BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004K18

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789263.1|  PREDICTED: putative kinase-like protein TMKL1    92.4    2e-18   Nicotiana sylvestris
ref|XP_009588520.1|  PREDICTED: putative kinase-like protein TMKL1    91.3    5e-18   Nicotiana tomentosiformis
ref|XP_010275393.1|  PREDICTED: putative kinase-like protein TMKL1    89.7    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004235179.1|  PREDICTED: putative kinase-like protein TMKL1    87.4    1e-16   Solanum lycopersicum
ref|XP_006358227.1|  PREDICTED: putative kinase-like protein TMKL...  87.0    1e-16   
gb|KDP22460.1|  hypothetical protein JCGZ_26291                       84.3    1e-15   Jatropha curcas
ref|XP_010258796.1|  PREDICTED: putative kinase-like protein TMKL1    82.8    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011076424.1|  PREDICTED: putative kinase-like protein TMKL1    82.8    5e-15   Sesamum indicum [beniseed]
emb|CDP05369.1|  unnamed protein product                              82.4    7e-15   Coffea canephora [robusta coffee]
ref|XP_010109114.1|  Putative kinase-like protein TMKL1               82.4    8e-15   Morus notabilis
ref|XP_010693739.1|  PREDICTED: putative kinase-like protein TMKL1    81.6    1e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010546136.1|  PREDICTED: putative kinase-like protein TMKL1    81.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_008453881.1|  PREDICTED: putative kinase-like protein TMKL1    79.3    8e-14   Cucumis melo [Oriental melon]
gb|AFK49119.1|  unknown                                               75.1    1e-13   Medicago truncatula
ref|XP_006385120.1|  hypothetical protein POPTR_0004s24110g           78.6    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011028462.1|  PREDICTED: putative kinase-like protein TMKL1    78.2    3e-13   Populus euphratica
ref|XP_007133478.1|  hypothetical protein PHAVU_011G181900g           77.8    3e-13   Phaseolus vulgaris [French bean]
ref|XP_002510997.1|  Nodulation receptor kinase precursor, putative   77.0    6e-13   Ricinus communis
gb|KDO45270.1|  hypothetical protein CISIN_1g038580mg                 76.6    7e-13   Citrus sinensis [apfelsine]
gb|EYU31309.1|  hypothetical protein MIMGU_mgv1a008745mg              76.6    7e-13   Erythranthe guttata [common monkey flower]
ref|XP_003531799.1|  PREDICTED: putative kinase-like protein TMKL...  76.6    7e-13   Glycine max [soybeans]
ref|XP_006585708.1|  PREDICTED: putative kinase-like protein TMKL...  76.6    7e-13   
ref|XP_006490173.1|  PREDICTED: putative kinase-like protein TMKL...  76.6    7e-13   Citrus sinensis [apfelsine]
ref|XP_010034989.1|  PREDICTED: putative kinase-like protein TMKL1    76.6    8e-13   Eucalyptus grandis [rose gum]
ref|XP_010062568.1|  PREDICTED: putative kinase-like protein TMKL1    76.6    8e-13   Eucalyptus grandis [rose gum]
gb|KJB51381.1|  hypothetical protein B456_008G214600                  76.3    9e-13   Gossypium raimondii
ref|XP_006421583.1|  hypothetical protein CICLE_v10005242mg           76.3    9e-13   Citrus clementina [clementine]
ref|XP_006399244.1|  hypothetical protein EUTSA_v10013915mg           76.3    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_007038297.1|  Kinase superfamily protein, putative             75.9    1e-12   
ref|XP_003628252.1|  MAP/microtubule affinity-regulating kinase       75.5    1e-12   
ref|XP_004511130.1|  PREDICTED: putative kinase-like protein TMKL...  75.9    2e-12   Cicer arietinum [garbanzo]
gb|EYU20189.1|  hypothetical protein MIMGU_mgv1a008951mg              75.9    2e-12   Erythranthe guttata [common monkey flower]
gb|AET02728.2|  receptor-like kinase                                  75.5    2e-12   Medicago truncatula
gb|KHN38152.1|  Putative kinase-like protein TMKL1                    75.5    2e-12   Glycine soja [wild soybean]
ref|NP_196379.1|  protein kinase family protein                       75.5    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146910.1|  PREDICTED: probable leucine-rich repeat rece...  75.1    2e-12   Cucumis sativus [cucumbers]
ref|XP_007218266.1|  hypothetical protein PRUPE_ppa008215mg           74.7    3e-12   
ref|XP_008234436.1|  PREDICTED: putative kinase-like protein TMKL1    75.1    3e-12   Prunus mume [ume]
gb|KHG13692.1|  Putative kinase-like protein TMKL1                    75.1    3e-12   Gossypium arboreum [tree cotton]
emb|CDY60499.1|  BnaCnng36410D                                        74.3    5e-12   Brassica napus [oilseed rape]
gb|AAR13701.1|  protein kinase                                        73.9    5e-12   Brassica oleracea
ref|XP_009362704.1|  PREDICTED: putative kinase-like protein TMKL1    73.6    8e-12   Pyrus x bretschneideri [bai li]
ref|XP_008376379.1|  PREDICTED: putative kinase-like protein TMKL1    73.6    9e-12   Malus domestica [apple tree]
ref|XP_010452731.1|  PREDICTED: putative kinase-like protein TMKL1    73.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009370434.1|  PREDICTED: putative kinase-like protein TMKL1    72.8    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_006289110.1|  hypothetical protein CARUB_v10002531mg           72.8    2e-11   Capsella rubella
ref|XP_009372839.1|  PREDICTED: putative kinase-like protein TMKL1    72.4    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_010919672.1|  PREDICTED: putative kinase-like protein TMKL1    72.0    3e-11   Elaeis guineensis
emb|CDY64669.1|  BnaA10g30230D                                        72.0    3e-11   Brassica napus [oilseed rape]
ref|XP_009122323.1|  PREDICTED: putative kinase-like protein TMKL1    71.6    4e-11   Brassica rapa
ref|XP_006598015.1|  PREDICTED: putative kinase-like protein TMKL...  71.6    4e-11   Glycine max [soybeans]
gb|AAR15503.1|  protein kinase                                        71.2    5e-11   Arabidopsis arenosa
gb|AAR15452.1|  protein kinase                                        71.2    6e-11   Arabidopsis arenosa
ref|XP_004307785.1|  PREDICTED: putative kinase-like protein TMKL1    70.5    1e-10   Fragaria vesca subsp. vesca
ref|XP_010491380.1|  PREDICTED: putative kinase-like protein TMKL1    70.1    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008802506.1|  PREDICTED: putative kinase-like protein TMKL1    70.1    1e-10   Phoenix dactylifera
gb|AFK46824.1|  unknown                                               65.1    2e-10   Medicago truncatula
ref|XP_010523204.1|  PREDICTED: putative kinase-like protein TMKL1    69.7    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_002873320.1|  protein kinase                                   69.7    2e-10   Arabidopsis lyrata subsp. lyrata
gb|EMT19579.1|  Putative kinase-like protein TMKL1                    67.8    4e-10   
gb|AAR15438.1|  protein kinase                                        68.6    5e-10   Sisymbrium irio
ref|XP_010423188.1|  PREDICTED: putative kinase-like protein TMKL1    68.2    7e-10   Camelina sativa [gold-of-pleasure]
gb|EMS55370.1|  Putative kinase-like protein TMKL1                    67.4    7e-10   Triticum urartu
ref|XP_011101106.1|  PREDICTED: putative kinase-like protein TMKL1    67.0    1e-09   Sesamum indicum [beniseed]
gb|AEW07404.1|  hypothetical protein 0_527_01                         62.8    2e-09   Pinus radiata
gb|AFG43841.1|  hypothetical protein 0_527_01                         62.8    2e-09   Pinus taeda
dbj|BAJ87469.1|  predicted protein                                    65.5    6e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972765.1|  hypothetical protein SELMODRAFT_173095           65.9    7e-09   Selaginella moellendorffii
ref|XP_002984340.1|  hypothetical protein SELMODRAFT_120346           65.9    7e-09   Selaginella moellendorffii
ref|XP_006837336.1|  hypothetical protein AMTR_s00111p00085260        64.7    9e-09   Amborella trichopoda
ref|XP_003570014.1|  PREDICTED: putative kinase-like protein TMKL1    65.1    9e-09   Brachypodium distachyon [annual false brome]
gb|ABR17460.1|  unknown                                               65.1    1e-08   Picea sitchensis
ref|XP_010933622.1|  PREDICTED: putative kinase-like protein TMKL1    64.3    1e-08   Elaeis guineensis
ref|XP_009402001.1|  PREDICTED: putative kinase-like protein TMKL1    63.2    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647625.1|  PREDICTED: putative kinase-like protein TMKL...  62.8    6e-08   Oryza brachyantha
emb|CAC39066.1|  putative protein                                     61.6    1e-07   Oryza sativa [red rice]
ref|XP_009389299.1|  PREDICTED: putative kinase-like protein TMKL1    61.6    1e-07   
ref|NP_001053480.1|  Os04g0548400                                     58.9    1e-07   
ref|NP_001047621.1|  Os02g0655800                                     61.6    1e-07   
gb|EMT22768.1|  Putative kinase-like protein TMKL1                    61.6    2e-07   
ref|XP_002452814.1|  hypothetical protein SORBIDRAFT_04g033010        60.5    3e-07   Sorghum bicolor [broomcorn]
ref|XP_009388875.1|  PREDICTED: putative kinase-like protein TMKL1    60.1    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002448282.1|  hypothetical protein SORBIDRAFT_06g024440        60.1    4e-07   Sorghum bicolor [broomcorn]
