEVHEHDKSGKDDFAGQICLPISELRRGFRAVPLFDRKGMKFK  582

Query  210  SVRLLMRFTFV  178
            SVR+LMRF FV
Sbjct  583  SVRVLMRFEFV  593



>emb|CDY52122.1| BnaA10g29510D [Brassica napus]
Length=589

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQGYGR+LWLMQGMFR NGGCGYVKKPDFL+      EVFDP      
Sbjct  399  GWMSGAQMIAFNMQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGEVFDPNENSHP  458

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGWHLDFK+THFD YSPPDFY RVGIAG PAD+ M KT+ K + WTP+W
Sbjct  459  KKTLKVKVLMGDGWHLDFKKTHFDRYSPPDFYVRVGIAGAPADKAMEKTEVKYNTWTPIW  518

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTF LTVPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKG  Y+
Sbjct  519  NEEFTFQLTVPELALLRVEVHEYDNNEKDDFGGQTCLPVSELRQGIRAVPLFNRKGVKYS  578

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  579  STRLLMRFEFV  589



>ref|XP_008805482.1| PREDICTED: phosphoinositide phospholipase C 6-like [Phoenix dactylifera]
Length=597

 Score =   278 bits (712),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM G FR NGGCGY+KK DFL+K     + FDP+ T PV
Sbjct  407  GWMHGAQMVAFNMQGYGRSLWLMHGFFRANGGCGYIKKADFLLKAGLDGQAFDPKKTFPV  466

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DFKQTHFD YSPPDFYT+VGIAGVPAD    KT+  ED+WTPVW
Sbjct  467  KKTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTKVGIAGVPADTVTKKTRTIEDDWTPVW  526

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLR+EVHEYD SEKDDF GQTCLPVSELR GIRAV L +RKG  + 
Sbjct  527  DEEFSFPLTVPELALLRVEVHEYDFSEKDDFGGQTCLPVSELRSGIRAVPLYDRKGMKFK  586

Query  210  SVRLLMRFTFV  178
            SV+LLMRF  V
Sbjct  587  SVKLLMRFESV  597



>ref|XP_009387536.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=592

 Score =   278 bits (711),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGRSLWLM G ++ NGGCGYVKKPDFL++     +VFDP+A LPV
Sbjct  402  GWIHGAQMVAFNMQGYGRSLWLMHGFYKGNGGCGYVKKPDFLLEHGSDNDVFDPKADLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGWH DFKQTHFD YSPPDFYTRVGIAGVPAD  M KTK  EDNWTPVW
Sbjct  462  KKTLKVKVYMGDGWHADFKQTHFDSYSPPDFYTRVGIAGVPADTTMKKTKAVEDNWTPVW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEVHE+D S KDDFAGQ CLP+SELR G RAV L +RKG  + 
Sbjct  522  DEEFIFPLTVPELALLRIEVHEHDKSGKDDFAGQICLPISELRRGFRAVPLFDRKGMKFK  581

Query  210  SVRLLMRFTFV  178
            SVR+LMRF FV
Sbjct  582  SVRVLMRFEFV  592



>gb|ABJ99758.1| phospholipase C [Nicotiana tabacum]
Length=588

 Score =   278 bits (711),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  398  AWTHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPNNQIFDPEANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DF  THFD YSPPDFY ++GIAGVPAD  M KT+  EDNW P W
Sbjct  458  KTTLKVTVFMGEGWYYDFNHTHFDAYSPPDFYAKIGIAGVPADNVMKKTRTLEDNWIPTW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  518  DEKFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGEKYN  577

Query  210  SVRLLMRFTFV  178
            SV+LLMRF +V
Sbjct  578  SVKLLMRFEYV  588



>ref|XP_009605158.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana tomentosiformis]
Length=588

 Score =   278 bits (710),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  398  AWTHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPNNQIFDPEANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DF  THFD YSPPDFY ++GIAGVPAD  M KT+  EDNW P W
Sbjct  458  KTTLKVTVFMGEGWYYDFNHTHFDAYSPPDFYAKIGIAGVPADNVMKKTRTLEDNWIPTW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  518  DEKFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGEKYN  577

Query  210  SVRLLMRFTFV  178
            SV+LLMRF +V
Sbjct  578  SVKLLMRFEYV  588



>ref|XP_009605157.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=589

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  399  AWTHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPNNQIFDPEANLPV  458

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DF  THFD YSPPDFY ++GIAGVPAD  M KT+  EDNW P W
Sbjct  459  KTTLKVTVFMGEGWYYDFNHTHFDAYSPPDFYAKIGIAGVPADNVMKKTRTLEDNWIPTW  518

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  519  DEKFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGEKYN  578

Query  210  SVRLLMRFTFV  178
            SV+LLMRF +V
Sbjct  579  SVKLLMRFEYV  589



>ref|XP_010535594.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Tarenaya hassleriana]
Length=479

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQG+GRSLW+MQGM+R NGGCGYVKKP  L+K     +VFDP+ATLP 
Sbjct  289  GWSHGAQMVAFNMQGHGRSLWVMQGMYRANGGCGYVKKPHILLKSSPNNDVFDPKATLPQ  348

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  349  KTTLRVTVYMGEGWYYDFRHTHFDQYSPPDFYTRVGIAGVPADSVMKKTKTLEDNWIPSW  408

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L NRKGE Y 
Sbjct  409  DEAFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRQGIRAVPLHNRKGEKYK  468

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  469  SVKLLMRFEFV  479



>emb|CAM92314.1| phospholipase C [Vigna radiata]
Length=591

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     EVFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLLKTGLNNEVFDPKARLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV +YMG+GW  DFK THFD YSPPDFY RVGIAGVP D  M KTK  EDNW+P W
Sbjct  461  KKTLKVTIYMGEGWFQDFKHTHFDQYSPPDFYARVGIAGVPYDTVMKKTKSVEDNWSPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  521  NEEFKFPLSVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRKGEKYH  580

Query  210  SVRLLMRFTFV  178
            +V+L MRF F+
Sbjct  581  NVKLQMRFEFI  591



>gb|KHG14938.1| Phosphoinositide phospholipase C 2 -like protein [Gossypium arboreum]
Length=578

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 157/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GWMHG QMVAFNMQG+GRSLWLM GMF+ NGGCGYVKKPDFL+   EVFDP+  LPVK T
Sbjct  391  GWMHGVQMVAFNMQGHGRSLWLMHGMFKANGGCGYVKKPDFLLNSMEVFDPKIKLPVKTT  450

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKV VYMG+GW+ DF  THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W E 
Sbjct  451  LKVTVYMGEGWYYDFHHTHFDAYSPPDFYTRVGIAGVPADSVMKKTKILEDNWLPSWNEV  510

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLP+SELR GIRAV L +RKGE YNSV+
Sbjct  511  FEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPISELRSGIRAVPLYSRKGEKYNSVK  570

Query  201  LLMRFTFV  178
            LLM F F+
Sbjct  571  LLMHFEFI  578



>ref|XP_008233758.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Prunus mume]
Length=591

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLW+MQGMFR NGGCGYVKKPDFL+K     EVFDP+  LPV
Sbjct  401  GWSHGAQMVAFNMQGYGRSLWVMQGMFRANGGCGYVKKPDFLLKTGPHNEVFDPKYKLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVY+G+GW+ DFK THFD YSPPDFY RVGIAGV AD  M KTK  ED+W P W
Sbjct  461  KTTLKVKVYVGEGWYYDFKHTHFDAYSPPDFYARVGIAGVAADSVMKKTKTLEDDWIPAW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELA+LRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKGE Y 
Sbjct  521  DEEFEFPLTVPELAVLRIEVHEYDMSEKDDFGGQTCLPVSELRKGIRAVPLHSRKGEKYK  580

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  581  SVKLLMHFEFV  591



>ref|XP_008233757.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Prunus mume]
Length=592

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLW+MQGMFR NGGCGYVKKPDFL+K     EVFDP+  LPV
Sbjct  402  GWSHGAQMVAFNMQGYGRSLWVMQGMFRANGGCGYVKKPDFLLKTGPHNEVFDPKYKLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVY+G+GW+ DFK THFD YSPPDFY RVGIAGV AD  M KTK  ED+W P W
Sbjct  462  KTTLKVKVYVGEGWYYDFKHTHFDAYSPPDFYARVGIAGVAADSVMKKTKTLEDDWIPAW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELA+LRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKGE Y 
Sbjct  522  DEEFEFPLTVPELAVLRIEVHEYDMSEKDDFGGQTCLPVSELRKGIRAVPLHSRKGEKYK  581

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  582  SVKLLMHFEFV  592



>ref|XP_010920865.1| PREDICTED: phosphoinositide phospholipase C 2-like [Elaeis guineensis]
Length=588

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 161/189 (85%), Gaps = 4/189 (2%)
 Frame = -2

Query  732  WMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKE----VFDPRAtlpvkk  565
            WM+GAQMVA NMQGYGR+LWL+ GMFR NGGCGYVKKPDFL+      VF+P+ TLPVKK
Sbjct  400  WMYGAQMVALNMQGYGRALWLVHGMFRANGGCGYVKKPDFLLDNDPDNVFNPKVTLPVKK  459

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKV+VYMGDGW  DF  THFD YSPPDFYTRVGIAGVPAD  M +TK  EDNWTPVW+E
Sbjct  460  TLKVRVYMGDGWRFDFHLTHFDTYSPPDFYTRVGIAGVPADTTMKRTKAIEDNWTPVWDE  519

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF FPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPV ELRPGIR+V LC+RKGE   SV
Sbjct  520  EFEFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVWELRPGIRSVPLCDRKGETLKSV  579

Query  204  RLLMRFTFV  178
            +LLM F F+
Sbjct  580  KLLMHFEFI  588



>emb|CDY32691.1| BnaA02g07530D [Brassica napus]
Length=594

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQGYGR+LWLMQGMFR NGGCGYVKKPDFL+      +VFDP      
Sbjct  404  GWMSGAQMIAFNMQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGQVFDPNENSSP  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGWHLDFK+THFDLYSPPDFY RVGIAG PADE M KT+ K D WTP+W
Sbjct  464  KKTLKVKVLMGDGWHLDFKKTHFDLYSPPDFYVRVGIAGAPADETMEKTEVKYDTWTPIW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EFTF LTVPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKG  Y+
Sbjct  524  NQEFTFKLTVPELALLRVEVHEYDANEKDDFGGQTCLPVSELRQGIRAVSLFNRKGVKYS  583

Query  210  SVRLLMRFTFV  178
              RLLMRF FV
Sbjct  584  CTRLLMRFDFV  594



>gb|EMT14453.1| Phosphoinositide phospholipase C 2 [Aegilops tauschii]
Length=486

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   EVFDP+   PVKK
Sbjct  298  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQSEPEVFDPKKPQPVKK  357

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DFKQTHFD YSPPDFY RVGIAGVPAD  M KTK  EDNW PVW E
Sbjct  358  TLKVKVYMGDGWRMDFKQTHFDQYSPPDFYARVGIAGVPADSVMKKTKAVEDNWVPVWGE  417

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF+F LTVPELALLR+E HEYDMSEKDDFAGQT LPVSEL+PGIRAV L +RKG  + +V
Sbjct  418  EFSFDLTVPELALLRVEAHEYDMSEKDDFAGQTVLPVSELQPGIRAVALFDRKGNKFPNV  477

Query  204  RLLMRFTFV  178
            +LLMRF FV
Sbjct  478  KLLMRFEFV  486



>gb|KDO68973.1| hypothetical protein CISIN_1g007399mg [Citrus sinensis]
Length=374

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQG+GRSLWLM GMFR NGGCGYVKKP+FL++     EVFDP+  LP 
Sbjct  184  GWSHGAQMVAFNMQGHGRSLWLMHGMFRANGGCGYVKKPNFLLQTGPHNEVFDPKVKLPA  243

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV VYMG+GW+ DF  THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  244  KKTLKVTVYMGEGWYYDFPHTHFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDNWIPSW  303

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPVSEL+ GIRAV L +RKGE Y 
Sbjct  304  NEEFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELKQGIRAVPLHDRKGERYK  363

Query  210  SVRLLMRFTFV  178
            SV+LLM F F+
Sbjct  364  SVKLLMHFEFI  374



>ref|XP_007220553.1| hypothetical protein PRUPE_ppa003223mg [Prunus persica]
 gb|EMJ21752.1| hypothetical protein PRUPE_ppa003223mg [Prunus persica]
Length=591

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLW+MQGMFR N GCGYVKKPDFL+K     EVFDP+  LPV
Sbjct  401  GWSHGAQMVAFNMQGYGRSLWVMQGMFRANSGCGYVKKPDFLLKTGPHNEVFDPKYKLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMG+GW+ DFK THFD YSPPDFY RVGIAGV AD  M KTK  ED+W P W
Sbjct  461  KTTLKVKVYMGEGWYYDFKHTHFDAYSPPDFYARVGIAGVAADSVMKKTKTLEDDWIPAW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELA+LRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RKGE Y 
Sbjct  521  DEEFEFPLTVPELAVLRIEVHEYDMSEKDDFGGQTCLPVSELRKGIRAVPLHSRKGEKYK  580

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  581  SVKLLMHFEFV  591



>ref|XP_010534599.1| PREDICTED: phosphoinositide phospholipase C 2 [Tarenaya hassleriana]
Length=582

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQG+GRSLWLMQGMFR NGGCGYV+KPD L+K     +VFDP+ATL  
Sbjct  392  GWSHGAQMVAFNMQGHGRSLWLMQGMFRANGGCGYVRKPDILLKSGPNDDVFDPKATLHP  451

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  452  KTTLRVTVYMGEGWYYDFRHTHFDQYSPPDFYTRVGIAGVPADSIMKKTKTLEDNWIPAW  511

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRA+ L NRKGE Y 
Sbjct  512  DEVFEFPLTVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRQGIRAIPLHNRKGEKYK  571

Query  210  SVRLLMRFTFV  178
            SV+LLM+F FV
Sbjct  572  SVKLLMKFEFV  582



>ref|XP_004149233.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cucumis sativus]
 ref|XP_004163786.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cucumis sativus]
 gb|KGN50656.1| hypothetical protein Csa_5G203390 [Cucumis sativus]
Length=599

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVA NMQGYGRSLW+M GMFR NGGCGYVKKPDF++K     E+FDPR  L V
Sbjct  409  GWTHGAQMVALNMQGYGRSLWIMHGMFRANGGCGYVKKPDFILKPGSDDEIFDPRVRLTV  468

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF  THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  469  KTTLKVTVYMGEGWYYDFHHTHFDAYSPPDFYTRVGIAGVPADTIMKKTKTLEDNWVPAW  528

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L + KGE Y 
Sbjct  529  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRRGIRAVPLHSVKGEKYK  588

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  589  SVKLLMGFEFV  599



>ref|NP_001234190.1| PI-phospholipase C PLC3 [Solanum lycopersicum]
 gb|ABW81001.1| PI-phospholipase C PLC3 [Solanum lycopersicum]
Length=583

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+K     +VFDP A+LPV
Sbjct  393  AWTHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDILLKAGPSNQVFDPEASLPV  452

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DF+ THFD YSPPDFY R+GIAGV AD  M KTK  EDNW P W
Sbjct  453  KTTLKVTVFMGEGWYYDFEHTHFDAYSPPDFYARIGIAGVDADIVMKKTKTLEDNWIPTW  512

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKG+ YN
Sbjct  513  DEQFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVPLHSRKGDKYN  572

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  573  SVKLLMRFEFI  583



>ref|XP_009344939.1| PREDICTED: phosphoinositide phospholipase C 2-like [Pyrus x bretschneideri]
Length=592

 Score =   276 bits (707),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGYVKKPDFL+K     EVFDP+  LPV
Sbjct  402  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFLLKSGPHNEVFDPKYDLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMG+GW+ DFK THFD YSPPDFY RVGIAGV AD  M KTK  ED+W P W
Sbjct  462  KQTLKVKVYMGEGWYYDFKHTHFDAYSPPDFYARVGIAGVAADSVMKKTKTLEDDWIPAW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELA+LRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L ++KGE Y 
Sbjct  522  NEEFEFPLTVPELAVLRIEVHEYDMSEKDDFGGQTCLPVSELRRGIRAVPLHSQKGEKYK  581

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  582  SVKLLMHFDFV  592



>emb|CDP14020.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   276 bits (705),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 158/189 (84%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GWMHGAQMVA NMQGYGRSLW+M+GMFR NGGCGYV+KPD L+K   E+FDP+A L VK 
Sbjct  401  GWMHGAQMVALNMQGYGRSLWVMRGMFRANGGCGYVRKPDILLKTGNEIFDPKAKLTVKT  460