ref|NP_001167868.1|  uncharacterized LOC100381572                     60.1    4e-07   Zea mays [maize]
dbj|BAJ86003.1|  predicted protein                                    59.3    7e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT15407.1|  Putative kinase-like protein TMKL1                    58.2    9e-07   
emb|CDY02133.1|  BnaA03g40340D                                        58.5    1e-06   
ref|XP_006653645.1|  PREDICTED: putative kinase-like protein TMKL...  58.2    1e-06   
emb|CAH67615.1|  OSIGBa0106P14.5                                      58.5    1e-06   Oryza sativa [red rice]
gb|EEE61444.1|  hypothetical protein OsJ_15680                        58.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAI64491.1|  OSJNBa0065H10.10                                     58.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMS58728.1|  Probably inactive leucine-rich repeat receptor-li...  57.0    2e-06   Triticum urartu
ref|XP_003580275.1|  PREDICTED: putative kinase-like protein TMKL1    58.2    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_009136493.1|  PREDICTED: putative kinase-like protein TMKL...  57.8    2e-06   Brassica rapa
ref|XP_009136494.1|  PREDICTED: putative kinase-like protein TMKL...  57.8    2e-06   Brassica rapa
ref|XP_004976425.1|  PREDICTED: putative kinase-like protein TMKL...  57.8    2e-06   Setaria italica
ref|XP_009407822.1|  PREDICTED: putative kinase-like protein TMKL1    57.8    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006830618.1|  hypothetical protein AMTR_s00120p00076230        57.8    3e-06   Amborella trichopoda
emb|CDY23057.1|  BnaC07g31300D                                        57.4    3e-06   Brassica napus [oilseed rape]
dbj|BAB09001.1|  disease resistance protein kinase Pto-like protein   57.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200965.2|  protein kinase-like protein                         57.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078779.1|  protein kinase-like protein                      57.0    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414950.1|  hypothetical protein EUTSA_v10024625mg           57.0    5e-06   Eutrema salsugineum [saltwater cress]
ref|XP_004139717.1|  PREDICTED: putative kinase-like protein TMKL...  57.0    5e-06   
ref|XP_004953334.1|  PREDICTED: putative kinase-like protein TMKL...  57.0    5e-06   Setaria italica
gb|KGN44574.1|  hypothetical protein Csa_7G336530                     57.0    5e-06   Cucumis sativus [cucumbers]
ref|XP_004154481.1|  PREDICTED: LOW QUALITY PROTEIN: putative kin...  57.0    6e-06   
ref|XP_003571274.1|  PREDICTED: putative kinase-like protein TMKL1    56.6    8e-06   Brachypodium distachyon [annual false brome]
ref|XP_008457968.1|  PREDICTED: putative kinase-like protein TMKL...  56.2    9e-06   
ref|XP_008457969.1|  PREDICTED: putative kinase-like protein TMKL...  56.2    9e-06   
ref|XP_008457967.1|  PREDICTED: putative kinase-like protein TMKL...  56.2    9e-06   Cucumis melo [Oriental melon]
ref|XP_010684950.1|  PREDICTED: putative kinase-like protein TMKL1    55.8    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001151835.1|  protein Kinase-like protein TMKL1                55.5    1e-05   
ref|NP_001168329.1|  uncharacterized LOC100382097                     55.5    2e-05   Zea mays [maize]
ref|XP_007049845.1|  Transmembrane kinase-like 1 isoform 1            55.5    2e-05   Theobroma cacao [chocolate]
ref|XP_007049846.1|  Transmembrane kinase-like 1 isoform 2            55.5    2e-05   Theobroma cacao [chocolate]
ref|XP_010532869.1|  PREDICTED: putative kinase-like protein TMKL1    55.5    2e-05   Tarenaya hassleriana [spider flower]
gb|KDP26419.1|  hypothetical protein JCGZ_17577                       54.7    3e-05   Jatropha curcas
ref|XP_009131002.1|  PREDICTED: putative kinase-like protein TMKL1    54.3    3e-05   Brassica rapa
gb|KFK39767.1|  hypothetical protein AALP_AA3G285100                  54.3    4e-05   Arabis alpina [alpine rockcress]
ref|XP_010243991.1|  PREDICTED: putative kinase-like protein TMKL1    54.3    4e-05   Nelumbo nucifera [Indian lotus]
gb|KHF99201.1|  Putative kinase-like protein TMKL1                    53.9    5e-05   Gossypium arboreum [tree cotton]
ref|XP_010264034.1|  PREDICTED: putative kinase-like protein TMKL...  53.9    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010264035.1|  PREDICTED: putative kinase-like protein TMKL...  53.9    5e-05   Nelumbo nucifera [Indian lotus]
gb|KJB42427.1|  hypothetical protein B456_007G152400                  53.9    5e-05   Gossypium raimondii
gb|EAZ08043.1|  hypothetical protein OsI_30307                        52.4    6e-05   Oryza sativa Indica Group [Indian rice]
gb|EPS73747.1|  hypothetical protein M569_01008                       53.9    6e-05   Genlisea aurea
ref|XP_008663534.1|  PREDICTED: putative kinase-like protein TMKL1    53.5    7e-05   Zea mays [maize]
gb|KDO65868.1|  hypothetical protein CISIN_1g0057491mg                52.0    9e-05   Citrus sinensis [apfelsine]
ref|XP_010935684.1|  PREDICTED: putative kinase-like protein TMKL1    53.1    1e-04   Elaeis guineensis
ref|XP_009395304.1|  PREDICTED: putative kinase-like protein TMKL1    53.1    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010652466.1|  PREDICTED: putative kinase-like protein TMKL1    53.1    1e-04   Vitis vinifera
ref|XP_007140555.1|  hypothetical protein PHAVU_008G122400g           53.1    1e-04   Phaseolus vulgaris [French bean]
emb|CAN75299.1|  hypothetical protein VITISV_008676                   53.1    1e-04   Vitis vinifera
gb|EYU17973.1|  hypothetical protein MIMGU_mgv1a002458mg              52.8    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_002303085.2|  kinase-like protein TMKL1 precursor              52.4    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011024555.1|  PREDICTED: putative kinase-like protein TMKL1    52.4    2e-04   Populus euphratica
ref|XP_008382654.1|  PREDICTED: putative kinase-like protein TMKL1    52.4    2e-04   
ref|XP_004515613.1|  PREDICTED: putative kinase-like protein TMKL...  52.4    2e-04   Cicer arietinum [garbanzo]
ref|XP_010069673.1|  PREDICTED: putative kinase-like protein TMKL1    52.4    2e-04   Eucalyptus grandis [rose gum]
gb|KEH22828.1|  LRR receptor-like kinase                              52.0    2e-04   Medicago truncatula
ref|XP_009624535.1|  PREDICTED: putative kinase-like protein TMKL1    52.0    2e-04   Nicotiana tomentosiformis
ref|XP_008669060.1|  PREDICTED: putative kinase-like protein TMKL1    51.6    2e-04   Zea mays [maize]
ref|XP_009804998.1|  PREDICTED: putative kinase-like protein TMKL1    52.0    2e-04   Nicotiana sylvestris
ref|XP_006443656.1|  hypothetical protein CICLE_v10019548mg           52.0    3e-04   
ref|XP_010109686.1|  Putative kinase-like protein TMKL1               52.0    3e-04   Morus notabilis
ref|XP_002521132.1|  Serine/threonine-protein kinase PBS1, putative   52.0    3e-04   Ricinus communis
ref|XP_006480189.1|  PREDICTED: putative kinase-like protein TMKL...  52.0    3e-04   Citrus sinensis [apfelsine]
ref|XP_008789531.1|  PREDICTED: putative kinase-like protein TMKL1    51.6    3e-04   Phoenix dactylifera
gb|KHN25001.1|  Putative kinase-like protein TMKL1                    51.6    3e-04   Glycine soja [wild soybean]
gb|KHN07823.1|  Putative kinase-like protein TMKL1                    51.6    3e-04   Glycine soja [wild soybean]
ref|XP_010527218.1|  PREDICTED: LOW QUALITY PROTEIN: putative kin...  51.6    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_003551441.1|  PREDICTED: putative kinase-like protein TMKL...  51.6    4e-04   Glycine max [soybeans]
ref|XP_006350300.1|  PREDICTED: putative kinase-like protein TMKL...  51.6    4e-04   Solanum tuberosum [potatoes]
emb|CBI38658.3|  unnamed protein product                              51.6    4e-04   Vitis vinifera
dbj|BAD10321.1|  putative SERK2 protein                               51.2    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ43686.1|  hypothetical protein OsJ_28311                        51.2    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007201714.1|  hypothetical protein PRUPE_ppa003735mg           51.2    5e-04   
ref|NP_001062532.2|  Os08g0564700                                     51.2    5e-04   
ref|XP_008372436.1|  PREDICTED: putative kinase-like protein TMKL1    51.2    5e-04   
ref|XP_008235521.1|  PREDICTED: putative kinase-like protein TMKL1    50.8    5e-04   Prunus mume [ume]
emb|CDP03844.1|  unnamed protein product                              50.4    5e-04   Coffea canephora [robusta coffee]
ref|XP_009371182.1|  PREDICTED: putative kinase-like protein TMKL1    50.8    6e-04   Pyrus x bretschneideri [bai li]
ref|XP_011083107.1|  PREDICTED: putative kinase-like protein TMKL1    50.8    6e-04   Sesamum indicum [beniseed]
ref|XP_004292387.1|  PREDICTED: putative kinase-like protein TMKL1    50.8    7e-04   Fragaria vesca subsp. vesca
ref|XP_009349843.1|  PREDICTED: putative kinase-like protein TMKL1    50.4    8e-04   Pyrus x bretschneideri [bai li]
ref|XP_011080164.1|  PREDICTED: LOW QUALITY PROTEIN: putative kin...  50.4    8e-04   Sesamum indicum [beniseed]
ref|XP_006394491.1|  hypothetical protein EUTSA_v10004479mg           50.1    0.001   Eutrema salsugineum [saltwater cress]