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKV V+MG+GW+ DF+ THFD YSPPDFY RVGIAGVPAD  M KT+  EDNW P W E
Sbjct  461  TLKVTVFMGEGWYYDFRHTHFDTYSPPDFYARVGIAGVPADTLMKKTRTLEDNWIPNWNE  520

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
             F FPLTVPELALLRIEVHEYDMS+KDDF GQTCLPVSELR GIRAV L N+KGE Y SV
Sbjct  521  HFEFPLTVPELALLRIEVHEYDMSDKDDFGGQTCLPVSELREGIRAVPLHNQKGEPYRSV  580

Query  204  RLLMRFTFV  178
            +LLMRF F+
Sbjct  581  KLLMRFQFI  589



>dbj|BAD95335.1| phosphoinositide specific phospholipase C [Arabidopsis thaliana]
Length=263

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  73   GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDLLLKSGSDSDIFDPKATLPV  132

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  133  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPGDTVMKKTKTLEDNWIPAW  192

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL  GIRA  L +RKGE Y 
Sbjct  193  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELSEGIRAFPLHSRKGEKYK  252

Query  210  SVRLLMRFTFV  178
            SV+LL++  FV
Sbjct  253  SVKLLVKVEFV  263



>ref|XP_010535516.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Tarenaya hassleriana]
Length=583

 Score =   275 bits (704),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQG+GRSLW+MQGM+R NGGCGYVKKP  L+K     +VFDP+ATLP 
Sbjct  393  GWSHGAQMVAFNMQGHGRSLWVMQGMYRANGGCGYVKKPHILLKSSPNNDVFDPKATLPQ  452

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  453  KTTLRVTVYMGEGWYYDFRHTHFDQYSPPDFYTRVGIAGVPADSVMKKTKTLEDNWIPSW  512

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L NRKGE Y 
Sbjct  513  DEAFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRQGIRAVPLHNRKGEKYK  572

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  573  SVKLLMRFEFV  583



>ref|XP_009126743.1| PREDICTED: phosphoinositide phospholipase C 4 [Brassica rapa]
Length=594

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQGYGR+LWLMQGMFR NGGCGYVKKPDFL+      +VFDP      
Sbjct  404  GWMSGAQMIAFNMQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGQVFDPNENSSP  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGWHLDFK+THFDLYSPPDFY RVGI+G PADE M KT+ K D WTP+W
Sbjct  464  KKTLKVKVLMGDGWHLDFKKTHFDLYSPPDFYVRVGISGAPADETMEKTEVKYDTWTPIW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EFTF LTVPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKG  Y+
Sbjct  524  NQEFTFKLTVPELALLRVEVHEYDANEKDDFGGQTCLPVSELRQGIRAVPLFNRKGVKYS  583

Query  210  SVRLLMRFTFV  178
              RLLMRF FV
Sbjct  584  CTRLLMRFDFV  594



>ref|XP_009133410.1| PREDICTED: phosphoinositide phospholipase C 6-like [Brassica 
rapa]
Length=612

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 158/190 (83%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL+K     EVFDP+  L V
Sbjct  422  GWTHGAQMIAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPKKKLHV  481

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW LDF  THFD YSPPDFYT+V I GVPAD    KT+  EDNW P+W
Sbjct  482  KETLKVKVYMGDGWRLDFSHTHFDTYSPPDFYTKVFIVGVPADNAKRKTRVIEDNWYPIW  541

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  542  DEEFSFPLTVPELALLRIEVREYDMSDKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  601

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  602  SVRLLMRFIF  611



>gb|ABM90640.1| phospholipase C [Torenia fournieri]
Length=601

 Score =   276 bits (705),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQ +GRSLWLMQG+FR NGGCGYVKKPDFL++     EVFDP+A LPV
Sbjct  411  GWVHGAQMVAFNMQTHGRSLWLMQGIFRANGGCGYVKKPDFLLRVGPHNEVFDPKAHLPV  470

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV+MG+GW+LDF +THFDLYSPPDFY ++GIAGVP+D  M KTK  EDNW PVW
Sbjct  471  KKTLKVKVHMGEGWNLDFSRTHFDLYSPPDFYVKIGIAGVPSDTVMKKTKVVEDNWAPVW  530

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHE DMS+KDDF GQTCLPVSELR GIR+V L + KGE Y 
Sbjct  531  NEEFEFPLTVPELALLRIEVHESDMSDKDDFGGQTCLPVSELRKGIRSVPLYDHKGEKYK  590

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F 
Sbjct  591  SVKLLMRFHFT  601



>gb|ADR00313.1| phosphoinositide-specific phospholipase C1 [Triticum aestivum]
Length=506

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 160/189 (85%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   EVFDP+   PVKK
Sbjct  318  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQSEPEVFDPKKPQPVKK  377

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DFKQTHFD YSPPDFY RVGIAGVPAD  M KTK  EDNW PVW E
Sbjct  378  TLKVKVYMGDGWRMDFKQTHFDQYSPPDFYARVGIAGVPADSVMKKTKAVEDNWVPVWGE  437

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF+F LTVPELALLR+E HEYDMSEKDDFAGQT LPVSEL+PGIRAV L +RKG    +V
Sbjct  438  EFSFDLTVPELALLRVEAHEYDMSEKDDFAGQTVLPVSELQPGIRAVALFDRKGNKLPNV  497

Query  204  RLLMRFTFV  178
            +LLMRF FV
Sbjct  498  KLLMRFEFV  506



>gb|AAN75042.1| phosphoinositide-specific phospholipase C 8 [Arabidopsis thaliana]
Length=544

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  354  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKLPV  413

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  414  KETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNAKKKTKIIEDNWYPIW  473

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPV+ELRPGIR+V L ++KGE   
Sbjct  474  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVAELRPGIRSVPLYDKKGEKMK  533

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  534  SVRLLMRFIF  543



>ref|XP_007141766.1| hypothetical protein PHAVU_008G224000g [Phaseolus vulgaris]
 gb|ESW13760.1| hypothetical protein PHAVU_008G224000g [Phaseolus vulgaris]
Length=599

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLMQGMFR NGGCGYVKKP+FL++     EVFDP+A LPV
Sbjct  408  GWMHGAQMVAFNMQGHGRSLWLMQGMFRANGGCGYVKKPEFLLETGPDNEVFDPKAKLPV  467

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K  LKV VYMG+GW+ DFK THFD YSPPDFYTRVGIAGV +D  M KT+  EDNW P W
Sbjct  468  KTILKVTVYMGEGWYYDFKHTHFDQYSPPDFYTRVGIAGVSSDTVMKKTRAIEDNWLPTW  527

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPLTVPELALLRIEVHEYDMSEKDDF GQTC+P+ ELR GIRA+ L ++KGE Y 
Sbjct  528  NETFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCIPIRELRSGIRAIPLYSQKGEKYA  587

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  588  SVKLLMRFEFI  598



>gb|EYU22354.1| hypothetical protein MIMGU_mgv1a001900mg [Erythranthe guttata]
Length=741

 Score =   278 bits (712),  Expect = 1e-84, Method: Composition-based stats.
 Identities = 138/190 (73%), Positives = 157/190 (83%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M G+FR NGGCGY KKPD L +     EVFDP++TL V
Sbjct  551  GWMHGAQMVAFNMQGYGKSLWMMHGLFRANGGCGYFKKPDLLTRRGPNDEVFDPKSTLAV  610

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV VYMGDGW LDF QTHFD +SPPDFYT+V I GVPAD    KT+  ED+W P W
Sbjct  611  KKTLKVTVYMGDGWALDFSQTHFDAFSPPDFYTKVHIVGVPADAAKRKTRVIEDDWIPYW  670

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV E+D+SEKDDF GQTCLPVSELRPGIR+V L ++KG  Y 
Sbjct  671  DEEFSFPLTVPELALLRIEVREHDLSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGHKYK  730

Query  210  SVRLLMRFTF  181
            SV+LLM+F F
Sbjct  731  SVKLLMKFHF  740



>ref|XP_010233537.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Brachypodium distachyon]
Length=600

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-EVFDPRAtlpvkktl  559
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++ +VFDP+   PVKKTL
Sbjct  414  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQSDVFDPKKRQPVKKTL  473

Query  558  kvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEEF  379
            KVK+YMGDGW +DFK THFD YSPPDFY RVGIAGVPAD  M KT+  EDNW PVWEEEF
Sbjct  474  KVKIYMGDGWRMDFKHTHFDQYSPPDFYARVGIAGVPADSVMKKTRTIEDNWVPVWEEEF  533

Query  378  TFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVRL  199
             F LTVPE+ALLR+EVHEYDMSEKDDF GQT LPVSEL+PGIRAV L +RKG  +N+V+L
Sbjct  534  AFDLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSELQPGIRAVALFDRKGNKFNNVKL  593

Query  198  LMRFTFV  178
            LMRF FV
Sbjct  594  LMRFEFV  600



>ref|XP_006295484.1| hypothetical protein CARUB_v10024587mg [Capsella rubella]
 gb|EOA28382.1| hypothetical protein CARUB_v10024587mg [Capsella rubella]
Length=617

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  427  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFRDEVFDPRKKLPV  486

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  487  KETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNAKKKTKIIEDNWYPIW  546

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  547  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  606

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  607  SVRLLMRFIF  616



>ref|NP_001235310.1| phosphoinositide-specific phospholipase C P13 [Glycine max]
 gb|AAB03258.1| phosphoinositide-specific phospholipase C P13 [Glycine max]
Length=600

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL++     EVF+P+A LPV
Sbjct  408  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLLETGPDDEVFNPKAKLPV  467

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DFK THFD YSPPDFYTRVGIAGVP D  M +TK  EDNW P W
Sbjct  468  KTTLKVTVYMGEGWYYDFKHTHFDQYSPPDFYTRVGIAGVPNDTIMKRTKAIEDNWLPTW  527

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLP+ ELR GIRA+ L ++KG+ YN
Sbjct  528  NEAFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPIWELRSGIRAIPLHSQKGDKYN  587

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  588  TVKLLMRFEFI  598



>ref|XP_003562396.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Brachypodium distachyon]
Length=599

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-EVFDPRAtlpvkktl  559
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++ +VFDP+   PVKKTL
Sbjct  413  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQSDVFDPKKRQPVKKTL  472

Query  558  kvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEEF  379
            KVK+YMGDGW +DFK THFD YSPPDFY RVGIAGVPAD  M KT+  EDNW PVWEEEF
Sbjct  473  KVKIYMGDGWRMDFKHTHFDQYSPPDFYARVGIAGVPADSVMKKTRTIEDNWVPVWEEEF  532

Query  378  TFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVRL  199
             F LTVPE+ALLR+EVHEYDMSEKDDF GQT LPVSEL+PGIRAV L +RKG  +N+V+L
Sbjct  533  AFDLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSELQPGIRAVALFDRKGNKFNNVKL  592

Query  198  LMRFTFV  178
            LMRF FV
Sbjct  593  LMRFEFV  599



>ref|XP_009766854.1| PREDICTED: phosphoinositide phospholipase C 2-like [Nicotiana 
sylvestris]
Length=484

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG GR LWLMQGMFR NGGCGYVKKP+ L+K     EV+DP+  L +
Sbjct  293  GWMHGAQMVAFNMQGNGRPLWLMQGMFRANGGCGYVKKPELLLKDGPNNEVYDPKRLLSL  352

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVK+YMG GWHLDFK+THFD+YSPPDFY ++ IAGVPAD  + KT+  ED+W P W
Sbjct  353  KTTLKVKIYMGKGWHLDFKRTHFDIYSPPDFYVKIAIAGVPADSGVKKTRPIEDDWVPTW  412

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EF FPLTVPE+ALLR+EVHEYDMSE DDF GQTC+PVSELR GIRAV L N KGE Y 
Sbjct  413  NDEFEFPLTVPEIALLRVEVHEYDMSEIDDFGGQTCIPVSELRTGIRAVPLYNEKGEKYP  472

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  473  SVKLLMRFEFV  483



>ref|XP_010505719.1| PREDICTED: phosphoinositide phospholipase C 6-like [Camelina 
sativa]
Length=614

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  424  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKLPV  483

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  484  KETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNTKRKTKIIEDNWYPIW  543

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  544  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  603

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  604  SVRLLMRFIF  613



>ref|XP_010517422.1| PREDICTED: phosphoinositide phospholipase C 6 [Camelina sativa]
Length=614

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  424  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKLPV  483

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  484  KETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNAKRKTKIIEDNWYPIW  543

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  544  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  603

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  604  SVRLLMRFIF  613



>gb|AAW81961.1| phosphatidylinositol-specific phospholipase C 1 [Lilium davidii]
Length=547

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL+      E F P+  LPV
Sbjct  357  GWLHGAQMVAFNMQGYGRALWLMHGFYQANGGCGYVKKPDFLLNTGSHGETFHPKVPLPV  416

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DFKQT+FD YSPPDFYTR+GIAGVPAD  M +TK  ED+WTPVW
Sbjct  417  KKTLKVKVYMGDGWRMDFKQTYFDAYSPPDFYTRIGIAGVPADXVMKRTKAIEDDWTPVW  476

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPE+ALLRIEVHEYDMSEKDDF GQTCLP+SELRPG R+V L +RKG  + 
Sbjct  477  NEEFVFPLTVPEIALLRIEVHEYDMSEKDDFGGQTCLPISELRPGFRSVPLFDRKGMKFK  536

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  537  SVKLLMRFEFI  547



>ref|XP_008343623.1| PREDICTED: phosphoinositide phospholipase C 2-like [Malus domestica]
Length=592

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGYVKKPDFL+K     EVFDP++ LPV
Sbjct  402  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFLLKSGPHNEVFDPKSDLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMG+GW+ DFK THFD YSPPDFY RVGIAGV AD  M KTK  ED+W P W
Sbjct  462  KQTLKVKVYMGEGWYYDFKHTHFDAYSPPDFYARVGIAGVAADSVMKKTKTLEDDWXPAW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELA+LR+EVHEYDMSEKDDF GQTCLPVSELR GIRAV L  RKG  Y 
Sbjct  522  NEEFAFPLTVPELAVLRVEVHEYDMSEKDDFGGQTCLPVSELRTGIRAVPLNCRKGVPYK  581

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  582  SVKLLMHFDFV  592



>ref|XP_006411261.1| hypothetical protein EUTSA_v10016400mg [Eutrema salsugineum]
 gb|ESQ52714.1| hypothetical protein EUTSA_v10016400mg [Eutrema salsugineum]
Length=606

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDP+  LPV
Sbjct  416  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPKKKLPV  475

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW LDF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  476  KETLKVKVYMGDGWRLDFSHTHFDAYSPPDFYTKMFIVGVPADNAKRKTKIIEDNWYPIW  535

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  536  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  595

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  596  SVRLLMRFIF  605



>ref|XP_008463239.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cucumis melo]
Length=603

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVA NMQGYGRSLW+M GMFR NGGCGYVKKPDF++K     E+FDP+  LPV
Sbjct  413  GWTHGAQMVALNMQGYGRSLWIMHGMFRANGGCGYVKKPDFILKPGSDDEIFDPKVRLPV  472

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF  THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  473  KTTLKVTVYMGEGWYYDFHHTHFDAYSPPDFYTRVGIAGVPADTIMKKTKTLEDNWVPAW  532

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L + KGE Y 
Sbjct  533  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRRGIRAVPLHSVKGEKYK  592

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  593  SVKLLMGFEFV  603



>emb|CBI15950.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHG Q++AFNMQG+GRSLWLM GMFR NGGCGYVKKPDFL+      +VFDP+A LPV
Sbjct  362  GWMHGVQLLAFNMQGHGRSLWLMHGMFRANGGCGYVKKPDFLLNVSPHNQVFDPKAKLPV  421

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV+VY+GDGW+ DFK+THFD YSPPDFYTRVGIAG  AD+ M +TKKK++NW PVW
Sbjct  422  KKTLKVRVYLGDGWNFDFKKTHFDFYSPPDFYTRVGIAGAAADKTMKETKKKQNNWKPVW  481

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEV+EY+M EKD FAGQTCLPV ELR GIRAV L NRKGE Y+
Sbjct  482  NEEFTFPLTVPELALLRIEVYEYNMPEKDMFAGQTCLPVWELRQGIRAVPLFNRKGEMYS  541

Query  210  SVRLLMRFTFV  178
            SVRLLM F FV
Sbjct  542  SVRLLMSFQFV  552



>gb|AEK84223.1| phosphoinositide-specific phospholipase-like protein [Cucurbita 
maxima]
Length=597