>ref|XP_009789263.1| PREDICTED: putative kinase-like protein TMKL1 [Nicotiana sylvestris]
Length=358

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAV-EDHILELLRLAMDCCSPSPSLRP  571
            DI+LPN V++AI++ R+ D +HP +L   N ++ AV EDHI E L+LAM CCSPSP+LRP
Sbjct  285  DIYLPNAVQSAILDHRVIDFYHPKILLSQNEEQRAVSEDHIYEFLQLAMACCSPSPALRP  344

Query  570  TVKEFLTRLEEIER  529
            T+K+ +++LEEI R
Sbjct  345  TIKQVVSKLEEIGR  358



>ref|XP_009588520.1| PREDICTED: putative kinase-like protein TMKL1 [Nicotiana tomentosiformis]
Length=358

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            DI+LPN V++AI++ R+ D +HP ++L Q++ ++   EDHI E L+LAM CCSPSP+LRP
Sbjct  285  DIYLPNAVQSAILDHRVMDFYHPKILLSQNDEQRTVSEDHIYEFLQLAMACCSPSPALRP  344

Query  570  TVKEFLTRLEEIER  529
            T+K+ +++LEEI R
Sbjct  345  TIKQVVSKLEEIGR  358



>ref|XP_010275393.1| PREDICTED: putative kinase-like protein TMKL1 [Nelumbo nucifera]
Length=357

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLR  574
             D++LP+ ++NAI++ R++D+FHP +++ QSN +K  +E+H+L   +LAM CCSPSP+LR
Sbjct  283  QDLYLPSAMRNAILDHRLSDVFHPSLLINQSNDQKSVMEEHLLMFFQLAMACCSPSPTLR  342

Query  573  PTVKEFLTRLEEIER  529
            P +K+ LT+LEEI +
Sbjct  343  PDIKQVLTKLEEIGQ  357



>ref|XP_004235179.1| PREDICTED: putative kinase-like protein TMKL1 [Solanum lycopersicum]
Length=359