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVA NMQGYGRSLWLM GMFR NGGCGYVKKPDF++K     ++FDP+  LPV
Sbjct  407  GWIHGAQMVALNMQGYGRSLWLMHGMFRANGGCGYVKKPDFMLKPGSDDQIFDPKVRLPV  466

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF  THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  467  KTTLKVTVYMGEGWYYDFHHTHFDAYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWVPAW  526

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPV+ELR GIRA+ L N KGE Y 
Sbjct  527  NEEFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVAELRKGIRAIPLRNVKGEKYK  586

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  587  SVKLLMGFEFV  597



>emb|CDX80341.1| BnaC09g34010D [Brassica napus]
Length=590

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQGYGR+LWLMQGMFR NGGCGYVKKPDFL+      +VFDP      
Sbjct  400  GWMSGAQMIAFNMQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGQVFDPNENSSP  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGWHLDFK+THFD YSPPDFY +VGIAG PAD+ M KT+ K + WTP+W
Sbjct  460  KKTLKVKVLMGDGWHLDFKKTHFDRYSPPDFYVKVGIAGAPADKSMEKTEVKYNTWTPIW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTF L VPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKG  Y+
Sbjct  520  NEEFTFQLIVPELALLRVEVHEYDNNEKDDFGGQTCLPVSELRQGIRAVPLYNRKGVKYS  579

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  580  STRLLMRFEFV  590



>ref|XP_009143251.1| PREDICTED: phosphoinositide phospholipase C 6 [Brassica rapa]
Length=615

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 160/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  +PV
Sbjct  425  GWIHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKIPV  484

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW LDF  THFD YSPPDFYT+V I GVPAD    KT+  EDNW P+W
Sbjct  485  KETLKVKVYMGDGWRLDFSHTHFDSYSPPDFYTKVYIVGVPADNAKRKTRVIEDNWYPIW  544

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  545  DEEFSFPLTVPELALLRIEVSEYDMSDKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  604

Query  210  SVRLLMRFTF  181
            SV+LLMRF F
Sbjct  605  SVKLLMRFIF  614



>ref|XP_011077556.1| PREDICTED: phosphoinositide phospholipase C 2-like [Sesamum indicum]
Length=593

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLMQGMFR NGGCGYVKKPDFL+      EVFDP+  LPV
Sbjct  403  GWMHGAQMVAFNMQGHGRSLWLMQGMFRANGGCGYVKKPDFLLNLGPDDEVFDPKRRLPV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            +KTLKVKVYMG+GW+LDF  THFDLYSPPDFY ++GIAGVP D  M +TK  EDNW P W
Sbjct  463  RKTLKVKVYMGEGWNLDFHHTHFDLYSPPDFYVKIGIAGVPYDSAMKRTKTIEDNWLPAW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHE+DMS+KDDF GQTCLPVSEL+ GIRAV L + KG+ Y 
Sbjct  523  NEEFEFPLTVPELALLRIEVHEFDMSDKDDFGGQTCLPVSELKTGIRAVPLHDYKGDKYK  582

Query  210  SVRLLMRFTFV  178
            SV+LL+RF FV
Sbjct  583  SVKLLLRFDFV  593



>ref|XP_006435740.1| hypothetical protein CICLE_v10031029mg [Citrus clementina]
 ref|XP_006486316.1| PREDICTED: phosphoinositide phospholipase C 2-like [Citrus sinensis]
 gb|ESR48980.1| hypothetical protein CICLE_v10031029mg [Citrus clementina]
Length=591

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL++     EVFDP+  LP 
Sbjct  401  GWSHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLLQTGPHNEVFDPKVKLPA  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV VYMG+GW+ DF  THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  461  KKTLKVTVYMGEGWYYDFPHTHFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDNWIPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPVSEL+ GIRAV L + KGE Y 
Sbjct  521  NEEFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELKQGIRAVPLHDHKGERYK  580

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  581  SVKLLMRFEFI  591



>dbj|BAK01542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=610

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G +R NGGCGYVKKPDFL++   EVFDP+   PVKK
Sbjct  422  GWVHGAQMVAFNMQGYGRALWLMHGFYRANGGCGYVKKPDFLMQSEPEVFDPKTPQPVKK  481

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DFKQTHFD YSPPDFY RVGIAGVPAD  M KTK  EDNW PVW +
Sbjct  482  TLKVKVYMGDGWRMDFKQTHFDQYSPPDFYARVGIAGVPADSVMKKTKAVEDNWVPVWGD  541

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF+F LTVPELALLR+EVHEYDMSEKDDFAGQT LPVSEL+PGIRAV L +RKG  Y + 
Sbjct  542  EFSFGLTVPELALLRVEVHEYDMSEKDDFAGQTVLPVSELQPGIRAVALFDRKGNKYPNA  601

Query  204  RLLMRFTFV  178
            +LLMRF FV
Sbjct  602  KLLMRFEFV  610



>ref|NP_850327.2| phosphoinositide phospholipase C 6 [Arabidopsis thaliana]
 sp|Q8GV43.2|PLCD6_ARATH RecName: Full=Phosphoinositide phospholipase C 6; AltName: Full=Phosphoinositide 
phospholipase PLC6; Short=AtPLC6; Short=AtPLC8; 
Short=PI-PLC6 [Arabidopsis thaliana]
 gb|AEC09783.1| phosphoinositide phospholipase C 6 [Arabidopsis thaliana]
Length=613

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  423  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKLPV  482

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  483  KETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNAKKKTKIIEDNWYPIW  542

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPV+ELRPGIR+V L ++KGE   
Sbjct  543  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVAELRPGIRSVPLYDKKGEKMK  602

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  603  SVRLLMRFIF  612



>ref|XP_002879846.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56105.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=618

 Score =   274 bits (701),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  428  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKLPV  487

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  488  KETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNAKKKTKIIEDNWYPIW  547

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPV+ELRPGIR+V L ++KGE   
Sbjct  548  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVAELRPGIRSVPLYDKKGEKMK  607

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  608  SVRLLMRFIF  617



>ref|XP_006338846.1| PREDICTED: phosphoinositide phospholipase C 2-like [Solanum tuberosum]
Length=565

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+K     EVFDP A LPV
Sbjct  375  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLKAGPNNEVFDPTANLPV  434

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QTHFD YSPPDFY ++GIAGVPADE   +TK  +DNW P W
Sbjct  435  KTTLKVTVYMGDGWDKDFDQTHFDTYSPPDFYAKLGIAGVPADEVKKRTKTMDDNWIPSW  494

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRI+V +Y++S+KD+FAGQTCLPV+ELR GIRAV L +RKGE Y+
Sbjct  495  DEQFEFPLTVPELALLRIKVLDYNLSDKDEFAGQTCLPVAELRQGIRAVPLYDRKGEKYS  554

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  555  SVKLLMRFEFI  565



>ref|XP_010508911.1| PREDICTED: phosphoinositide phospholipase C 6-like [Camelina 
sativa]
Length=614

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  424  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKLPV  483

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW +DF  THFD YSPPDFYT++ + GVPAD    KTK  EDNW P+W
Sbjct  484  KETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMYLVGVPADNAKRKTKIIEDNWYPIW  543

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  544  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  603

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  604  SVRLLMRFIF  613



>ref|NP_001275075.1| phosphoinositide phospholipase C 2-like [Solanum tuberosum]
 emb|CAA63893.1| phosphoinositide-specific phospholipase C [Solanum tuberosum]
Length=565

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+K     EVFDP A LPV
Sbjct  375  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLKAGPNNEVFDPTANLPV  434

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QTHFD YSPPDFY ++GIAGVPADE   +TK  +DNW P W
Sbjct  435  KTTLKVTVYMGDGWDKDFDQTHFDTYSPPDFYAKLGIAGVPADEVKKRTKTMDDNWIPSW  494

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRI+V +Y++S+KD+FAGQTCLPV+ELR GIRAV L +RKGE Y+
Sbjct  495  DEQFEFPLTVPELALLRIKVLDYNLSDKDEFAGQTCLPVAELRQGIRAVPLYDRKGEKYS  554

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  555  SVKLLMRFEFI  565



>ref|NP_001275298.1| phosphoinositide phospholipase C 2-like [Solanum tuberosum]
 emb|CAA63777.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Solanum 
tuberosum]
Length=596

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GR LWLMQGMF+ NGGCGYVKKP+ L+K     EV DP+  L V
Sbjct  405  GWMHGAQMVAFNMQGHGRPLWLMQGMFKANGGCGYVKKPELLLKTDANNEVHDPKRLLSV  464

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMG GWHLDFK+THFD YSPPDFY ++GIAGV AD ++ KTK  EDNW P+W
Sbjct  465  KTTLKVKVYMGKGWHLDFKRTHFDAYSPPDFYVKIGIAGVAADSRVKKTKAIEDNWIPIW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EF FPLTVPELALLR+EVHEYDMSE DDF GQTC+PVSELR GIRAV + N KGE Y 
Sbjct  525  NDEFEFPLTVPELALLRVEVHEYDMSEIDDFGGQTCIPVSELRTGIRAVPIYNEKGEKYP  584

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  585  SVKLLMRFEFV  595



>ref|XP_009612249.1| PREDICTED: phosphoinositide phospholipase C 2-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   273 bits (698),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG GR LWLMQGMFR NGGCGYVKKP+ L+K     EV DP+  L V
Sbjct  405  GWMHGAQMVAFNMQGNGRPLWLMQGMFRANGGCGYVKKPELLLKDGPNNEVHDPKRLLSV  464

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVK+YMG GWHLDFK+THFD+YSPPDFY ++GIAGVPAD ++ KT+  EDNW P W
Sbjct  465  KTTLKVKIYMGRGWHLDFKRTHFDIYSPPDFYFKIGIAGVPADSRVKKTRPIEDNWVPTW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EF FPLTVPE+ALLR+EVHEYDMSE DDF GQTC+PVSELR GIRAV L N KGE Y 
Sbjct  525  NDEFEFPLTVPEIALLRVEVHEYDMSEIDDFGGQTCIPVSELRTGIRAVPLYNEKGEKYP  584

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  585  SVKLLMRFEFV  595



>ref|XP_002278839.2| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Vitis vinifera]
Length=590

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHG Q++AFNMQG+GRSLWLM GMFR NGGCGYVKKPDFL+      +VFDP+A LPV
Sbjct  400  GWMHGVQLLAFNMQGHGRSLWLMHGMFRANGGCGYVKKPDFLLNVSPHNQVFDPKAKLPV  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV+VY+GDGW+ DFK+THFD YSPPDFYTRVGIAG  AD+ M +TKKK++NW PVW
Sbjct  460  KKTLKVRVYLGDGWNFDFKKTHFDFYSPPDFYTRVGIAGAAADKTMKETKKKQNNWKPVW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLRIEV+EY+M EKD FAGQTCLPV ELR GIRAV L NRKGE Y+
Sbjct  520  NEEFTFPLTVPELALLRIEVYEYNMPEKDMFAGQTCLPVWELRQGIRAVPLFNRKGEMYS  579

Query  210  SVRLLMRFTFV  178
            SVRLLM F FV
Sbjct  580  SVRLLMSFQFV  590



>gb|KDO68971.1| hypothetical protein CISIN_1g007399mg [Citrus sinensis]
Length=591

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQG+GRSLWLM GMFR NGGCGYVKKP+FL++     EVFDP+  LP 
Sbjct  401  GWSHGAQMVAFNMQGHGRSLWLMHGMFRANGGCGYVKKPNFLLQTGPHNEVFDPKVKLPA  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV VYMG+GW+ DF  THFD YSPPDFY RVGIAGVPAD  M KTK  EDNW P W
Sbjct  461  KKTLKVTVYMGEGWYYDFPHTHFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDNWIPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPVSEL+ GIRAV L +RKGE Y 
Sbjct  521  NEEFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELKQGIRAVPLHDRKGERYK  580

Query  210  SVRLLMRFTFV  178
            SV+LLM F F+
Sbjct  581  SVKLLMHFEFI  591



>ref|XP_007016094.1| Phosphatidylinositol-speciwc phospholipase C4 isoform 1 [Theobroma 
cacao]
 gb|EOY33713.1| Phosphatidylinositol-speciwc phospholipase C4 isoform 1 [Theobroma 
cacao]
Length=596

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVA NMQGYG+SLWLM GMFR+NGGCGYVKKP+FL+      +VFDP+A LPV
Sbjct  402  GWMHGAQMVALNMQGYGKSLWLMHGMFRSNGGCGYVKKPEFLMNVGPNDQVFDPKAKLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KK LKVKVYMGDGWHLDFKQ H + +SPP+FYTRVGI GVPAD+ M KTKK+  NWT VW
Sbjct  462  KKILKVKVYMGDGWHLDFKQRHLNHWSPPEFYTRVGIEGVPADKTMRKTKKRNGNWTLVW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF +PLTVPE+ALLR+EVHEY+MSEKD FAGQTCLPVSELRPGIRAV L NRKGE + 
Sbjct  522  DEEFIYPLTVPEIALLRVEVHEYNMSEKDYFAGQTCLPVSELRPGIRAVPLFNRKGEKFT  581

Query  210  SVRLLMRFTFV  178
            S+ LLMRF FV
Sbjct  582  SLGLLMRFEFV  592



>ref|XP_010520201.1| PREDICTED: phosphoinositide phospholipase C 4 [Tarenaya hassleriana]
Length=586

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 153/191 (80%), Gaps = 9/191 (5%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQM+AFNMQGYGR+LWLM GMFR NGGCGYVKKPDFL+K     EVFD      +
Sbjct  400  GWMHGAQMIAFNMQGYGRALWLMHGMFRANGGCGYVKKPDFLMKAGPSGEVFDSTVKKTL  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K  +     MGDGW +DFK THFDLYSPPDFY +VGIAG PADE M KTK K +NWTPVW
Sbjct  460  KVKVC----MGDGWQVDFKLTHFDLYSPPDFYVKVGIAGAPADEVMAKTKIKFNNWTPVW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLT PELALLR+EVHEYD SEKDDF GQTCLPVSELR G+RAV L ++KGE Y+
Sbjct  516  NEEFTFPLTAPELALLRVEVHEYDTSEKDDFGGQTCLPVSELRQGLRAVPLFDQKGEKYS  575

Query  210  SVRLLMRFTFV  178
            S RLL+RF FV
Sbjct  576  STRLLLRFEFV  586



>emb|CDY27998.1| BnaC05g44000D [Brassica napus]
Length=546

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  356  AWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDSDIFDPKATLPV  415

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  416  KTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWVPAW  475

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIRA  L NRKGE Y 
Sbjct  476  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELKEGIRAFPLHNRKGEKYK  535

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  536  SVKLLVRCEFV  546



>ref|NP_001236167.1| phosphatidylinositol-specific phospholipase C [Glycine max]
 gb|AAA74441.1| phosphatidylinositol-specific phospholipase C [Glycine max]
Length=600

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL++     EVF+P+A LPV
Sbjct  408  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLLETGPDDEVFNPKAKLPV  467

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DFK THFD YSPPDFYTRVGIAGVP D  M +TK  EDNW P W
Sbjct  468  KTTLKVTVYMGEGWYYDFKHTHFDQYSPPDFYTRVGIAGVPNDTIMKRTKAIEDNWLPTW  527

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPLTVPELALLRIEVHEYDMSEKDDF GQ CLP+ ELR GIRA+ L ++KG+ YN
Sbjct  528  NEVFEFPLTVPELALLRIEVHEYDMSEKDDFGGQACLPIWELRSGIRAIPLHSQKGDKYN  587

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  588  TVKLLMRFEFI  598



>ref|XP_003600904.1| Phosphoinositide phospholipase C [Medicago truncatula]
 gb|AAL17948.1| phosphoinositide-specific phospholipase C [Medicago truncatula]
 gb|AES71155.1| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=593

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCG+VKKPDFL+K     E+FDP+A LP 
Sbjct  403  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGFVKKPDFLLKTGPNNEIFDPKANLPS  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DFK THFD +SPPDFY RVGIAGVP D  M KTK  ED+W P W
Sbjct  463  KTTLKVTVYMGEGWYYDFKHTHFDQFSPPDFYARVGIAGVPFDTVMKKTKSIEDSWLPSW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRA+ L +RKG+ YN
Sbjct  523  NEVFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRSGIRAIPLHSRKGDKYN  582

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  583  NVKLLMRFEFI  593



>gb|KFK36899.1| hypothetical protein AALP_AA4G187200 [Arabis alpina]
Length=622

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 158/190 (83%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP FL+K     EVFDP+  +PV
Sbjct  432  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPSFLMKKGFHDEVFDPKKKVPV  491

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW LDF  THFD YSPPDFYT++ I GVPAD    KT+  EDNW P+W
Sbjct  492  KETLKVKVYMGDGWRLDFSHTHFDSYSPPDFYTKMFIVGVPADNAKRKTRIIEDNWYPIW  551