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVL--GQSNGKKEAVEDHILELLRLAMDCCSPSPSLR  574
            DI+LPN +++AI++ R+ D +HP +L     +G++   EDH+ E L+LA+ CCSPSP+LR
Sbjct  285  DIYLPNAIQSAILDHRVADFYHPQILVSKTDDGQRAVNEDHVYEFLQLAVACCSPSPALR  344

Query  573  PTVKEFLTRLEEIER  529
            PT+K+ L++LEEI +
Sbjct  345  PTIKQVLSKLEEIGK  359



>ref|XP_006358227.1| PREDICTED: putative kinase-like protein TMKL1-like [Solanum tuberosum]
Length=359

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVL--GQSNGKKEAVEDHILELLRLAMDCCSPSPSLR  574
            DI+LPN +++AI++ R+ D +HP +L     +G++   EDH+ E L+LA+ CCSPSP+LR
Sbjct  285  DIYLPNAIQSAILDHRVADFYHPQILVSQTDDGQRAINEDHVYEFLQLAVACCSPSPALR  344

Query  573  PTVKEFLTRLEEIER  529
            PT+K+ L++LEEI +
Sbjct  345  PTIKQVLSKLEEIGK  359



>gb|KDP22460.1| hypothetical protein JCGZ_26291 [Jatropha curcas]
Length=326

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVL--GQSNGKKEAVEDHILELLRLAMDCCSPSPSL  577
            DD  LP  ++NA+++ RITDL+HP +L   QS+ +K   E+ +L+  +LAM CCSPSPSL
Sbjct  251  DDFHLPTYMRNAVLDRRITDLYHPGILVSNQSDNEKLVTEECVLKFFQLAMACCSPSPSL  310

Query  576  RPTVKEFLTRLEEIER  529
            RP +K+ L +LEEI R
Sbjct  311  RPNIKQVLWKLEEIGR  326



>ref|XP_010258796.1| PREDICTED: putative kinase-like protein TMKL1 [Nelumbo nucifera]
Length=359

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLR  574
             D++LPN ++NAI++ + +D+FHP ++L + + +K  +E+ IL   +LAM CCSPSPSLR
Sbjct  285  QDLYLPNSMRNAILDQKFSDIFHPSLLLNEGSDQKSIMEERILMFFQLAMACCSPSPSLR  344

Query  573  PTVKEFLTRLEEIER  529
            P +K+ L +LEEI R
Sbjct  345  PDIKQVLIKLEEIGR  359



>ref|XP_011076424.1| PREDICTED: putative kinase-like protein TMKL1 [Sesamum indicum]
Length=359

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D +LP+ +++AI++DRI DL+HP ++LG SN +K A ED IL   +LAM CCSPS  LRP
Sbjct  286  DFYLPSAMRSAILDDRIADLYHPNILLGLSNDQKVATEDGILRYFQLAMACCSPSRLLRP  345

Query  570  TVKEFLTRLEEIER  529
             +KE L +LEEI +
Sbjct  346  DMKEILDKLEEIRK  359



>emb|CDP05369.1| unnamed protein product [Coffea canephora]
Length=359

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D  LPN ++ AI++D+IT+L+HP ++L +S+ ++   +D IL L +LAM CCSPSPSLRP
Sbjct  286  DFHLPNAIRTAILDDQITELYHPDIILNESSDQRVVTKDRILVLFQLAMACCSPSPSLRP  345

Query  570  TVKEFLTRLEEIER  529
             VK+ L +LEEI +
Sbjct  346  DVKQILRKLEEIGK  359



>ref|XP_010109114.1| Putative kinase-like protein TMKL1 [Morus notabilis]
 gb|EXC20955.1| Putative kinase-like protein TMKL1 [Morus notabilis]
Length=370

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = -2

Query  753  KDDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE----AVEDHILELLRLAMDCCSPS  586
            ++D +LPN ++NA++  RI DLFHP +L  S+G  +      E+ IL+  +LAM CCSPS
Sbjct  292  EEDFYLPNFLRNAVLGHRIADLFHPNILLTSSGTDDEQVPVSEERILKFFQLAMACCSPS  351

Query  585  PSLRPTVKEFLTRLEEIER  529
            PSLRP +K+ L +LEEI +
Sbjct  352  PSLRPNIKQVLWKLEEIGK  370



>ref|XP_010693739.1| PREDICTED: putative kinase-like protein TMKL1 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE-AVEDHILELLRLAMDCCSPSPSLR  574
            ++I+LPNV++ AI++ RI D++HP ++   +G+++   ED  L+L++LAM CCSPSPSLR
Sbjct  285  EEIYLPNVIRRAILDHRIKDMYHPDIVSNQSGRQQLRTEDRALKLVQLAMSCCSPSPSLR  344

Query  573  PTVKEFLTRLEEIER*Q  523
            P   E + ++EEI + Q
Sbjct  345  PQASEVVRKVEEIGKEQ  361



>ref|XP_010546136.1| PREDICTED: putative kinase-like protein TMKL1 [Tarenaya hassleriana]
 gb|AGU70139.1| protein kinase superfamily protein [Tarenaya hassleriana]
Length=363

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA++  R++DL+ P +LG  +G K+  E+H+L+  +LAM CCSPSPSLRP
Sbjct  292  DEFYLPDFMRNAVLYHRLSDLYRPQILG--SGLKDVTEEHVLKYFQLAMACCSPSPSLRP  349

Query  570  TVKEFLTRLEEIER  529
            + K+ L +L++I +
Sbjct  350  SFKQMLRKLKDIGK  363



>ref|XP_008453881.1| PREDICTED: putative kinase-like protein TMKL1 [Cucumis melo]
Length=357

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSN-GKKEAVEDHILELLRLAMDCCSPSPSLR  574
            +D +LPN ++NA++  RI DLFHP +L  SN       E+ IL+  +LAM CCSPSP+LR
Sbjct  283  EDFYLPNFMRNAVLGHRIADLFHPEILLYSNIDGNHVTEEKILKFFQLAMACCSPSPALR  342

Query  573  PTVKEFLTRLEEI  535
            P++K+ L +L EI
Sbjct  343  PSMKQVLRKLNEI  355



>gb|AFK49119.1| unknown [Medicago truncatula]
Length=110

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA++  RI+DL+HP +L +++   E    E+ +L+  +LAM CCSPSPS+
Sbjct  35   EDFYLPNFMRNAVLGHRISDLYHPAILLRNSIDDEIQVTEECVLKFFQLAMACCSPSPSI  94

Query  576  RPTVKEFLTRLEEI  535
            RP +K+ + +LEEI
Sbjct  95   RPNIKQVIRKLEEI  108



>ref|XP_006385120.1| hypothetical protein POPTR_0004s24110g [Populus trichocarpa]
 gb|ERP62917.1| hypothetical protein POPTR_0004s24110g [Populus trichocarpa]
Length=362

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 5/77 (6%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNG---KKEAVEDHILELLRLAMDCCSPSPS  580
            +D +LP  ++NA+++ RI DL+HP +L  SNG   ++   E+ +L+  +LAM CCSPSPS
Sbjct  287  EDFYLPTFMRNAVLDRRIADLYHPDIL--SNGDDNERPVTEECVLKYFQLAMACCSPSPS  344