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPV+ELRPGIR+V L ++KGE   
Sbjct  552  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVAELRPGIRSVPLYDKKGEKMK  611

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  612  SVRLLMRFVF  621



>ref|XP_009147001.1| PREDICTED: phosphoinositide phospholipase C 2 [Brassica rapa]
Length=585

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  395  AWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDSDIFDPKATLPV  454

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  455  KTTLKVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWVPAW  514

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIRA  L NRKGE Y 
Sbjct  515  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELKEGIRAFPLHNRKGEKYK  574

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  575  SVKLLVRCEFV  585



>ref|NP_001235324.1| phosphoinositide-specific phospholipase C P25 [Glycine max]
 gb|AAB03259.1| phosphoinositide-specific phospholipase C P25 [Glycine max]
 gb|KHN34717.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=551

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPD L+K     EVFDPR+ LPV
Sbjct  361  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDLLLKVGPNNEVFDPRSHLPV  420

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV +YMG+GW LDFK THFD +SPPDFY RVGIAGVP D  M KT+K EDNW+P W
Sbjct  421  KTTLKVTIYMGEGWFLDFKHTHFDKFSPPDFYARVGIAGVPNDTVMKKTEKVEDNWSPSW  480

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             + F FPL VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKG+ Y 
Sbjct  481  NQVFKFPLAVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRKGDKYA  540

Query  210  SVRLLMRFTFV  178
            +V+LLM F F+
Sbjct  541  NVKLLMHFEFI  551



>emb|CAA75546.2| phospholipase C [Pisum sativum]
Length=594

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCG+VKKPDFL+K     EVFDP+A+LP+
Sbjct  404  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGFVKKPDFLLKTGPNNEVFDPKASLPL  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF  THFD +SPPDFY RVGIAGVP D  M KTK  ED+W P W
Sbjct  464  KTTLKVTVYMGEGWYYDFDHTHFDQFSPPDFYARVGIAGVPFDTIMKKTKTVEDSWLPSW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKG+ YN
Sbjct  524  NEVFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRTGIRAVPLHSRKGDKYN  583

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  584  NVKLLMRFEFI  594



>emb|CDY35983.1| BnaA05g29670D [Brassica napus]
Length=585

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  395  AWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDSDIFDPKATLPV  454

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  455  KTTLKVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWVPAW  514

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIRA  L NRKGE Y 
Sbjct  515  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELKEGIRAFPLHNRKGEKYK  574

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  575  SVKLLVRCEFV  585



>gb|KHG13942.1| Phosphoinositide phospholipase C 2 -like protein [Gossypium arboreum]
Length=578

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV--KEVFDPRAtlpvkkt  562
            GWMHGAQMVAFNMQGYGRSLWLM GMF+ NGGCGY+KKPDFL+  K VFDP   LPVKK 
Sbjct  389  GWMHGAQMVAFNMQGYGRSLWLMHGMFKANGGCGYLKKPDFLLNTKAVFDPTVKLPVKKI  448

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKV +YMG+GW+ DF  THFD YSPPDFY RVGIAGV  D  M KTK  EDNW P W EE
Sbjct  449  LKVTMYMGEGWYYDFHHTHFDAYSPPDFYARVGIAGVSFDSVMKKTKTLEDNWVPCWNEE  508

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F F LTVPELALLR+EVHEYDMSEKDDF GQTCLP+SELR GIRAV L +RKGE Y+SV+
Sbjct  509  FEFHLTVPELALLRVEVHEYDMSEKDDFGGQTCLPISELRSGIRAVPLNSRKGEKYSSVK  568

Query  201  LLMRFTFV  178
            LLMRF F+
Sbjct  569  LLMRFEFI  576



>emb|CDY07623.1| BnaA03g18880D [Brassica napus]
Length=595

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 151/190 (79%), Gaps = 11/190 (6%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL+K     EVFDP+  L V
Sbjct  411  GWTHGAQMIAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPKKKLHV  470

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K       YMGDGW LDF  THFD YSPPDFYT+V I GVPAD    KT+  EDNW P+W
Sbjct  471  KV------YMGDGWRLDFSHTHFDTYSPPDFYTKVFIVGVPADNAKRKTRVIEDNWYPIW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  525  DEEFSFPLTVPELALLRIEVREYDMSDKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  584

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  585  SVRLLMRFIF  594



>emb|CDY07057.1| BnaA04g22580D [Brassica napus]
Length=610

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 155/190 (82%), Gaps = 6/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  421  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHEEVFDPRKKLPV  480

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLK   YMGDGW LDF  THFD YSPPDFYT++ I GVPAD    KTK   DNW P+W
Sbjct  481  KETLKAM-YMGDGWRLDFSHTHFDAYSPPDFYTKMFIVGVPADNAKRKTKIIVDNWYPIW  539

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  540  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  599

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  600  SVRLLMRFIF  609



>ref|XP_002533649.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF28737.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=601

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 158/189 (84%), Gaps = 3/189 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GWMHGAQM+AFNMQGYG+SLWLM GMFR NGGCGY+KKPDFL++   E+FDP+ TL V K
Sbjct  413  GWMHGAQMIAFNMQGYGKSLWLMHGMFRGNGGCGYLKKPDFLMQKDEELFDPKRTLSVIK  472

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVY+GDGW LDF  THFD YSPPDFYT++ I GVPAD+   KTK  EDNW P W E
Sbjct  473  TLKVKVYLGDGWRLDFSHTHFDSYSPPDFYTKLYIVGVPADDAKRKTKIIEDNWAPAWNE  532

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            EF FPLTVPELALLR+EV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE  N+ 
Sbjct  533  EFAFPLTVPELALLRVEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLHDKKGEKLNNA  592

Query  204  RLLMRFTFV  178
            RLLM+F FV
Sbjct  593  RLLMKFEFV  601



>ref|XP_010534598.1| PREDICTED: phosphoinositide phospholipase C 6 [Tarenaya hassleriana]
Length=604

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 157/190 (83%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKPDFL+     +EVFDP+  LPV
Sbjct  414  GWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPDFLMDQDPKEEVFDPKKKLPV  473

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLKVKVYMGDGW LDF  THFD YSPPDFYT++ I GVPAD    KT+  EDNW P+W
Sbjct  474  KQTLKVKVYMGDGWRLDFSHTHFDTYSPPDFYTKLYIVGVPADNASKKTRIIEDNWYPIW  533

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPV+ELR GIRAV L ++KGE   
Sbjct  534  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVAELRQGIRAVPLYDKKGEKLK  593

Query  210  SVRLLMRFTF  181
            SVRLLMRF  
Sbjct  594  SVRLLMRFVL  603



>gb|AIG51130.1| phospholipase C [Gossypium hirsutum]
Length=578

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GWMHGAQMVAFNMQGYGRSLWLM GMF+ NGGCGY+KKPDFL+   +VFDP   LPVKK 
Sbjct  389  GWMHGAQMVAFNMQGYGRSLWLMHGMFKANGGCGYLKKPDFLLNPNKVFDPNVKLPVKKI  448

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKV +YMG+GW+ DF  THFD YSPPDFY RVGIAGVP D  M KTK  EDNW P W EE
Sbjct  449  LKVTMYMGEGWYYDFHHTHFDAYSPPDFYARVGIAGVPFDSVMKKTKTLEDNWVPCWNEE  508

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F F LTVPELALLR+EVHEYDMSEKDDF GQTCLP+SELR GIRAV L +RKGE Y+SV+
Sbjct  509  FEFCLTVPELALLRVEVHEYDMSEKDDFGGQTCLPISELRSGIRAVPLNSRKGEKYSSVK  568

Query  201  LLMRFTF  181
            LLMRF F
Sbjct  569  LLMRFEF  575



>gb|AAF33824.1|AF223573_1 phospholipase C2 [Nicotiana tabacum]
Length=605

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 5/188 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  398  AWTHGAQMVAFNMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPNNQIFDPEANLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW+ DF  THFD Y+PPDFY ++GIAGVPAD  M KT+  E+NW P W
Sbjct  458  KTTLKVTVFMGEGWYYDFNHTHFDAYAPPDFYAKIGIAGVPADNVMKKTRTLENNWIPTW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVH YDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  518  DEKFEFPLTVPELALLRVEVHVYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGERYN  577

Query  210  SVRLLMRF  187
            SV+LLMRF
Sbjct  578  SVKLLMRF  585



>gb|EEC82741.1| hypothetical protein OsI_27447 [Oryza sativa Indica Group]
Length=598

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 159/188 (85%), Gaps = 3/188 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   EVFDP+ +L  KK
Sbjct  410  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTDPEVFDPKKSLSPKK  469

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DF QTHFD YSPPDFY RVGIAGVPAD  M +T+  EDNW PVWEE
Sbjct  470  TLKVKVYMGDGWRMDFTQTHFDQYSPPDFYARVGIAGVPADSVMKRTRAIEDNWVPVWEE  529

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            +FTF LTVPE+ALLR+EVHEYDMSEKDDF GQT LPVSEL PGIRAV L +RKG   N+V
Sbjct  530  DFTFKLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSELIPGIRAVALHDRKGIKLNNV  589

Query  204  RLLMRFTF  181
            +LLMRF F
Sbjct  590  KLLMRFEF  597



>ref|XP_010689668.1| PREDICTED: phosphoinositide phospholipase C 6 [Beta vulgaris 
subsp. vulgaris]
Length=582

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLWLM GMFR+NGGCGYVKKPDFL+      EVFDP+A L V
Sbjct  392  GWMHGAQMVAFNMQGYGKSLWLMNGMFRSNGGCGYVKKPDFLMTKGSNDEVFDPKAPLEV  451

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV+VYMGDGW LDF +THFD +SPPDFY ++ I GVPAD    KTK  ED+W PVW
Sbjct  452  KKTLKVRVYMGDGWRLDFSKTHFDTFSPPDFYVKLRILGVPADYAKEKTKVIEDDWAPVW  511

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            ++EFTFPLTVPELALL+IEV EYDMSEKDDF GQ CLP+SEL+ GIR++RL +RKGE   
Sbjct  512  DQEFTFPLTVPELALLQIEVREYDMSEKDDFGGQACLPLSELKTGIRSIRLHDRKGEKLP  571

Query  210  SVRLLMRFTFV  178
            SVRLLM+F FV
Sbjct  572  SVRLLMKFQFV  582



>gb|KHN36373.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=551

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     EVFDP+A LPV
Sbjct  361  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLLKVGQNNEVFDPKAHLPV  420

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV +YMG+GW  DFK THFD +SPPDFY RVGIAGVP D  M KT+K EDNW+P W
Sbjct  421  KTTLKVTIYMGEGWFHDFKHTHFDKFSPPDFYARVGIAGVPNDTVMKKTEKVEDNWSPSW  480

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             + F FPL VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +R G+ Y 
Sbjct  481  NQVFEFPLAVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRNGDKYA  540

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  541  NVKLLMRFEFI  551



>gb|KHN20845.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=562

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 155/193 (80%), Gaps = 7/193 (4%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAt--l  577
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL++     EVF+P+A   +
Sbjct  368  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLLETGPDDEVFNPKAKLPV  427

Query  576  pvkktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTP  397
                  +V VYMG+GW+ DFK THFD YSPPDFYTRVGIAGVP D  M +TK  EDNW P
Sbjct  428  KTTLKARVTVYMGEGWYYDFKHTHFDQYSPPDFYTRVGIAGVPNDTIMKRTKAIEDNWLP  487

Query  396  VWEEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGEN  217
             W E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLP+ ELR GIRA+ L ++KG+ 
Sbjct  488  TWNEAFEFPLTVPELALLRVEVHEYDMSEKDDFGGQTCLPIWELRSGIRAIPLHSQKGDK  547

Query  216  YNSVRLLMRFTFV  178
            YN+V+LLMRF F+
Sbjct  548  YNTVKLLMRFEFI  560



>emb|CDY60344.1| BnaC03g72360D [Brassica napus]
Length=600

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 151/190 (79%), Gaps = 11/190 (6%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL+K     EVFDP+  L V
Sbjct  416  GWTHGAQMIAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPKKKLHV  475

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K       YMGDGW LDF  THFD YSPPDFYT+V I GVPAD    KT+  EDNW P+W
Sbjct  476  KV------YMGDGWRLDFSHTHFDTYSPPDFYTKVFIVGVPADNAKRKTRVIEDNWYPIW  529

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  530  DEEFSFPLTVPELALLRIEVREYDMSDKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  589

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  590  SVRLLMRFIF  599



>ref|XP_009783759.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Nicotiana sylvestris]
Length=890

 Score =   276 bits (707),  Expect = 6e-83, Method: Composition-based stats.
 Identities = 138/191 (72%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M GMFR+NGGCGYVKKP FL++     EVFDP+ T PV
Sbjct  700  GWMHGAQMVAFNMQGYGKSLWIMHGMFRSNGGCGYVKKPVFLMERGPRNEVFDPKVTSPV  759

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTL V+VY+GDGW +DF  THFD +SPPDFYT++ I GVPAD    KT+  ED+W P+W
Sbjct  760  KKTLWVRVYLGDGWRMDFSHTHFDTFSPPDFYTKLYIIGVPADAAKRKTRIIEDDWGPIW  819

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIRAV L ++KGE   
Sbjct  820  GEEFKFPLTVPELALLRIEVREYDMSDKDDFGGQTCLPVSELRPGIRAVPLYDKKGEKLK  879

Query  210  SVRLLMRFTFV  178
            SVRLLM+F F+
Sbjct  880  SVRLLMQFQFI  890



>gb|KFK38259.1| phosphoinositide phospholipase c 2 [Arabis alpina]
Length=581

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  391  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDLLLKGGSDDDIFDPKATLPV  450

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  451  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPADTIMKKTKTLEDNWIPAW  510

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIRA  L +RKGE Y 
Sbjct  511  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELQEGIRAFPLHSRKGEKYK  570

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  571  SVKLLVRCEFV  581



>emb|CDY61706.1| BnaC04g56690D [Brassica napus]
Length=610

 Score =   271 bits (692),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 156/190 (82%), Gaps = 6/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLW+M GMFR NGGCGYVKKP+FL+K     EVFDPR  LPV
Sbjct  421  GWTHGAQMIAFNMQGYGKSLWMMHGMFRANGGCGYVKKPNFLMKKGFHEEVFDPRKKLPV  480

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TLK   YMGDGW LDF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W
Sbjct  481  KETLKAM-YMGDGWRLDFSHTHFDAYSPPDFYTKMFIVGVPADNAKRKTKIIEDNWYPIW  539

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  540  DEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  599

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  600  SVRLLMRFIF  609



>ref|XP_002311223.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEE88590.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=590

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMFR NGGCG+VKKP FL+K     EVFD +A LP+
Sbjct  400  GWMHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGFVKKPSFLLKSGPHGEVFDTKAKLPM  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            +KTLKVK+YMG+GW  DF+ THFD YSPPDFY RVGIAGVPAD  M KTK  ED+W P W
Sbjct  460  QKTLKVKIYMGEGWFYDFQHTHFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDSWIPFW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y 
Sbjct  520  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELREGIRAVPLHDRKGERYK  579

Query  210  SVRLLMRFTFV  178
             V+LL+R  FV
Sbjct  580  CVKLLVRLEFV  590



>ref|XP_007163546.1| hypothetical protein PHAVU_001G243300g [Phaseolus vulgaris]
 gb|ESW35540.1| hypothetical protein PHAVU_001G243300g [Phaseolus vulgaris]
Length=591

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKP FL++     EVFDP+A LPV
Sbjct  401  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPHFLLESGLNDEVFDPKADLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV +YMG+GW  DFK THFD YSPPDFY RVGIAGVP D  M KT   EDNW+P W
Sbjct  461  KKTLKVTIYMGEGWFHDFKHTHFDQYSPPDFYARVGIAGVPCDAVMKKTGTIEDNWSPSW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             + F FPL+VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L ++KGE Y 
Sbjct  521  NKAFEFPLSVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSQKGEKYE  580

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  581  NVKLLMRFEFI  591



>gb|EYU26667.1| hypothetical protein MIMGU_mgv1a003464mg [Erythranthe guttata]
Length=583

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQ +GRSLWLMQGMFR NGGCGYVKKPDFL+K     EVFDP+ +LPV
Sbjct  393  GWIHGAQMVAFNMQSHGRSLWLMQGMFRANGGCGYVKKPDFLLKKGPNNEVFDPKGSLPV  452

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLK+K+YMG GW+LDFK THFD YSPPDFY ++GIAG+P+D  M KT+   DNW PVW
Sbjct  453  KTTLKIKIYMGVGWNLDFKSTHFDAYSPPDFYVKIGIAGIPSDSAMKKTEIIADNWMPVW  512