Query  579  LRPTVKEFLTRLEEIER  529
            LRP +K+ L +LEEI R
Sbjct  345  LRPNIKQVLWKLEEIGR  361



>ref|XP_011028462.1| PREDICTED: putative kinase-like protein TMKL1 [Populus euphratica]
Length=363

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNG---KKEAVEDHILELLRLAMDCCSPSPS  580
            +D +LP  ++NA+++ RI DL+HP +L  SNG   ++   E+ +L+  +LAM CCSPSPS
Sbjct  287  EDFYLPTFMRNAVLDRRIADLYHPDIL-LSNGDDNERPVTEECVLKYFQLAMACCSPSPS  345

Query  579  LRPTVKEFLTRLEEIER  529
            LRP +K+ L +LEEI R
Sbjct  346  LRPNIKQVLWKLEEIGR  362



>ref|XP_007133478.1| hypothetical protein PHAVU_011G181900g [Phaseolus vulgaris]
 gb|ESW05472.1| hypothetical protein PHAVU_011G181900g [Phaseolus vulgaris]
Length=353

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAV---EDHILELLRLAMDCCSPSPS  580
            +D +LPN ++NA++  R+ DL+HP +L   N +++++   E+ IL++ +LAM CCSPSPS
Sbjct  278  EDFYLPNFMRNAVLGHRVADLYHPAIL-LRNSREDSIPVTEEFILKVFQLAMACCSPSPS  336

Query  579  LRPTVKEFLTRLEEI  535
            +RP +K+ L +LEEI
Sbjct  337  VRPNIKQVLKKLEEI  351



>ref|XP_002510997.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF51599.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=359

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVL--GQSNGKKEAVEDHILELLRLAMDCCSPSPSL  577
            +D  LP  ++NA+++ RITDL+HP +L    S+ +    E+ IL+  +LAM CCSPSPSL
Sbjct  284  EDFHLPTFMRNAVLDRRITDLYHPDILLSNHSDNETPVTEECILKYFQLAMSCCSPSPSL  343

Query  576  RPTVKEFLTRLEEI  535
            RP +K+ L +LEEI
Sbjct  344  RPNIKQVLLKLEEI  357



>gb|KDO45270.1| hypothetical protein CISIN_1g038580mg [Citrus sinensis]
Length=356

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP--MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSL  577
            +D  LP  ++NA+++ RITDL+HP  ++   SN +    E+ IL+  +LAM CCSPSPSL
Sbjct  281  EDFHLPTFMRNAVLDHRITDLYHPDMLLCSNSNHENPVSEERILKFFQLAMACCSPSPSL  340

Query  576  RPTVKEFLTRLEEIER  529
            RP +K+ L +LE++ +
Sbjct  341  RPNIKQVLWKLEDLGK  356



>gb|EYU31309.1| hypothetical protein MIMGU_mgv1a008745mg [Erythranthe guttata]
Length=363

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVL-GQSNGKKEAVEDHILELLRLAMDCCSPSPSLR  574
             D +LP+V++ AI++DRI +L+HP +L G SN ++   ED IL   +LAM CCSPS  LR
Sbjct  289  QDFYLPSVLRTAILDDRIMELYHPDILVGMSNDRRAITEDRILRFFQLAMACCSPSRLLR  348

Query  573  PTVKEFLTRLEEI  535
            P + E L +L EI
Sbjct  349  PEINEVLEKLREI  361



>ref|XP_003531799.1| PREDICTED: putative kinase-like protein TMKL1-like isoform X1 
[Glycine max]
Length=355

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAV---EDHILELLRLAMDCCSPSPS  580
            +D +LPN ++NA++  RI DL+HP +L + N + +++   E+ IL++ +LAM CCSPSPS
Sbjct  280  EDFYLPNFMRNAVLGHRIADLYHPAILLR-NSRDDSIPVTEECILKVFQLAMACCSPSPS  338

Query  579  LRPTVKEFLTRLEEI  535
            +RP +K+ L +LEEI
Sbjct  339  VRPNIKQVLKKLEEI  353



>ref|XP_006585708.1| PREDICTED: putative kinase-like protein TMKL1-like isoform X2 
[Glycine max]
Length=356

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAV---EDHILELLRLAMDCCSPSPS  580
            +D +LPN ++NA++  RI DL+HP +L + N + +++   E+ IL++ +LAM CCSPSPS
Sbjct  281  EDFYLPNFMRNAVLGHRIADLYHPAILLR-NSRDDSIPVTEECILKVFQLAMACCSPSPS  339

Query  579  LRPTVKEFLTRLEEI  535
            +RP +K+ L +LEEI
Sbjct  340  VRPNIKQVLKKLEEI  354



>ref|XP_006490173.1| PREDICTED: putative kinase-like protein TMKL1-like [Citrus sinensis]
Length=361

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP--MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSL  577
            +D  LP  ++NA+++ RITDL+HP  ++   SN +    E+ IL+  +LAM CCSPSPSL
Sbjct  286  EDFHLPTFMRNAVLDHRITDLYHPDMLLCSNSNHENPVSEERILKFFQLAMACCSPSPSL  345

Query  576  RPTVKEFLTRLEEIER  529
            RP +K+ L +LE++ +
Sbjct  346  RPNIKQVLWKLEDLGK  361



>ref|XP_010034989.1| PREDICTED: putative kinase-like protein TMKL1 [Eucalyptus grandis]
 gb|KCW46249.1| hypothetical protein EUGRSUZ_K00131 [Eucalyptus grandis]
Length=363

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAV---EDHILELLRLAMDCCSPSPS  580
            ++I+LPN ++ A++  R+++L+HP +L  + G  + V   E  +L+L  LAM CCSPSPS
Sbjct  287  EEIYLPNYIRRAVLGRRVSELYHPDILFSNGGGSDDVSVLEARVLKLFHLAMACCSPSPS  346

Query  579  LRPTVKEFLTRLEEIER  529
            LRPT K+   +LEEI +
Sbjct  347  LRPTAKQVRWKLEEIGK  363



>ref|XP_010062568.1| PREDICTED: putative kinase-like protein TMKL1 [Eucalyptus grandis]
 gb|KCW90872.1| hypothetical protein EUGRSUZ_A02920 [Eucalyptus grandis]
Length=365

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAV-EDHILELLRLAMDCCSPSPSL  577
            ++  LPN V+ AI++ RI++L+HP ++L  S G+  AV E+HIL   +LAM CCSPSPSL
Sbjct  290  EESHLPNYVRRAILDRRISELYHPDILLADSCGEISAVAEEHILNFFQLAMACCSPSPSL  349

Query  576  RPTVKEFLTRLEEI  535
            RP  ++ L +LEEI
Sbjct  350  RPNTRQVLRKLEEI  363



>gb|KJB51381.1| hypothetical protein B456_008G214600 [Gossypium raimondii]
Length=359

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA+++ RI+DL+HP +L ++N  K     E+ IL+  +LAM CCSPSP+L
Sbjct  284  EDFYLPNFMRNAVLDHRISDLYHPDLLLRNNNDKGNPVTEESILKFFQLAMTCCSPSPTL  343

Query  576  RPTVKEFLTRLEEIER  529
            RP  +  L  LEEI +
Sbjct  344  RPNSRRVLMMLEEIGK  359



>ref|XP_006421583.1| hypothetical protein CICLE_v10005242mg [Citrus clementina]
 gb|ESR34823.1| hypothetical protein CICLE_v10005242mg [Citrus clementina]
Length=361