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FP++VPELALLR+EVHE+D+SEKDDF GQTCLP+SEL+ GIRAV L + KG  Y 
Sbjct  513  NEEFEFPMSVPELALLRVEVHEFDVSEKDDFGGQTCLPISELKSGIRAVPLHDYKGNKYK  572

Query  210  SVRLLMRFTFV  178
            SV+LL+RF F 
Sbjct  573  SVKLLLRFCFT  583



>ref|XP_006356459.1| PREDICTED: phosphoinositide phospholipase C 6-like [Solanum tuberosum]
Length=884

 Score =   276 bits (706),  Expect = 9e-83, Method: Composition-based stats.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M GMFR+NGGCGYV+KP FL++     E+FDP+ TLPV
Sbjct  694  GWMHGAQMVAFNMQGYGKSLWIMHGMFRSNGGCGYVRKPSFLMERGPYNELFDPKVTLPV  753

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTL+V+VY+GDGW +DF  THFD +SPPDFYT++ I GVPAD    KT+  ED+W P+W
Sbjct  754  KKTLRVRVYLGDGWRMDFSHTHFDAFSPPDFYTKLYIIGVPADAAKSKTRIIEDDWGPIW  813

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIRAV L ++KGE   
Sbjct  814  GEEFKFPLTVPELALLRIEVREYDMSDKDDFGGQTCLPVSELRPGIRAVPLYDKKGEKLK  873

Query  210  SVRLLMRFTFV  178
            SVRLLM+F F+
Sbjct  874  SVRLLMQFRFI  884



>gb|AAK01711.1|AF332874_1 phosphoinositide-specific phospholipase C [Oryza sativa Indica 
Group]
Length=599

 Score =   270 bits (691),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 159/188 (85%), Gaps = 3/188 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   EVFDP+ +L  KK
Sbjct  411  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTDPEVFDPKKSLSSKK  470

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DF QTHFD YSPPDFY RVGIAGVPAD  M +T+  EDNW PVWEE
Sbjct  471  TLKVKVYMGDGWRMDFTQTHFDQYSPPDFYARVGIAGVPADSVMKRTRAIEDNWVPVWEE  530

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            +FTF LTVPE+ALLR+EVHEYDMSEKDDF GQT LPVSEL PGIRAV L +RKG   N+V
Sbjct  531  DFTFKLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSELIPGIRAVALHDRKGIKLNNV  590

Query  204  RLLMRFTF  181
            +LLMRF F
Sbjct  591  KLLMRFEF  598



>emb|CDP06481.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVA NMQGYGR LWLMQG+FR NGGCGYVKKPD L++     EVFDP+  LPV
Sbjct  404  GWTHGAQMVALNMQGYGRYLWLMQGLFRANGGCGYVKKPDILLQIGPHSEVFDPKRALPV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW+LDF  THFD+YSPPDFY +VGIAGV  D  + KTK  EDNW P W
Sbjct  464  KKTLKVKVYMGDGWNLDFHHTHFDMYSPPDFYVKVGIAGVSDDSAVKKTKIVEDNWVPTW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            EEEF F L VPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIR V L N+KGE Y 
Sbjct  524  EEEFEFQLRVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELREGIRGVPLYNQKGEKYK  583

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  584  SVKLLMRFDFL  594



>ref|XP_003552353.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform 1 
[Glycine max]
Length=592

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCGYVKKPDFL+K     EVFDP+A LPV
Sbjct  402  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGYVKKPDFLLKVGQNNEVFDPKAHLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV +YMG+GW  DFK THFD +SPPDFY RVGIAGVP D  M KT+K EDNW+P W
Sbjct  462  KTTLKVTIYMGEGWFHDFKHTHFDKFSPPDFYARVGIAGVPNDTVMKKTEKVEDNWSPSW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             + F FPL VPELALLR+EVHEYDMSEKDDF GQTCLPV ELR GIRAV L +R G+ Y 
Sbjct  522  NQVFEFPLAVPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRNGDKYA  581

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  582  NVKLLMRFEFI  592



>ref|NP_001067028.1| Os12g0562400 [Oryza sativa Japonica Group]
 dbj|BAF30047.1| Os12g0562400 [Oryza sativa Japonica Group]
Length=193

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQG+ ++L LMQG FR NGGCGYVKKPDFL++     EVFDP A++PV
Sbjct  3    AWTHGAQMVAFNMQGHDKALRLMQGFFRANGGCGYVKKPDFLLRTGPNGEVFDPNASMPV  62

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DF +THFD +SPPDFYTRVGIAGV AD  M KT+  ED W P+W
Sbjct  63   KKTLKVKVYMGDGWRMDFSKTHFDTFSPPDFYTRVGIAGVRADCVMKKTRTIEDQWVPMW  122

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELA+LRIEVHEYDMSEK DF GQTCLPVSEL+ GIRAV L +R+G  Y 
Sbjct  123  DEEFTFPLTVPELAVLRIEVHEYDMSEKHDFGGQTCLPVSELKQGIRAVPLHDRRGTRYK  182

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  183  SVRLLMRFDFL  193



>ref|XP_006401052.1| hypothetical protein EUTSA_v10013042mg [Eutrema salsugineum]
 gb|ESQ42505.1| hypothetical protein EUTSA_v10013042mg [Eutrema salsugineum]
Length=594

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQGYGR+LWLMQGMFR NGGCGYVKKPDFL+      +VFDP  + P 
Sbjct  404  GWMSGAQMIAFNMQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPTGQVFDPNESSPP  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGWHLDF +THFDLYSPPDF+ RVGIAG P DE M KT+ K D WTP+W
Sbjct  464  KKTLKVKVCMGDGWHLDFNKTHFDLYSPPDFFVRVGIAGAPVDEAMKKTEVKYDTWTPIW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTF LTVPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKG  Y 
Sbjct  524  NEEFTFQLTVPELALLRVEVHEYDANEKDDFGGQTCLPVSELRQGIRAVPLFNRKGVKYG  583

Query  210  SVRLLMRFTFV  178
              RLLMRF FV
Sbjct  584  FTRLLMRFEFV  594



>gb|AAM90315.1| phospholipase C [Pisum sativum]
Length=594

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCG+VKKPDFL+K     EVFDP+A+LP+
Sbjct  404  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGFVKKPDFLLKTGPNNEVFDPKASLPL  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF  THFD +SPPDFY RVGIAGVP D  M KTK  ED+W P W
Sbjct  464  KTTLKVTVYMGEGWYYDFDHTHFDQFSPPDFYARVGIAGVPFDTIMKKTKTVEDSWLPSW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKG  YN
Sbjct  524  NEVFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRTGIRAVPLHSRKGGKYN  583

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  584  NVKLLMRFEFI  594



>emb|CDP14022.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQM+AFNMQGYG+SLWLM G+FR+NGGCGYVKKPDFL+K     E+FDP+  LPV
Sbjct  394  GWTHGAQMLAFNMQGYGKSLWLMHGLFRSNGGCGYVKKPDFLMKRGPRNELFDPKVKLPV  453

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV VY+GDGW LDF  THFD YSPPDFYT+V + GVPADE   KT+  ED+W P+W
Sbjct  454  KKTLKVSVYLGDGWRLDFSHTHFDSYSPPDFYTKVQMVGVPADEAKKKTRIIEDDWGPIW  513

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+FTFPLTVPELALLRIE+ E+DMSEKDDF GQTCLPVSELRPGIRAV + ++KGE   
Sbjct  514  DEDFTFPLTVPELALLRIEIREHDMSEKDDFGGQTCLPVSELRPGIRAVPIYDKKGEKLR  573

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  574  SVRLLMRFQFI  584



>ref|XP_004500491.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Cicer arietinum]
Length=594

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NG CG+VKKPDFL+K     EVFDP+A LPV
Sbjct  404  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGRCGFVKKPDFLLKTGPNNEVFDPKAPLPV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VY+G+GW+ DFK THFD +SPPDFY RVGIAGVP D  M KTK  EDNW P W
Sbjct  464  KTTLKVTVYIGEGWYYDFKHTHFDQFSPPDFYARVGIAGVPFDTTMKKTKSIEDNWLPSW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RK   YN
Sbjct  524  NEVFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRAVPLHSRKDVKYN  583

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  584  NVKLLMRFEFI  594



>ref|XP_004500490.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Cicer arietinum]
Length=595

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NG CG+VKKPDFL+K     EVFDP+A LPV
Sbjct  405  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGRCGFVKKPDFLLKTGPNNEVFDPKAPLPV  464

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VY+G+GW+ DFK THFD +SPPDFY RVGIAGVP D  M KTK  EDNW P W
Sbjct  465  KTTLKVTVYIGEGWYYDFKHTHFDQFSPPDFYARVGIAGVPFDTTMKKTKSIEDNWLPSW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L +RK   YN
Sbjct  525  NEVFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRAVPLHSRKDVKYN  584

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  585  NVKLLMRFEFI  595



>ref|NP_001060735.1| Os07g0694000 [Oryza sativa Japonica Group]
 dbj|BAC84056.1| putative phosphoinositide-specific phospholipase C [Oryza sativa 
Japonica Group]
 dbj|BAF22649.1| Os07g0694000 [Oryza sativa Japonica Group]
 gb|EAZ41196.1| hypothetical protein OsJ_25698 [Oryza sativa Japonica Group]
 dbj|BAG91961.1| unnamed protein product [Oryza sativa Japonica Group]
Length=598

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 159/188 (85%), Gaps = 3/188 (2%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK---EVFDPRAtlpvkk  565
            GW+HGAQMVAFNMQGYGR+LWLM G ++ NGGCGYVKKPDFL++   EVFDP+ +L  KK
Sbjct  410  GWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTDPEVFDPKKSLSPKK  469

Query  564  tlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEE  385
            TLKVKVYMGDGW +DF QTHFD YSPPDFY RVGIAGVPAD  M +T+  EDNW PVWEE
Sbjct  470  TLKVKVYMGDGWRMDFTQTHFDQYSPPDFYARVGIAGVPADSVMKRTRAIEDNWVPVWEE  529

Query  384  EFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSV  205
            +FTF LTVPE+ALLR+EVHEYDMSEKDDF GQT LPVS+L PGIRAV L +RKG   N+V
Sbjct  530  DFTFKLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSDLIPGIRAVALHDRKGIKLNNV  589

Query  204  RLLMRFTF  181
            +LLMRF F
Sbjct  590  KLLMRFEF  597



>emb|CDX74806.1| BnaA05g05520D [Brassica napus]
Length=600

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 153/190 (81%), Gaps = 11/190 (6%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  +PV
Sbjct  416  GWIHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKIPV  475

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K       YMGDGW LDF  THFD YSPPDFYT+V I GVPAD    KT+  EDNW P+W
Sbjct  476  KV------YMGDGWRLDFSHTHFDSYSPPDFYTKVYIVGVPADNAKRKTRVIEDNWYPIW  529

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF+FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIR+V L ++KGE   
Sbjct  530  DEEFSFPLTVPELALLRIEVSEYDMSDKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMK  589

Query  210  SVRLLMRFTF  181
            SV+LLMRF F
Sbjct  590  SVKLLMRFIF  599



>ref|XP_010318244.1| PREDICTED: phosphoinositide phospholipase C 6-like [Solanum lycopersicum]
Length=884

 Score =   276 bits (705),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M GMFR+NGGCGYV+KP FL++     E+FDP+ TLPV
Sbjct  694  GWMHGAQMVAFNMQGYGKSLWIMHGMFRSNGGCGYVRKPSFLMERGPCNELFDPKVTLPV  753

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTL+V+VY+GDGW +DF  THFD +SPPDFYT++ I GVPAD    KT+  ED+W P+W
Sbjct  754  KKTLRVRVYLGDGWRMDFSHTHFDAFSPPDFYTKLYIIGVPADAAKSKTRIIEDDWGPIW  813

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIRAV L ++KGE   
Sbjct  814  GEEFKFPLTVPELALLRIEVREYDMSDKDDFGGQTCLPVSELRPGIRAVPLYDKKGEKLK  873

Query  210  SVRLLMRFTFV  178
            SVRLLM+F F+
Sbjct  874  SVRLLMQFRFI  884



>emb|CAC81703.2| phospholipase C [Oryza sativa]
Length=280

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQG+ ++L LMQG FR NGGCGYVKKPDFL++     EVFDP A++PV
Sbjct  90   AWTHGAQMVAFNMQGHDKALRLMQGFFRANGGCGYVKKPDFLLRTGPNGEVFDPNASMPV  149

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DF +THFD +SPPDFYTRVGIAGV AD  M KT+  ED W P+W
Sbjct  150  KKTLKVKVYMGDGWRMDFSKTHFDTFSPPDFYTRVGIAGVRADCVMKKTRTIEDQWVPMW  209

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELA+LRIEVHEYDMSEK DF GQTCLPVSEL+ GIRAV L +R+G  Y 
Sbjct  210  DEEFTFPLTVPELAVLRIEVHEYDMSEKHDFGGQTCLPVSELKQGIRAVPLHDRRGTRYK  269

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  270  SVRLLMRFDFL  280



>ref|XP_002316213.2| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEF02384.2| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=595

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQM+AFNMQGYG+SLWLM GMFR NGGCGY+KKPDFL++     EVFDP+  L V
Sbjct  405  GWMHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYLKKPDFLMEKGPNNEVFDPKIKLAV  464

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
             KTLKVKVY+GDGW LDF  THFD YSPPDFYT+V I G PAD    KTK  EDNW+P W
Sbjct  465  TKTLKVKVYLGDGWRLDFSHTHFDSYSPPDFYTKVYIVGAPADAAKKKTKIIEDNWSPAW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EFTFPLTVPELALLRIEV EYDMSEKDDF GQTCLPVS+LRPGIR+V L ++KGE   
Sbjct  525  NQEFTFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSDLRPGIRSVPLHDKKGEKLK  584

Query  210  SVRLLMRFTFV  178
            +VRLL+ F FV
Sbjct  585  NVRLLVGFQFV  595



>ref|XP_010106260.1| Phosphoinositide phospholipase C 6 [Morus notabilis]
 gb|EXC09417.1| Phosphoinositide phospholipase C 6 [Morus notabilis]
Length=599

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM+G QMVAFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL++     EVFDP+ TLPV
Sbjct  409  GWMYGVQMVAFNMQGYGKSLWLMHGMFRANGGCGYVKKPEFLMQKGPRNEVFDPKRTLPV  468

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW LDF QTHFD YSPPDFYT+V I GVPAD    KT+   D+W P+W
Sbjct  469  KKTLKVKVYMGDGWRLDFSQTHFDTYSPPDFYTKVYIVGVPADCAKNKTRIIADDWAPIW  528

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTFPLTVPELALLRIEV EYD SEKDDF GQTCLPVS+L+PGIRAV L ++KG+   
Sbjct  529  DEEFTFPLTVPELALLRIEVREYDRSEKDDFGGQTCLPVSDLKPGIRAVPLYDKKGDKLK  588

Query  210  SVRLLMRFTFV  178
            SV+LLMRF F+
Sbjct  589  SVKLLMRFQFL  599



>ref|XP_010658272.1| PREDICTED: phosphoinositide phospholipase C 6 [Vitis vinifera]
 emb|CBI25478.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLWLM GMFR NGGCGY+KKPDFL+K     EVF+P+ATLPV
Sbjct  402  GWMHGAQMVAFNMQGYGKSLWLMHGMFRCNGGCGYIKKPDFLMKKGPCREVFNPKATLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K  LKV VYMGDGW LDF  THFD YSPPDFYT++ I GVPAD    KTK   +NW PVW
Sbjct  462  KTILKVGVYMGDGWSLDFSPTHFDTYSPPDFYTKIHIVGVPADNTKRKTKIINNNWFPVW  521

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F F LTVPELALLRIEV E+D SEKDDF GQTCLPVSELRPGIR+V L ++KGE Y 
Sbjct  522  DEAFIFSLTVPELALLRIEVREHDRSEKDDFGGQTCLPVSELRPGIRSVPLFDKKGEKYK  581

Query  210  SVRLLMRFTFV  178
            SVRLLM F F+
Sbjct  582  SVRLLMEFEFL  592



>ref|XP_011046045.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=586

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLMQGMFR NGGCG+VKKP FL+K     EVFD +A LP 
Sbjct  396  GWMHGAQMVAFNMQGHGRSLWLMQGMFRANGGCGFVKKPSFLLKSGPHGEVFDTKAKLPK  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            +KTLKVK+YMG+GW+ DF  THFD YSPPDFY RVGIAGVPAD  M KTK  ED+W P W
Sbjct  456  QKTLKVKIYMGEGWYYDFHHTHFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDSWIPYW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y 
Sbjct  516  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELREGIRAVPLHDRKGERYK  575