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP--MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSL  577
            +D  LP  ++NA+++ RITDL+HP  ++   SN +    E+ IL+  +LAM CCSPSPSL
Sbjct  286  EDFHLPTFMRNAVLDHRITDLYHPDMLLCSNSNHENPVSEEGILKFFQLAMACCSPSPSL  345

Query  576  RPTVKEFLTRLEEIER  529
            RP +K+ L +LE++ +
Sbjct  346  RPNIKQVLRKLEDLGK  361



>ref|XP_006399244.1| hypothetical protein EUTSA_v10013915mg [Eutrema salsugineum]
 gb|ESQ40697.1| hypothetical protein EUTSA_v10013915mg [Eutrema salsugineum]
Length=361

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA+++ +++DL+ P +L +SNG     E+ +L+ ++LAM CCSPSPSLRP
Sbjct  290  DEFYLPDFIRNAVLDHKLSDLYRPEIL-RSNGN--VSEECVLKYIQLAMSCCSPSPSLRP  346

Query  570  TVKEFLTRLEEIER  529
             VK+ L +L+EI R
Sbjct  347  NVKQVLGKLKEIRR  360



>ref|XP_007038297.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY22798.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=359

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQ-SNGKKEAV-EDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA+++ RI+DL+HP +L Q SN +   V E+ IL+  +LAM CCSPS SL
Sbjct  284  EDFYLPNFMRNAVLDHRISDLYHPDILLQNSNDQGNPVTEESILKFFQLAMACCSPSSSL  343

Query  576  RPTVKEFLTRLEEIER  529
            RP  ++ L +LEEI +
Sbjct  344  RPNSRQVLLKLEEIGK  359



>ref|XP_003628252.1| MAP/microtubule affinity-regulating kinase [Medicago truncatula]
Length=337

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA++  RI+DL+HP +L +++   E    E+ +L+  +LAM CCSPSPS+
Sbjct  262  EDFYLPNFMRNAVLGHRISDLYHPAILLRNSIDDEIQVTEECVLKFFQLAMACCSPSPSI  321

Query  576  RPTVKEFLTRLEEI  535
            RP +K+ + +LEEI
Sbjct  322  RPNIKQVIRKLEEI  335



>ref|XP_004511130.1| PREDICTED: putative kinase-like protein TMKL1-like [Cicer arietinum]
Length=353

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA++  RI+DL+HP +L + +   E    E+ +L+  +LAM CCSPSPS+
Sbjct  278  EDFYLPNFMRNAVLGHRISDLYHPAILLRKSCDDEIQVTEECVLKFFQLAMACCSPSPSI  337

Query  576  RPTVKEFLTRLEEI  535
            RP +K+ L +L+EI
Sbjct  338  RPNIKQVLRKLQEI  351



>gb|EYU20189.1| hypothetical protein MIMGU_mgv1a008951mg [Erythranthe guttata]
Length=357

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLR  574
             D +LP+ +++AI++DR   L+HP +++G SN ++   ED IL   +LAM CCSPS ++R
Sbjct  283  QDFYLPSALRSAILDDRAVQLYHPDILIGLSNDERVVTEDGILRYFQLAMACCSPSRNVR  342

Query  573  PTVKEFLTRLEEI  535
            P++K+ L +LEEI
Sbjct  343  PSIKQILEKLEEI  355



>gb|AET02728.2| receptor-like kinase [Medicago truncatula]
Length=352

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA++  RI+DL+HP +L +++   E    E+ +L+  +LAM CCSPSPS+
Sbjct  277  EDFYLPNFMRNAVLGHRISDLYHPAILLRNSIDDEIQVTEECVLKFFQLAMACCSPSPSI  336

Query  576  RPTVKEFLTRLEEI  535
            RP +K+ + +LEEI
Sbjct  337  RPNIKQVIRKLEEI  350



>gb|KHN38152.1| Putative kinase-like protein TMKL1 [Glycine soja]
Length=355

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAV---EDHILELLRLAMDCCSPSPS  580
            +D +LPN ++NA++  RI DL+HP +L + N + + +   E+ IL++ +LAM CCSPSPS
Sbjct  280  EDFYLPNFMRNAVLGHRIADLYHPAILLR-NSRDDNIPVTEECILKVFQLAMACCSPSPS  338

Query  579  LRPTVKEFLTRLEEI  535
            +RP +K+ L +LEEI
Sbjct  339  VRPNIKQVLKKLEEI  353



>ref|NP_196379.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB11440.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED91186.1| protein kinase family protein [Arabidopsis thaliana]
Length=359

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA+++ R++DL+ P +LG  +      E+ +L+  +LAM CCSPSPSLRP
Sbjct  288  DEFYLPDFMRNAVLDHRLSDLYRPEILGSDD---NLSEECVLKYFQLAMSCCSPSPSLRP  344

Query  570  TVKEFLTRLEEIER  529
             VK+ L +LEEI +
Sbjct  345  NVKQVLRKLEEIGK  358



>ref|XP_004146910.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase IMK3-like [Cucumis sativus]
 ref|XP_004161584.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase IMK3-like [Cucumis sativus]
 gb|KGN53161.1| Nodulation receptor kinase [Cucumis sativus]
Length=357

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSN-GKKEAVEDHILELLRLAMDCCSPSPSLR  574
            +D +LP+ ++NA++  RI DLFHP +L  S+       E+ IL+  +LAM CCSPSP+LR
Sbjct  283  EDFYLPSFMRNAVLGHRIADLFHPEILLYSSIDGNHVTEEKILKFFQLAMACCSPSPALR  342

Query  573  PTVKEFLTRLEEI  535
            P++K+ L +L EI
Sbjct  343  PSMKQVLRKLNEI  355



>ref|XP_007218266.1| hypothetical protein PRUPE_ppa008215mg [Prunus persica]
 gb|EMJ19465.1| hypothetical protein PRUPE_ppa008215mg [Prunus persica]
Length=341

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D  LPN ++NA++  RI DLFHP +L  S+   E    ++ IL+  +LAM CCSPSPSL
Sbjct  266  EDFSLPNFMRNAVLGHRIHDLFHPGLLLNSSIDDELPVTKEQILKFFQLAMTCCSPSPSL  325

Query  576  RPTVKEFLTRLEEI  535
            RP  K+ L +LEEI
Sbjct  326  RPNTKQVLWKLEEI  339



>ref|XP_008234436.1| PREDICTED: putative kinase-like protein TMKL1 [Prunus mume]
Length=359

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQS--NGKKEAVEDHILELLRLAMDCCSPSPSL  577
            +D  LP+ ++NA++  RI DLFHP +L  S  + K    ++HIL+  +LAM CCSPSPSL
Sbjct  284  EDYSLPDFMRNAVLGHRIHDLFHPDLLLNSSIDDKVPVTKEHILKFFQLAMTCCSPSPSL  343

Query  576  RPTVKEFLTRLEEI  535
            RP  K+ L +LEEI
Sbjct  344  RPNTKQVLWKLEEI  357



>gb|KHG13692.1| Putative kinase-like protein TMKL1 [Gossypium arboreum]
Length=359