Query  210  SVRLLMRFTFV  178
             V+LL+R  FV
Sbjct  576  CVKLLVRLEFV  586



>gb|KJB67579.1| hypothetical protein B456_010G197900 [Gossypium raimondii]
Length=578

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GWMHGAQMVAFNMQGYGRSLWLM GM + NGGCGY+KKPDFL+   +VFDP   LPVKK 
Sbjct  389  GWMHGAQMVAFNMQGYGRSLWLMHGMLKANGGCGYLKKPDFLLNPNKVFDPNVKLPVKKI  448

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKV +YMG+GW+ DF  THFD YSPPDFY RVGIAGVP D  M KTK  EDNW P W EE
Sbjct  449  LKVTMYMGEGWYYDFHHTHFDAYSPPDFYARVGIAGVPFDSVMKKTKTLEDNWVPCWNEE  508

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F F LTVPELALLR+EVHEYDMSEKDDF GQTCLP+SELR GIRAV L +RKGE Y+SV+
Sbjct  509  FEFCLTVPELALLRVEVHEYDMSEKDDFGGQTCLPISELRSGIRAVPLNSRKGEKYSSVK  568

Query  201  LLMRFTF  181
            LLMRF F
Sbjct  569  LLMRFEF  575



>ref|NP_001234203.1| PI-phospholipase C PLC1 [Solanum lycopersicum]
 gb|ABW81003.1| PI-phospholipase C PLC1 [Solanum lycopersicum]
Length=601

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHG QMVAFN+QG+GR LWLMQGMFR NGGCGYVKKP+ L+K     EV DP+  L V
Sbjct  405  GWMHGTQMVAFNIQGHGRPLWLMQGMFRANGGCGYVKKPELLLKTDANNEVHDPKRLLSV  464

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMG GWHLDFK+THFD YSPPDFY ++GIAGVPAD ++ KTK  EDNW P W
Sbjct  465  KTTLKVKVYMGKGWHLDFKRTHFDAYSPPDFYVKIGIAGVPADSRVKKTKAIEDNWIPTW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             +EF FPLTVPELALLR+EVHEYDMSE DDF GQTC+PVSELR GIRAV + N KGE Y 
Sbjct  525  NDEFEFPLTVPELALLRVEVHEYDMSEIDDFGGQTCIPVSELRTGIRAVPIYNEKGEKYP  584

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  585  SVKLLMCFEFV  595



>ref|XP_009123935.1| PREDICTED: phosphoinositide phospholipase C 2 [Brassica rapa]
Length=581

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  391  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDSDIFDPKATLPV  450

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  451  KTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWVPSW  510

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIR+  L +RKGE Y 
Sbjct  511  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELQEGIRSFPLHSRKGEKYK  570

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  571  SVKLLVRCEFV  581



>ref|XP_010067519.1| PREDICTED: phosphoinositide phospholipase C 2-like [Eucalyptus 
grandis]
 gb|KCW65669.1| hypothetical protein EUGRSUZ_G03056 [Eucalyptus grandis]
 gb|KCW65670.1| hypothetical protein EUGRSUZ_G03056 [Eucalyptus grandis]
Length=600

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPDFL+K     ++FDP++ LPV
Sbjct  404  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDFLLKSGPLNDLFDPKSPLPV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K  LKV VYMG+GWH +F  THFDLYSPPDFY RVGIAGV AD  M KTK  EDNW PVW
Sbjct  464  KTKLKVTVYMGEGWHHEFDSTHFDLYSPPDFYARVGIAGVRADRVMKKTKTLEDNWIPVW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPVSELR G+R V L + KGE Y 
Sbjct  524  NEYFVFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGMRMVSLHDLKGEKYK  583

Query  210  SVRLLMRFTFV  178
             V+LLMRF F+
Sbjct  584  FVKLLMRFEFL  594



>ref|XP_010685546.1| PREDICTED: phosphoinositide phospholipase C 4-like [Beta vulgaris 
subsp. vulgaris]
Length=578

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 157/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GWMHGAQMVAFNMQGYGR LW M GMFR NGGCGYVKKP+FLV    VFDP+  LP++ T
Sbjct  391  GWMHGAQMVAFNMQGYGRWLWQMHGMFRANGGCGYVKKPEFLVDCDHVFDPKIKLPLETT  450

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVK+YMGDGW +DFK+THFD YSPPDFYT++GIAGV ADE M  T  K+D WTP+W EE
Sbjct  451  LKVKIYMGDGWRMDFKKTHFDKYSPPDFYTKIGIAGVRADETMQMTVVKDDQWTPIWNEE  510

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            FTFPLTVPELALLRIEVHEYD  +KDDF GQTCLPVSELR GI A+ L + KGE +NSV+
Sbjct  511  FTFPLTVPELALLRIEVHEYDNDKKDDFGGQTCLPVSELRAGIYAIPLYSHKGEKFNSVK  570

Query  201  LLMRFTFV  178
            LLMRF FV
Sbjct  571  LLMRFEFV  578



>emb|CDY20520.1| BnaC04g05240D [Brassica napus]
Length=608

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 153/192 (80%), Gaps = 7/192 (4%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAt--l  577
            GW+HGAQM+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR    +
Sbjct  416  GWIHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKIPV  475

Query  576  pvkktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTP  397
                   VKVYMGDGW LDF  THFD YSPPDFYT+V + GVPAD    KT+  EDNW P
Sbjct  476  KETMAFNVKVYMGDGWRLDFSHTHFDSYSPPDFYTKVYVVGVPADNAKRKTRVIEDNWYP  535

Query  396  VWEEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGEN  217
            +W+EEF+FPLTVPELALLRIEV EYDMS+KDDF GQTCLPVSELRPGIR+V L ++KGE 
Sbjct  536  IWDEEFSFPLTVPELALLRIEVSEYDMSDKDDFGGQTCLPVSELRPGIRSVPLYDKKGEK  595

Query  216  YNSVRLLMRFTF  181
              SV+LLMRF F
Sbjct  596  MKSVKLLMRFIF  607



>gb|KHN48566.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=600

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKP+FL++     EVF+P+A LPV
Sbjct  408  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLLETGPDDEVFNPKAKLPV  467

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ D K THFD YSPPDFYTRVGIAGVP D  M +TK  EDNW P W
Sbjct  468  KTTLKVTVYMGEGWYYDSKHTHFDQYSPPDFYTRVGIAGVPNDTIMKRTKAIEDNWLPTW  527

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPLTVPELALLRIEVHEYDMSEKDDF GQ CLP+ ELR GIRA+ L ++KG+ YN
Sbjct  528  NEVFEFPLTVPELALLRIEVHEYDMSEKDDFGGQACLPIWELRSGIRAIPLHSQKGDKYN  587

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  588  TVKLLMRFEFI  598



>ref|XP_002311222.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEE88589.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=590

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQM+AFNMQGYG+SLWLM GMFR NGGCGY+KKPDFL++     EVFDP+  LPV
Sbjct  400  GWMHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYLKKPDFLLEKGPNNEVFDPKTKLPV  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
             KTL VKVY+GDGW LDF  THFD YSPPDFYT+V I GVPAD    KTK  EDNW+P W
Sbjct  460  TKTLNVKVYLGDGWRLDFSHTHFDSYSPPDFYTKVYIVGVPADAAKRKTKIIEDNWSPAW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLR+EV EYDMS+KDDF GQTCLPV +LRPGIR+V L ++KGE   
Sbjct  520  NEEFTFPLTVPELALLRVEVQEYDMSDKDDFGGQTCLPVLDLRPGIRSVPLHDKKGEKLK  579

Query  210  SVRLLMRFTFV  178
            +VRLLM F FV
Sbjct  580  NVRLLMGFQFV  590



>ref|XP_009586599.1| PREDICTED: phosphoinositide phospholipase C 6-like [Nicotiana 
tomentosiformis]
Length=590

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M GMFR+NG CGYV+KP FL++     EVFDP+  LPV
Sbjct  400  GWMHGAQMVAFNMQGYGKSLWMMHGMFRSNGSCGYVRKPRFLMEKGPHNEVFDPKVKLPV  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTL+V+VYMGDGW LDF  THFD YSPPDFYT++ I GVPAD +  KT+  ED+W P+W
Sbjct  460  KKTLQVRVYMGDGWRLDFSHTHFDAYSPPDFYTKLYIVGVPADARKKKTRIIEDDWCPIW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KG+   
Sbjct  520  DEEFNFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVALYDKKGQKMK  579

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  580  SVKLLMRFQFV  590



>ref|XP_011045853.1| PREDICTED: phosphoinositide phospholipase C 6 isoform X1 [Populus 
euphratica]
 ref|XP_011042809.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Populus euphratica]
Length=614

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQM+AFNMQGYG+SLWLM GMFR NGGCGY+KKPDFL++     EVFDP+  LPV
Sbjct  424  GWMHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYLKKPDFLLEKGPNNEVFDPKTKLPV  483

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
             KTL VKVY+GDGW LDF  THFD YSPPDFYT+V I GVPAD    KTK  EDNW+P W
Sbjct  484  TKTLNVKVYLGDGWRLDFSHTHFDSYSPPDFYTKVYIVGVPADAAKRKTKIIEDNWSPAW  543

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELALLR+EV EYDMS+KDDF GQTCLPV +LRPGIR+V L ++KGE   
Sbjct  544  NEEFTFPLTVPELALLRVEVQEYDMSDKDDFGGQTCLPVLDLRPGIRSVPLHDKKGEKLK  603

Query  210  SVRLLMRFTFV  178
            +VRLLM F FV
Sbjct  604  NVRLLMGFQFV  614



>dbj|BAE71237.1| putative phosphoinositide specific phospholipase C [Trifolium 
pratense]
Length=603

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NG CGYVKKPDFL+K     EVFDP+A LP 
Sbjct  413  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGRCGYVKKPDFLLKPGPINEVFDPKAPLPA  472

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DFK THFD +SPPDFY R+GIAGVP D  M KTK  ED+W P W
Sbjct  473  KTTLKVTVYMGEGWYYDFKHTHFDQFSPPDFYARIGIAGVPFDTVMKKTKSIEDSWLPSW  532

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRA+ L +RKG+ YN
Sbjct  533  NEVFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRSGIRAIPLHSRKGDKYN  592

Query  210  SVRLLMRFTFV  178
            +V+LL+RF F+
Sbjct  593  NVKLLVRFEFI  603



>ref|XP_010464460.1| PREDICTED: phosphoinositide phospholipase C 2-like [Camelina 
sativa]
Length=586

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  396  AWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDNDIFDPKATLPV  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  456  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPGDTIMKKTKTLEDNWIPAW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV E++ GIRA  L NRKGE Y 
Sbjct  516  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWEIQEGIRAFPLHNRKGEKYK  575

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  576  SVKLLVRVEFV  586



>ref|XP_010505720.1| PREDICTED: phosphoinositide phospholipase C 6-like [Camelina 
sativa]
Length=184

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 153/183 (84%), Gaps = 5/183 (3%)
 Frame = -2

Query  714  MVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpvkktlkvk  550
            M+AFNMQGYG+SLWLM GMFR NGGCGYVKKP+FL+K     EVFDPR  LPVK+TLKVK
Sbjct  1    MIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPRKKLPVKETLKVK  60

Query  549  VYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEEFTFP  370
            VYMGDGW +DF  THFD YSPPDFYT++ I GVPAD    KTK  EDNW P+W+EEF+FP
Sbjct  61   VYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNAKRKTKIIEDNWYPIWDEEFSFP  120

Query  369  LTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVRLLMR  190
            LTVPELALLRIEV EYDMSEKDDF GQTCLPVSELRPGIR+V L ++KGE   SVRLLMR
Sbjct  121  LTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMR  180

Query  189  FTF  181
            F F
Sbjct  181  FIF  183



>ref|XP_010461812.1| PREDICTED: phosphoinositide phospholipase C 2 [Camelina sativa]
Length=584

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  394  AWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDNDIFDPKATLPV  453

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  454  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPGDTIMKKTKTLEDNWIPAW  513

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV E++ GIRA  L NRKGE Y 
Sbjct  514  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWEIQEGIRAFPLHNRKGEKYK  573

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  574  SVKLLVRVEFV  584



>ref|XP_011469918.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=595

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GW HGAQMVAFNMQG+GRSLW+MQGMFR NGGCGYV+KPDFL+   E+FDP+    VKKT
Sbjct  408  GWSHGAQMVAFNMQGHGRSLWVMQGMFRANGGCGYVRKPDFLLNTTEIFDPKQKSSVKKT  467

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVK+YMG+GW+ DFK THFD YSPPDFY RVGIAGV AD  M KTK  EDNW P W+EE
Sbjct  468  LKVKIYMGEGWYYDFKHTHFDAYSPPDFYARVGIAGVAADTIMKKTKTLEDNWIPAWDEE  527

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F FPLT PELA++RIEVHEYDMSEKDDF GQT LP+SEL+ GIRAV L +RKGE Y SV+
Sbjct  528  FEFPLTCPELAVIRIEVHEYDMSEKDDFGGQTSLPLSELKKGIRAVTLHDRKGEKYKSVK  587

Query  201  LLMRFTFV  178
            LLM F  V
Sbjct  588  LLMHFDLV  595



>ref|XP_006407765.1| hypothetical protein EUTSA_v10020359mg [Eutrema salsugineum]
 gb|ESQ49218.1| hypothetical protein EUTSA_v10020359mg [Eutrema salsugineum]
Length=590

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  400  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDNDIFDPKATLPV  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  460  KTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPVDTVMKKTKTLEDNWIPAW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIRA  L +RKGE Y 
Sbjct  520  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELQEGIRAFPLHSRKGEKYK  579

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  580  SVKLLVRCEFV  590



>gb|KFK27404.1| hypothetical protein AALP_AA8G378600 [Arabis alpina]
Length=593

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWM GAQM+AFNMQG+GR+LWLMQGMFR NGGCGYVKKPDFL+      EVFD       
Sbjct  403  GWMSGAQMIAFNMQGHGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGEVFDLNENSSP  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV MGDGW LDF +THFD YSPPDFY RVGIAG PADE M KTK K D WTP+W
Sbjct  463  KKTLKVKVCMGDGWQLDFNKTHFDNYSPPDFYVRVGIAGAPADEAMEKTKIKYDTWTPIW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTF LTVPELALLR+EVHEYD +EKDDF GQTCLPVSELR GIRAV L NRKGE Y+
Sbjct  523  NEEFTFQLTVPELALLRVEVHEYDKNEKDDFGGQTCLPVSELRQGIRAVLLFNRKGEKYS  582

Query  210  SVRLLMRFTFV  178
              RLLMRF FV
Sbjct  583  FTRLLMRFEFV  593



>ref|XP_006297293.1| hypothetical protein CARUB_v10013310mg [Capsella rubella]
 gb|EOA30191.1| hypothetical protein CARUB_v10013310mg [Capsella rubella]
Length=584

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  394  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDNDIFDPKATLPV  453

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  454  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPGDTIMKKTKTLEDNWVPSW  513

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL  GIRA  L  RKGE Y 
Sbjct  514  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELSEGIRAFPLHTRKGEKYK  573

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  574  SVKLLVRVEFV  584



>ref|XP_011469919.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=594

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK--EVFDPRAtlpvkkt  562
            GW HGAQMVAFNMQG+GRSLW+MQGMFR NGGCGYV+KPDFL+   E+FDP+    VKKT
Sbjct  407  GWSHGAQMVAFNMQGHGRSLWVMQGMFRANGGCGYVRKPDFLLNTTEIFDPKQKSSVKKT  466

Query  561  lkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEE  382
            LKVK+YMG+GW+ DFK THFD YSPPDFY RVGIAGV AD  M KTK  EDNW P W+EE
Sbjct  467  LKVKIYMGEGWYYDFKHTHFDAYSPPDFYARVGIAGVAADTIMKKTKTLEDNWIPAWDEE  526

Query  381  FTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYNSVR  202
            F FPLT PELA++RIEVHEYDMSEKDDF GQT LP+SEL+ GIRAV L +RKGE Y SV+
Sbjct  527  FEFPLTCPELAVIRIEVHEYDMSEKDDFGGQTSLPLSELKKGIRAVTLHDRKGEKYKSVK  586

Query  201  LLMRFTFV  178
            LLM F  V
Sbjct  587  LLMHFDLV  594



>ref|XP_010486390.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Camelina sativa]
Length=585

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  395  AWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDNDIFDPKATLPV  454

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  455  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPVDTIMKKTKTLEDNWIPSW  514

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV E++ GIRA  L NRKGE Y 
Sbjct  515  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWEIQEGIRAFPLHNRKGEKYK  574

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  575  SVKLLVRVEFV  585



>ref|XP_010685545.1| PREDICTED: phosphoinositide phospholipase C 4-like [Beta vulgaris 
subsp. vulgaris]
Length=582

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+G+ LWLM GMF+ NG CGYVKKPDFL+      +VFDP+A LPV
Sbjct  392  GWMHGAQMVAFNMQGHGKPLWLMHGMFKANGSCGYVKKPDFLMSIGPENQVFDPKADLPV  451

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVK+Y+GDGW  DFKQTHFD +SPPDFY +VGIAG PADE M KTK  ED+W P W
Sbjct  452  KITLKVKIYLGDGWREDFKQTHFDTFSPPDFYAKVGIAGAPADEVMKKTKVIEDHWRPAW  511

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF+FPL +PELALLRIEVHEYD ++KDDFAGQTCLPV EL+PGI AV +C+ KG+ Y 
Sbjct  512  NEEFSFPLKIPELALLRIEVHEYDKTDKDDFAGQTCLPVHELKPGIHAVPICDNKGKEYP  571

Query  210  SVRLLMRFTFV  178
            SV+LLM+FTFV
Sbjct  572  SVKLLMQFTFV  582



>ref|XP_010486391.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Camelina sativa]
Length=601

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  411  AWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDNDIFDPKATLPV  470

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  471  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPVDTIMKKTKTLEDNWIPSW  530

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV E++ GIRA  L NRKGE Y 
Sbjct  531  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWEIQEGIRAFPLHNRKGEKYK  590

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  591  SVKLLVRVEFV  601



>ref|XP_007016095.1| Phosphatidylinositol-speciwc phospholipase C4, putative isoform 
2 [Theobroma cacao]
 gb|EOY33714.1| Phosphatidylinositol-speciwc phospholipase C4, putative isoform 
2 [Theobroma cacao]
Length=597

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 164/192 (85%), Gaps = 6/192 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVA NMQGYG+SLWLM GMFR+NGGCGYVKKP+FL+      +VFDP+A LPV
Sbjct  402  GWMHGAQMVALNMQGYGKSLWLMHGMFRSNGGCGYVKKPEFLMNVGPNDQVFDPKAKLPV  461

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRV-GIAGVPAdekmmktkkkeDNWTPV  394
            KK LKVKVYMGDGWHLDFKQ H + +SPP+FYTRV GI GVPAD+ M KTKK+  NWT V
Sbjct  462  KKILKVKVYMGDGWHLDFKQRHLNHWSPPEFYTRVVGIEGVPADKTMRKTKKRNGNWTLV  521

Query  393  WEEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENY  214
            W+EEF +PLTVPE+ALLR+EVHEY+MSEKD FAGQTCLPVSELRPGIRAV L NRKGE +
Sbjct  522  WDEEFIYPLTVPEIALLRVEVHEYNMSEKDYFAGQTCLPVSELRPGIRAVPLFNRKGEKF  581

Query  213  NSVRLLMRFTFV  178
             S+ LLMRF FV
Sbjct  582  TSLGLLMRFEFV  593



>ref|NP_187464.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
 ref|NP_001030660.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
 sp|Q39033.1|PLCD2_ARATH RecName: Full=Phosphoinositide phospholipase C 2; AltName: Full=Phosphoinositide 
phospholipase PLC2; Short=AtPLC2; Short=PI-PLC2 
[Arabidopsis thaliana]
 gb|AAG50827.1|AC074395_1 phosphoinositide specific phospholipase (AtPLC2) [Arabidopsis 
thaliana]
 gb|AAK25916.1|AF360206_1 putative phosphoinositide specific phospholipase AtPLC2 [Arabidopsis 
thaliana]
 dbj|BAA09432.1| phosphoinositide specific phospholipase C [Arabidopsis thaliana]
 gb|AAK64112.1| putative phosphoinositide specific phospholipase PLC2 [Arabidopsis 
thaliana]
 dbj|BAH56972.1| AT3G08510 [Arabidopsis thaliana]
 gb|AEE74640.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
 gb|AEE74641.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
Length=581

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ATLPV
Sbjct  391  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDLLLKSGSDSDIFDPKATLPV  450

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V VYMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  451  KTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPGDTVMKKTKTLEDNWIPAW  510

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL  GIRA  L +RKGE Y 
Sbjct  511  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELSEGIRAFPLHSRKGEKYK  570

Query  210  SVRLLMRFTFV  178
            SV+LL++  FV
Sbjct  571  SVKLLVKVEFV  581



>ref|XP_010689655.1| PREDICTED: phosphoinositide phospholipase C 2 [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   267 bits (683),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             WMHGAQMVAFNMQGYGRSLWLMQGMFR NGGCGYVKKP+FL+      EVFDP+  LPV
Sbjct  399  AWMHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYVKKPNFLLNSGPNGEVFDPKVKLPV  458

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV VYMG+GW+ DFK THFD +SPPDFY RVGIAGV AD  M KTK  EDNW P W
Sbjct  459  KKTLKVTVYMGEGWYYDFKHTHFDQFSPPDFYVRVGIAGVAADTVMKKTKTLEDNWIPAW  518

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIR++ L +R+G  Y 
Sbjct  519  NEEFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELREGIRSIPLFSREGVKYK  578

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  579  SVKLLMHFQFV  589



>emb|CDY22153.1| BnaC01g39480D [Brassica napus]
Length=581

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ TLPV
Sbjct  391  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDSDIFDPKVTLPV  450

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  451  KTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWVPSW  510

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIR+  L +RKGE Y 
Sbjct  511  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELQEGIRSFPLHSRKGEKYK  570

Query  210  SVRLLMRFTFV  178
            SV+LL+R  FV
Sbjct  571  SVKLLVRCEFV  581



>gb|KHG10596.1| Phosphoinositide phospholipase C 4 [Gossypium arboreum]
Length=630

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKEVFD-PRAtlpvkktl  559
            GWMHGAQM+AFNMQGYGRSLWLMQGMFR NGGCGYVKKPDFL+    +  RA LPVKK L
Sbjct  397  GWMHGAQMIAFNMQGYGRSLWLMQGMFRANGGCGYVKKPDFLMNVGANGERAKLPVKKRL  456

Query  558  kvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVWEEEF  379
            +VKVYMGDGWHLDFK THFD YSPPDFYT+VGIAGVP DE M KTK KEDNWTPVW+EEF
Sbjct  457  RVKVYMGDGWHLDFKHTHFDTYSPPDFYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEF  516

Query  378  TFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGEN  217
            TFPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSEL+ GIRAV L +RKGE 
Sbjct  517  TFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELKQGIRAVPLFDRKGEK  570



>ref|XP_003600780.1| Phosphoinositide phospholipase C [Medicago truncatula]
 gb|AES71031.1| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=572

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLMQGMF+ NGGCG+VKKPDFL++     EVFDP+A LP 
Sbjct  382  GWMHGAQMVAFNMQGYGRSLWLMQGMFKANGGCGFVKKPDFLLQTGPNNEVFDPKAHLPS  441

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DFK THFD +S PDFY RVGIAGVP D  M KTK  +++W P W
Sbjct  442  KTTLKVTVYMGEGWYYDFKHTHFDQFSSPDFYARVGIAGVPFDTVMKKTKSTDNSWLPSW  501

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E F FPL+VPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L +R+G+ YN
Sbjct  502  NEVFEFPLSVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRNGIRAVPLHSREGDKYN  561

Query  210  SVRLLMRFTFV  178
            +V+LLMRF F+
Sbjct  562  NVKLLMRFEFI  572



>ref|XP_010031218.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Eucalyptus grandis]
Length=483

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 156/190 (82%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW +GAQMVA NMQG+GR LWLM GMFR NGGCGYVKKP+FL+K     EVFDP+A LPV
Sbjct  293  GWRYGAQMVALNMQGHGRPLWLMHGMFRANGGCGYVKKPEFLMKSGPDNEVFDPKAKLPV  352

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMG+GW+ DF +THFD YSPPDFY RVGIAGVPAD  M +TK  EDNWTP W
Sbjct  353  KTTLKVTVYMGEGWYYDFHRTHFDAYSPPDFYARVGIAGVPADTGMKRTKTWEDNWTPAW  412

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYD+SEKDDF GQTCLPV ELR GIR+V L N +GE Y 
Sbjct  413  NEEFEFPLTVPELALLRIEVHEYDVSEKDDFGGQTCLPVWELRRGIRSVPLHNYEGEKYP  472

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  473  SVRLLMRFEF  482



>gb|KJB55726.1| hypothetical protein B456_009G091700 [Gossypium raimondii]
Length=598

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVA NMQGYG+ LWLM GMF +NGGCGYVKKPDFL+      +VFD +A LPV
Sbjct  404  GWMHGAQMVALNMQGYGKPLWLMHGMFGSNGGCGYVKKPDFLMNVGPNDQVFDAKAKLPV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KK LKVKV+MGDGWHLDFKQ + +L+S P+FYTRVGIAGVPAD+ M KTKK++ NWT VW
Sbjct  464  KKILKVKVHMGDGWHLDFKQRYLNLWSSPEFYTRVGIAGVPADKTMKKTKKRKGNWTRVW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFTF LTVPE+ALLRIEVHEY+MSEKDDFAGQTCLPVSELRPG RAV L NRKGE Y 
Sbjct  524  DEEFTFQLTVPEIALLRIEVHEYNMSEKDDFAGQTCLPVSELRPGFRAVPLFNRKGEEYT  583

Query  210  SVRLLMRFTFV  178
            S+RLL+RF FV
Sbjct  584  SLRLLLRFEFV  594



>ref|XP_007008969.1| Phosphoinositide-specific phospholipase C family protein [Theobroma 
cacao]
 gb|EOY17779.1| Phosphoinositide-specific phospholipase C family protein [Theobroma 
cacao]
Length=597

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVKE-----VFDPRAtlpv  571
            GWMHGAQM+AFNMQGYG+SLWLM GMFR NGGCGYV+KPDFL+++     V DP+ TLPV
Sbjct  407  GWMHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVRKPDFLMQKGSHDVVLDPKITLPV  466

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            +K LKVK+YMGDGW LDF  THFD YSPPDFYT+V I GVPADE   KT+   D+W+PVW
Sbjct  467  QKMLKVKIYMGDGWRLDFSHTHFDTYSPPDFYTKVYIVGVPADEAKRKTRIIGDDWSPVW  526

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEFT+PLTVP+LALLRIEV EYDMSEKDDF GQTCLPVS+LRPGIR+V L ++KG+   
Sbjct  527  DEEFTYPLTVPDLALLRIEVREYDMSEKDDFGGQTCLPVSDLRPGIRSVPLHDKKGKKLP  586

Query  210  SVRLLMRFTFV  178
            + RLLM+F FV
Sbjct  587  NARLLMKFEFV  597



>gb|ABR16299.1| unknown [Picea sitchensis]
Length=597

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 156/193 (81%), Gaps = 8/193 (4%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV--------KEVFDPRAt  580
             W HGAQMVAFNMQGYGR LWL+ G FR NGGCGYVKKPDFL+        + +FDP+A 
Sbjct  404  AWTHGAQMVAFNMQGYGRQLWLVHGFFRANGGCGYVKKPDFLLPNGSENDDQHIFDPKAP  463

Query  579  lpvkktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWT  400
             PVK TLKVK+YMGDGW+ +FK+THFD YSPPDFYTRVGIAGVPAD  M +T+  ED+W 
Sbjct  464  RPVKTTLKVKIYMGDGWNQEFKKTHFDTYSPPDFYTRVGIAGVPADTIMKRTRAIEDDWF  523

Query  399  PVWEEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGE  220
            P W EEF FPLTVPELA+LR+EVHEYDMSEKDDF GQTC+PV+EL+ GIR + LCN+KGE
Sbjct  524  PCWNEEFVFPLTVPELAVLRVEVHEYDMSEKDDFGGQTCVPVAELKSGIRTIPLCNKKGE  583

Query  219  NYNSVRLLMRFTF  181
             Y SVRLL+R  F
Sbjct  584  KYKSVRLLVRIDF  596



>ref|XP_002526337.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF36008.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=551

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLM+GMF+ NGGCGYVKKPDFL+K     EVFDPRA LPV
Sbjct  361  GWMHGAQMVAFNMQGHGRSLWLMRGMFKANGGCGYVKKPDFLLKCSPHGEVFDPRAELPV  420

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKVKVYMGDGW+ DF +  FD++S PDFY RVGIAGVPAD +M KT+  +DNWTPVW
Sbjct  421  KTTLKVKVYMGDGWYNDFHEPGFDVFSEPDFYVRVGIAGVPADTEMKKTETVDDNWTPVW  480

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALL++EV+E+DMS+KDDF GQTCLPVSELR GIRAV L + +G  YN
Sbjct  481  NEEFEFPLTVPELALLQVEVNEHDMSQKDDFGGQTCLPVSELRRGIRAVPLHDSEGVKYN  540

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  541  SVKLLMHFDFV  551



>gb|ABR16641.1| unknown [Picea sitchensis]
Length=597

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 156/193 (81%), Gaps = 8/193 (4%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV--------KEVFDPRAt  580
             W HGAQMVAFNMQGYGR LWL+ G FR NGGCGYVKKPDFL+        + +FDP+A 
Sbjct  404  AWTHGAQMVAFNMQGYGRQLWLVHGFFRANGGCGYVKKPDFLLPNGSENDDQHIFDPKAP  463

Query  579  lpvkktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWT  400
             PVK TLKVK+YMGDGW+ +FK+THFD YSPPDFYTRVGIAGVPAD  M +T+  ED+W 
Sbjct  464  RPVKTTLKVKIYMGDGWNQEFKKTHFDTYSPPDFYTRVGIAGVPADTIMKRTRAIEDDWF  523

Query  399  PVWEEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGE  220
            P W EEF FPLTVPELA+LR+EVHEYDMSEKDDF GQTC+PV+EL+ GIR + LCN+KGE
Sbjct  524  PCWNEEFVFPLTVPELAVLRVEVHEYDMSEKDDFGGQTCVPVAELKSGIRTIPLCNKKGE  583

Query  219  NYNSVRLLMRFTF  181
             Y SVRLL+R  F
Sbjct  584  KYKSVRLLVRIDF  596



>gb|AAD26119.1|AF108123_1 phosphoinositide-specific phospholipase C [Brassica napus]
Length=581

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     ++FDP+ TLPV
Sbjct  391  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKGGSDSDIFDPKTTLPV  450

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVPAD  M KTK  EDNW P W
Sbjct  451  KTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWVPSW  510

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL+ GIR+  L NRK E Y 
Sbjct  511  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELQEGIRSFPLHNRKEEKYK  570

Query  210  SVRLLMRFTFV  178
            SV+LL++  FV
Sbjct  571  SVKLLVKVEFV  581



>ref|XP_011084908.1| PREDICTED: phosphoinositide phospholipase C 6 [Sesamum indicum]
Length=588

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 158/190 (83%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M G+FR+NGGCGYVKKPD L+      EVFDP+ TLPV
Sbjct  398  GWMHGAQMVAFNMQGYGKSLWMMHGLFRSNGGCGYVKKPDLLMMGGPDNEVFDPKLTLPV  457

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKV V+MGDGW LDF  THFD YSPPDFYT++ I GVPAD    KT+  ED+WTP W
Sbjct  458  KKTLKVTVFMGDGWRLDFSHTHFDAYSPPDFYTKIYIVGVPADAAKKKTRVIEDDWTPYW  517

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRIEV E++ SEKDDF GQTCLPVSELRPGIRAV L N+KG+ + 
Sbjct  518  DEDFAFPLTVPELALLRIEVREHNRSEKDDFGGQTCLPVSELRPGIRAVPLYNKKGQKFK  577

Query  210  SVRLLMRFTF  181
            SVRLLMRF F
Sbjct  578  SVRLLMRFQF  587



>ref|XP_011042811.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=586

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQG+GRSLWLMQGMFR NGGCG+VKKP FL+K     EVFD +A LP 
Sbjct  396  GWMHGAQMVAFNMQGHGRSLWLMQGMFRANGGCGFVKKPSFLLKSGPHGEVFDTKAKLPK  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            +KTLKVK+YMG+GW  DF+ T+FD YSPPDFY RVGIAGVPAD  M KTK  ED+W P W
Sbjct  456  QKTLKVKIYMGEGWFYDFQHTYFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDSWIPYW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELALLRIEVHEYDMSEKDDF GQTCLPV ELR GIRAV L +RKGE Y 
Sbjct  516  NEEFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELREGIRAVPLHDRKGERYK  575