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA+++ RI+DL+HP +L ++N  K     E+  L+  +LAM CCSPSP+L
Sbjct  284  EDFYLPNFMRNAVLDHRISDLYHPDLLLRNNNDKGNPVTEESFLKFFQLAMTCCSPSPTL  343

Query  576  RPTVKEFLTRLEEIER  529
            RP  +  L  LEEI +
Sbjct  344  RPNSRRVLMMLEEIGK  359



>emb|CDY60499.1| BnaCnng36410D [Brassica napus]
Length=355

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ V+NA+I+ +++DL+ P +L  S    +  E+ +L+  +LA+ CCSPSPSLRP
Sbjct  284  DEFYLPDFVRNAVIDHKLSDLYRPEILKSSG---DMSEERVLKYFQLALSCCSPSPSLRP  340

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LE+I++
Sbjct  341  NIKQVLRKLEDIKK  354



>gb|AAR13701.1| protein kinase [Brassica oleracea]
Length=353

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ V+NA+I+ +++DL+ P +L  S    +  E+ +L+  +LA+ CCSPSPSLRP
Sbjct  282  DEFYLPDFVRNAVIDHKLSDLYRPEILKSSG---DMSEERVLKYFQLALSCCSPSPSLRP  338

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LE+I++
Sbjct  339  NIKQVLRKLEDIKK  352



>ref|XP_009362704.1| PREDICTED: putative kinase-like protein TMKL1 [Pyrus x bretschneideri]
Length=360

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPS  580
            +D  LP+ ++NA++  RI DLFHP ++L  S G  E    ++ IL+  +LAM CC+PSPS
Sbjct  284  EDFSLPDFMRNAVLGHRIHDLFHPDLLLNSSAGYGEIPVTKERILKFFQLAMACCAPSPS  343

Query  579  LRPTVKEFLTRLEEI  535
            LRP  K+ L++LEEI
Sbjct  344  LRPNSKQVLSKLEEI  358



>ref|XP_008376379.1| PREDICTED: putative kinase-like protein TMKL1 [Malus domestica]
Length=376

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVL-----GQSNGKKEAVEDHILELLRLAMDCCSPS  586
            +D  LPN ++NA++  +I DLFHP +L     G  +G+     + IL+  +LAM CC+PS
Sbjct  297  EDFSLPNFMRNAVLGHKIHDLFHPDLLLNSGVGVGDGEIPVAREQILKFFQLAMACCAPS  356

Query  585  PSLRPTVKEFLTRLEEIER  529
            PSLRP  K+ L +LE+I R
Sbjct  357  PSLRPNTKKVLWKLEDIGR  375



>ref|XP_010452731.1| PREDICTED: putative kinase-like protein TMKL1 [Camelina sativa]
Length=368

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA+++ R++DL+ P +L   +      E+ +L+  +LAM CCSPSPSLRP
Sbjct  297  DEFYLPDFMRNAVLDHRLSDLYRPEILKSDD---NLSEECVLKYFQLAMSCCSPSPSLRP  353

Query  570  TVKEFLTRLEEIER  529
             +K+ L++LEEI +
Sbjct  354  NIKQVLSKLEEIRK  367



>ref|XP_009370434.1| PREDICTED: putative kinase-like protein TMKL1 [Pyrus x bretschneideri]
Length=364

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVL-----GQSNGKKEAVEDHILELLRLAMDCCSPS  586
            +D  LPN ++NA++  +I DLFHP +L     G  +G+     + IL+  +LAM CC+PS
Sbjct  285  EDFSLPNFMRNAVLGHKIHDLFHPDLLLNSGVGVGDGEIPVTREQILKFFQLAMACCAPS  344

Query  585  PSLRPTVKEFLTRLEEIER  529
            P+LRP  K+ L +LE+I R
Sbjct  345  PTLRPNTKKVLWKLEDIGR  363



>ref|XP_006289110.1| hypothetical protein CARUB_v10002531mg [Capsella rubella]
 gb|AAR15469.1| protein kinase [Capsella rubella]
 gb|EOA22008.1| hypothetical protein CARUB_v10002531mg [Capsella rubella]
Length=362

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA+++ R++DL+ P +L          E+ +L+  +LAM CCSPSPSLRP
Sbjct  291  DEFYLPDFMRNAVLDHRLSDLYRPEIL---RSDANLSEERVLKYFQLAMSCCSPSPSLRP  347

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LEEI +
Sbjct  348  NIKQVLRKLEEIRK  361



>ref|XP_009372839.1| PREDICTED: putative kinase-like protein TMKL1 [Pyrus x bretschneideri]
Length=364

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVL-----GQSNGKKEAVEDHILELLRLAMDCCSPS  586
            +D  LPN ++NA++  +I DLFHP +L     G  +G+     + IL+  +LAM CC+PS
Sbjct  285  EDFSLPNFMRNAVLGHKIHDLFHPDLLLNSGVGVGDGEIPVTREQILKFFQLAMACCAPS  344

Query  585  PSLRPTVKEFLTRLEEIER  529
            P+LRP  K+ L +LE+I R
Sbjct  345  PTLRPNTKKVLWKLEDIGR  363



>ref|XP_010919672.1| PREDICTED: putative kinase-like protein TMKL1 [Elaeis guineensis]
Length=361

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
             D+ LP  ++N ++E +I+D+F   ++ QS  +K   ED +L   +LAM CCSPSP+LRP
Sbjct  288  QDLHLPTSLRNLVLEHKISDVFSSDLINQSRKQKSTNEDSLLMFFQLAMACCSPSPALRP  347

Query  570  TVKEFLTRLEEI  535
             +K  + RLEEI
Sbjct  348  DIKHIVKRLEEI  359



>emb|CDY64669.1| BnaA10g30230D [Brassica napus]
Length=359

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            ++++LP+ V+NA+I+ +++DL+ P +L  S    +  E+ +L+  +LA+ CCSPSPSLRP
Sbjct  288  NELYLPDFVRNAVIDHKLSDLYRPEILKSSG---DMSEELVLKYFQLALSCCSPSPSLRP  344

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LE+I++
Sbjct  345  NIKQVLRKLEDIKK  358



>ref|XP_009122323.1| PREDICTED: putative kinase-like protein TMKL1 [Brassica rapa]
Length=355

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ V+ A+I+ +++DL+ P +L  S    +  E+ +L+  +LA+ CCSPSPSLRP
Sbjct  284  DEFYLPDFVRKAVIDHKLSDLYRPEILKSSG---DMSEERVLKYFQLALSCCSPSPSLRP  340

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LE+I++
Sbjct  341  NIKQVLRKLEDIKK  354



>ref|XP_006598015.1| PREDICTED: putative kinase-like protein TMKL1-like [Glycine max]
 gb|KHN01771.1| Putative kinase-like protein TMKL1 [Glycine soja]
Length=354

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSL  577
            +D +LPN ++NA++  RI DL+ P  L +++        E+ IL++ +LAM CCSPSPS+
Sbjct  279  EDFYLPNFMRNAVLGHRIADLYQPAFLLRNSRDDNIPVTEECILKVFQLAMACCSPSPSV  338

Query  576  RPTVKEFLTRLEEI  535
            RP +K+ L +LEEI
Sbjct  339  RPNIKQVLKKLEEI  352



>gb|AAR15503.1| protein kinase [Arabidopsis arenosa]
Length=362

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA+++ R++DL+ P +L   +      E+ +L+  +LAM CCSPSPSLRP
Sbjct  291  DEFYLPDFMRNAVLDHRLSDLYRPEILRSDD---NLSEECVLKYFQLAMSCCSPSPSLRP  347