Query  210  SVRLLMRFTFV  178
             V+LL+R  FV
Sbjct  576  CVKLLVRLEFV  586



>ref|XP_008369254.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Malus domestica]
Length=595

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW +GAQMVAFNMQGYGR LW+MQGMFR NG CGYVKKPDFL+K     EVFDP+ +LPV
Sbjct  405  GWSYGAQMVAFNMQGYGRPLWVMQGMFRANGRCGYVKKPDFLLKSGPHNEVFDPKYSLPV  464

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMG+GW+ DFK THFD YSPPDFYTRVGIAGV  D  M KTK  EDNW P W
Sbjct  465  KKTLKVKVYMGEGWYYDFKHTHFDAYSPPDFYTRVGIAGVADDSVMKKTKALEDNWIPAW  524

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELA+LRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L   KGE Y 
Sbjct  525  NEEFEFPLTVPELAVLRIEVHEYDMSEKDDFGGQTCLPVSELRRGIRAVPLHCPKGEKYK  584

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  585  SVKLLMHFDFV  595



>ref|XP_008369255.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Malus domestica]
Length=594

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW +GAQMVAFNMQGYGR LW+MQGMFR NG CGYVKKPDFL+K     EVFDP+ +LPV
Sbjct  404  GWSYGAQMVAFNMQGYGRPLWVMQGMFRANGRCGYVKKPDFLLKSGPHNEVFDPKYSLPV  463

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMG+GW+ DFK THFD YSPPDFYTRVGIAGV  D  M KTK  EDNW P W
Sbjct  464  KKTLKVKVYMGEGWYYDFKHTHFDAYSPPDFYTRVGIAGVADDSVMKKTKALEDNWIPAW  523

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEF FPLTVPELA+LRIEVHEYDMSEKDDF GQTCLPVSELR GIRAV L   KGE Y 
Sbjct  524  NEEFEFPLTVPELAVLRIEVHEYDMSEKDDFGGQTCLPVSELRRGIRAVPLHCPKGEKYK  583

Query  210  SVRLLMRFTFV  178
            SV+LLM F FV
Sbjct  584  SVKLLMHFDFV  594



>ref|XP_002884682.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60941.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=564

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLMQGMFR NGGCGY+KKPD L+K     E+FDP+ TLPV
Sbjct  374  GWSHGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKSGSDSEIFDPKVTLPV  433

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TL+V +YMG+GW+ DF+ THFD YSPPDFYTRVGIAGVP D  M KTK  EDNW P W
Sbjct  434  KTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFYTRVGIAGVPGDTIMKKTKTLEDNWIPAW  493

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E F FPLTVPELALLR+EVHEYDMSEKDDF GQTCLPV EL  GIR+  L +RKGE Y 
Sbjct  494  DEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELSGGIRSFPLHSRKGEKYK  553

Query  210  SVRLLMRFTFV  178
            SV+LL++  FV
Sbjct  554  SVKLLVKVEFV  564



>gb|KFK27411.1| hypothetical protein AALP_AA8G379300 [Arabis alpina]
Length=591

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+ GAQM+AFN+QGYGR+LWLMQGMFR NGGCGYVKKPDFL+      +VFDP+  LP 
Sbjct  401  GWLSGAQMMAFNIQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGQVFDPKENLPP  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV  GDGW+LDF +THFDLYSPPDFY +VGIAG PADE M KTK +ED W PVW
Sbjct  461  KKTLKVKVCKGDGWNLDFNKTHFDLYSPPDFYVKVGIAGAPADEVMQKTKVEEDTWKPVW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLT+PELALLR+EV+++D  EKDDF GQTCLPVSELR GIRAV L ++KGE YN
Sbjct  521  NEEFTFPLTIPELALLRVEVYDFDNGEKDDFGGQTCLPVSELRQGIRAVPLFDQKGEKYN  580

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  581  STRLLMRFEFV  591



>gb|KFK27410.1| hypothetical protein AALP_AA8G379300 [Arabis alpina]
Length=593

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+ GAQM+AFN+QGYGR+LWLMQGMFR NGGCGYVKKPDFL+      +VFDP+  LP 
Sbjct  403  GWLSGAQMMAFNIQGYGRALWLMQGMFRANGGCGYVKKPDFLMNVGPNGQVFDPKENLPP  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKV  GDGW+LDF +THFDLYSPPDFY +VGIAG PADE M KTK +ED W PVW
Sbjct  463  KKTLKVKVCKGDGWNLDFNKTHFDLYSPPDFYVKVGIAGAPADEVMQKTKVEEDTWKPVW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLT+PELALLR+EV+++D  EKDDF GQTCLPVSELR GIRAV L ++KGE YN
Sbjct  523  NEEFTFPLTIPELALLRVEVYDFDNGEKDDFGGQTCLPVSELRQGIRAVPLFDQKGEKYN  582

Query  210  SVRLLMRFTFV  178
            S RLLMRF FV
Sbjct  583  STRLLMRFEFV  593



>ref|NP_001234197.1| PI-phospholipase C PLC2 [Solanum lycopersicum]
 gb|ABW81002.1| PI-phospholipase C PLC2 [Solanum lycopersicum]
Length=561

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 156/190 (82%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+K     EVFDP A LPV
Sbjct  371  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLKAGPDNEVFDPTANLPV  430

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QT FD YSPPDFY ++GIAGVPADE   +T+  +DNW P W
Sbjct  431  KTTLKVTVYMGDGWDKDFDQTDFDTYSPPDFYAKLGIAGVPADEVKKRTETIDDNWIPSW  490

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E+F FPLTVPELALLRI+V +Y++S+KD+FAGQTCLPV+ELR GIRAV L +RKGE Y+
Sbjct  491  NEQFEFPLTVPELALLRIKVLDYNLSDKDEFAGQTCLPVAELRQGIRAVPLYDRKGEKYS  550

Query  210  SVRLLMRFTF  181
            SV+LLM F F
Sbjct  551  SVKLLMHFEF  560



>ref|XP_009794867.1| PREDICTED: phosphoinositide phospholipase C 6-like [Nicotiana 
sylvestris]
 ref|XP_009794868.1| PREDICTED: phosphoinositide phospholipase C 6-like [Nicotiana 
sylvestris]
Length=590

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GW+HGAQMVAFNMQGYG+SLW+MQGMFR+NG CGYV+KP FL++     EVFDP+  LPV
Sbjct  400  GWIHGAQMVAFNMQGYGKSLWMMQGMFRSNGSCGYVRKPRFLMEKGPRNEVFDPKVKLPV  459

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KK L+V+VYMGDGW LDF  THFD YSPPDFYT++ I GVPAD    KT+  ED+W P+W
Sbjct  460  KKILQVRVYMGDGWRLDFSHTHFDAYSPPDFYTKLYIVGVPADAHKKKTRIIEDDWCPIW  519

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEV EYDMSEKDDF GQTCLPV ELRPGIR+V L ++KG+   
Sbjct  520  DEEFNFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVWELRPGIRSVALYDKKGQKMK  579

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  580  SVKLLMRFQFV  590



>ref|XP_006664643.1| PREDICTED: phosphoinositide phospholipase C 6-like [Oryza brachyantha]
Length=557

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMVAFNMQG+ ++L LMQG FR NGGCGYVKKPDFLV+     EVFDP A++PV
Sbjct  367  AWTHGAQMVAFNMQGHDKALRLMQGFFRANGGCGYVKKPDFLVRTGPNGEVFDPNASMPV  426

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTLKVKVYMGDGW +DF +THFD +SPPDFYTRVGIAGV AD  M KT+  ED W PVW
Sbjct  427  KKTLKVKVYMGDGWRMDFSKTHFDTFSPPDFYTRVGIAGVRADCVMKKTQTIEDQWVPVW  486

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             EEFTFPLTVPELA+LRIEVHEYDMSEK DF GQTCLPVSEL+ GIRAV L +R+G  Y 
Sbjct  487  NEEFTFPLTVPELAVLRIEVHEYDMSEKHDFGGQTCLPVSELKQGIRAVPLHDRRGNRYK  546

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  547  SVRLLMRFDFL  557



>ref|XP_009586600.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=561

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+      EVFDP   LPV
Sbjct  371  GWTHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLTAGPNNEVFDPTKKLPV  430

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QTHFD YSPPDFY +VGIAGVPAD    KTK  +DNW P W
Sbjct  431  KTTLKVTVYMGDGWDKDFDQTHFDTYSPPDFYAKVGIAGVPADAIKKKTKTMDDNWIPTW  490

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRI+V +Y+ S+KD+FAGQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  491  DEQFEFPLTVPELALLRIKVLDYNRSDKDEFAGQTCLPVPELRQGIRAVPLFDRKGEKYS  550

Query  210  SVRLLMRFTFV  178
            SV+L MRF FV
Sbjct  551  SVKLFMRFEFV  561



>ref|XP_009586601.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana tomentosiformis]
Length=560

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+      EVFDP   LPV
Sbjct  370  GWTHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLTAGPNNEVFDPTKKLPV  429

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QTHFD YSPPDFY +VGIAGVPAD    KTK  +DNW P W
Sbjct  430  KTTLKVTVYMGDGWDKDFDQTHFDTYSPPDFYAKVGIAGVPADAIKKKTKTMDDNWIPTW  489

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRI+V +Y+ S+KD+FAGQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  490  DEQFEFPLTVPELALLRIKVLDYNRSDKDEFAGQTCLPVPELRQGIRAVPLFDRKGEKYS  549

Query  210  SVRLLMRFTFV  178
            SV+L MRF FV
Sbjct  550  SVKLFMRFEFV  560



>gb|AJA33385.1| phosphatidylinositol phospholipase C 5 [Solanum lycopersicum]
Length=593

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M GMFR+NG CGYVKKP FL+      EVFDP+  LPV
Sbjct  403  GWMHGAQMVAFNMQGYGKSLWMMHGMFRSNGSCGYVKKPQFLMDKGPNNEVFDPKVKLPV  462

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K+TL+V+VYMGDGW LDF  THFD YSPPDFYT++ + GVPAD +  KT+  ED+W PVW
Sbjct  463  KQTLQVRVYMGDGWRLDFSHTHFDAYSPPDFYTKLYLVGVPADSRKKKTRILEDDWCPVW  522

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELR GIR+V L ++KG    
Sbjct  523  DEEFNFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRTGIRSVPLYDKKGHKMK  582

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  583  SVRLLMRFQFL  593



>ref|XP_010322097.1| PREDICTED: PI-phospholipase C PLC2 isoform X1 [Solanum lycopersicum]
Length=560

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 156/190 (82%), Gaps = 5/190 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+K     EVFDP A LPV
Sbjct  370  GWMHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLKAGPDNEVFDPTANLPV  429

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QT FD YSPPDFY ++GIAGVPADE   +T+  +DNW P W
Sbjct  430  KTTLKVTVYMGDGWDKDFDQTDFDTYSPPDFYAKLGIAGVPADEVKKRTETIDDNWIPSW  489

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
             E+F FPLTVPELALLRI+V +Y++S+KD+FAGQTCLPV+ELR GIRAV L +RKGE Y+
Sbjct  490  NEQFEFPLTVPELALLRIKVLDYNLSDKDEFAGQTCLPVAELRQGIRAVPLYDRKGEKYS  549

Query  210  SVRLLMRFTF  181
            SV+LLM F F
Sbjct  550  SVKLLMHFEF  559



>gb|AAF33823.1|AF223351_1 phospholipase C1 [Nicotiana tabacum]
Length=586

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 6/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLVK-----EVFDPRAtlpv  571
             W HGAQMV  +MQGYGRSLWLM GMFR+NGGCGYVKKPD L+K     ++FDP A LPV
Sbjct  397  AWTHGAQMV-HHMQGYGRSLWLMHGMFRSNGGCGYVKKPDILLKAGPNNQIFDPEANLPV  455

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV V+MG+GW++DFK THFD Y+PPDFY ++GIAGVPAD  M KTK  ED  TP W
Sbjct  456  KTTLKVTVFMGEGWYIDFKHTHFDAYTPPDFYAKIGIAGVPADNVMKKTKTLEDMDTPTW  515

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLR+EVHEYDMSEKDDFAGQTCLPVSELR GIRAV L +RKGE YN
Sbjct  516  DEKFEFPLTVPELALLRVEVHEYDMSEKDDFAGQTCLPVSELRQGIRAVSLHDRKGEKYN  575

Query  210  SVRLLMRFTFV  178
            SV+LLMRF FV
Sbjct  576  SVKLLMRFEFV  586



>ref|XP_009783480.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana sylvestris]
Length=565

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+      EVFDP   LPV
Sbjct  375  GWTHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLTAGPNNEVFDPTKKLPV  434

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QTHFD YSPPDFY +VGIAGVPAD    KTK  +DNW P W
Sbjct  435  KTTLKVTVYMGDGWDKDFDQTHFDTYSPPDFYAKVGIAGVPADAIKKKTKTMDDNWIPTW  494

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRI+V +Y+ S+KD+FAGQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  495  DEQFEFPLTVPELALLRIKVLDYNRSDKDEFAGQTCLPVPELRQGIRAVPLFDRKGEKYS  554

Query  210  SVRLLMRFTFV  178
            SV+L MRF F+
Sbjct  555  SVKLFMRFEFI  565



>ref|XP_006338847.1| PREDICTED: phosphoinositide phospholipase C 6-like [Solanum tuberosum]
Length=591

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GWMHGAQMVAFNMQGYG+SLW+M GMFR+NG CGYVKKP FL+      EVFDP+  LPV
Sbjct  401  GWMHGAQMVAFNMQGYGKSLWMMHGMFRSNGSCGYVKKPQFLMDIGPHNEVFDPKVKLPV  460

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            KKTL+V+VYMGDGW LDF  THFD YSPPDFYT++ + GVPAD +  KT+  ED+W PVW
Sbjct  461  KKTLQVRVYMGDGWRLDFSHTHFDAYSPPDFYTKLYLVGVPADTRKKKTRILEDDWCPVW  520

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +EEF FPLTVPELALLRIEV EYDMSEKDDF GQTCLPVSELR GIR+V L ++KG    
Sbjct  521  DEEFNFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVSELRTGIRSVPLYDKKGHKMK  580

Query  210  SVRLLMRFTFV  178
            SVRLLMRF F+
Sbjct  581  SVRLLMRFQFL  591



>ref|XP_009783481.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana sylvestris]
Length=561

 Score =   264 bits (675),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+      EVFDP   LPV
Sbjct  371  GWTHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLTAGPNNEVFDPTKKLPV  430

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QTHFD YSPPDFY +VGIAGVPAD    KTK  +DNW P W
Sbjct  431  KTTLKVTVYMGDGWDKDFDQTHFDTYSPPDFYAKVGIAGVPADAIKKKTKTMDDNWIPTW  490

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRI+V +Y+ S+KD+FAGQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  491  DEQFEFPLTVPELALLRIKVLDYNRSDKDEFAGQTCLPVPELRQGIRAVPLFDRKGEKYS  550

Query  210  SVRLLMRFTFV  178
            SV+L MRF F+
Sbjct  551  SVKLFMRFEFI  561



>ref|XP_009783482.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Nicotiana sylvestris]
Length=560

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = -2

Query  735  GWMHGAQMVAFNMQGYGRSLWLMQGMFRTNGGCGYVKKPDFLV-----KEVFDPRAtlpv  571
            GW HGAQMVAFNMQGYGRSLWLM GMFR NGGCGYVKKPD L+      EVFDP   LPV
Sbjct  370  GWTHGAQMVAFNMQGYGRSLWLMHGMFRANGGCGYVKKPDLLLTAGPNNEVFDPTKKLPV  429

Query  570  kktlkvkVYMGDGWHLDFKQTHFDLYSPPDFYTRVGIAGVPAdekmmktkkkeDNWTPVW  391
            K TLKV VYMGDGW  DF QTHFD YSPPDFY +VGIAGVPAD    KTK  +DNW P W
Sbjct  430  KTTLKVTVYMGDGWDKDFDQTHFDTYSPPDFYAKVGIAGVPADAIKKKTKTMDDNWIPTW  489

Query  390  EEEFTFPLTVPELALLRIEVHEYDMSEKDDFAGQTCLPVSELRPGIRAVRLCNRKGENYN  211
            +E+F FPLTVPELALLRI+V +Y+ S+KD+FAGQTCLPV ELR GIRAV L +RKGE Y+
Sbjct  490  DEQFEFPLTVPELALLRIKVLDYNRSDKDEFAGQTCLPVPELRQGIRAVPLFDRKGEKYS  549

Query  210  SVRLLMRFTFV  178
            SV+L MRF F+
Sbjct  550  SVKLFMRFEFI  560



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500