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LEEI +
Sbjct  348  NIKQVLRKLEEIGK  361



>gb|AAR15452.1| protein kinase [Arabidopsis arenosa]
Length=362

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA+++ R++DL+ P +L   +      E+ +L+  +LAM CCSPSPSLRP
Sbjct  291  DEFYLPDFMRNAVLDHRLSDLYRPEILRSDD---NLSEECVLKYFQLAMSCCSPSPSLRP  347

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LEEI +
Sbjct  348  NIKQVLRKLEEIGK  361



>ref|XP_004307785.1| PREDICTED: putative kinase-like protein TMKL1 [Fragaria vesca 
subsp. vesca]
Length=363

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAV---EDHILELLRLAMDCCSPSPS  580
            +D  LPN+++NA++  RI +LFHP +L  S    + +   ++ IL+L +LAM CCSPS S
Sbjct  287  EDFSLPNLMRNAVLGHRIQELFHPDILVSSCTTDDEIPVTKERILKLFQLAMTCCSPSSS  346

Query  579  LRPTVKEFLTRLEEI  535
            LRP  K+ L +LEEI
Sbjct  347  LRPNTKQVLWKLEEI  361



>ref|XP_010491380.1| PREDICTED: putative kinase-like protein TMKL1 [Camelina sativa]
Length=363

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ +++A+++ R++DL+ P +L   +      E+ IL+  +LAM CCSPSPSLRP
Sbjct  292  DEFYLPDFMRHAVLDHRLSDLYRPEILRSDD---NLSEECILKYFQLAMSCCSPSPSLRP  348

Query  570  TVKEFLTRLEEIER  529
             +K+ L +LEEI +
Sbjct  349  NIKQVLRKLEEIRK  362



>ref|XP_008802506.1| PREDICTED: putative kinase-like protein TMKL1 [Phoenix dactylifera]
Length=361

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
             D+ LP  ++N ++E +I+D+F   ++ QS  +  A ED +L   +L M CCSPSP+LRP
Sbjct  288  QDLHLPTSLRNLVLEHKISDVFSSELINQSRKQNSANEDTLLMFFQLVMACCSPSPALRP  347

Query  570  TVKEFLTRLEEIER  529
             +K  + RLEEI +
Sbjct  348  DIKHIVKRLEEIGQ  361



>gb|AFK46824.1| unknown [Medicago truncatula]
Length=68

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = -2

Query  726  VKNAIIEDRITDLFHPMVLGQSNGKKE--AVEDHILELLRLAMDCCSPSPSLRPTVKEFL  553
            ++NA++  RI+DL+HP +L +++   E    E+ +L+  +LAM CCSPSPS+RP +K+ +
Sbjct  1    MRNAVLGHRISDLYHPAILLRNSIDDEIQVTEECVLKFFQLAMACCSPSPSIRPNIKQVI  60

Query  552  TRLEEI  535
             +LEEI
Sbjct  61   RKLEEI  66



>ref|XP_010523204.1| PREDICTED: putative kinase-like protein TMKL1 [Tarenaya hassleriana]
Length=363

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQ--SNGKKEAVEDHILELLRLAMDCCSPSPSL  577
            D+ +LP+ ++N++++ R++DL+ P +L     +      E+ +L+  +LAM CCSPSPSL
Sbjct  288  DEFYLPDFMRNSVLDHRLSDLYRPEILRSDLKDADNSVTEECVLKCFQLAMSCCSPSPSL  347

Query  576  RPTVKEFLTRLEEIER  529
            RP++K  L +LEE+ +
Sbjct  348  RPSIKHVLRKLEEVGK  363



>ref|XP_002873320.1| protein kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49579.1| protein kinase [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ ++NA+++ R++DL+ P ++   +      E+ +L   +LAM CCSPSPSLRP
Sbjct  291  DEFYLPDFMRNAVLDHRLSDLYRPEIIRSDD---NLSEECVLMYFQLAMSCCSPSPSLRP  347

Query  570  TVKEFLTRLEEIER  529
             VK+ L +LEEI +
Sbjct  348  NVKQVLRKLEEIGK  361



>gb|EMT19579.1| Putative kinase-like protein TMKL1 [Aegilops tauschii]
Length=269

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DIFLP   KN ++E +I+D F+  ++ QS  +K   E  +     LA  CCSPSPSLRP 
Sbjct  199  DIFLPASFKNLVLERKISDAFNSDLVRQS--RKSGNERKLNAFFELATACCSPSPSLRPN  256

Query  567  VKEFLTRLEEIER  529
             KE L RLEEI +
Sbjct  257  TKEILRRLEEIAK  269



>gb|AAR15438.1| protein kinase [Sisymbrium irio]
Length=365

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            + +LP+ ++NA+++ +++DL+ P +L  S       E+ +L+  +LAM CCSPSPSLRP 
Sbjct  294  EFYLPDFMRNAVLDHKLSDLYRPEILTSSG--NNLSEECVLKYFQLAMSCCSPSPSLRPN  351

Query  567  VKEFLTRLEEIER  529
            +K+ L +LE+I +
Sbjct  352  MKQVLRKLEDIRK  364



>ref|XP_010423188.1| PREDICTED: putative kinase-like protein TMKL1 [Camelina sativa]
Length=368

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D+ +LP+ +++A+++ R++DL+ P +L   +      E+ +L+  +LAM CCSPSPSLRP
Sbjct  297  DEFYLPDFMRHAVLDHRLSDLYRPEILKSDD---NLTEECVLKYFQLAMSCCSPSPSLRP  353

Query  570  TVKEFLTRLEEIER  529
             +K+ L  LEEI +
Sbjct  354  NIKQVLRILEEIRK  367



>gb|EMS55370.1| Putative kinase-like protein TMKL1 [Triticum urartu]
Length=281

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DIFLP   KN ++E +I+D F   ++ QS  +K   E  +     LA  CCSPSPSLRP 
Sbjct  211  DIFLPASFKNLVLERKISDAFSSDLVRQS--RKSGNEKKLNAFFELATACCSPSPSLRPN  268

Query  567  VKEFLTRLEEIER  529
             KE L RLEEI +
Sbjct  269  TKEILRRLEEIAK  281



>ref|XP_011101106.1| PREDICTED: putative kinase-like protein TMKL1 [Sesamum indicum]
Length=359

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHP-MVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D  LP+ ++NA+++D + DL+HP ++LG SN ++   ED +    +LAM CCSP+  LRP
Sbjct  286  DFCLPSALRNAVLDDTMVDLYHPDILLGLSNDQRIVTEDRVFRFFQLAMACCSPTRLLRP  345

Query  570  TVKEFLTRLEEIER  529
             + + L +L+ I +
Sbjct  346  HINQILEKLQGIGK  359



>gb|AEW07404.1| hypothetical protein 0_527_01, partial [Pinus radiata]
 gb|AFG43831.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43832.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43833.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43834.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43835.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43836.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43837.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43838.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43839.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43840.1| hypothetical protein 0_527_01, partial [Pinus taeda]
 gb|AFG43842.1| hypothetical protein 0_527_01, partial [Pinus taeda]
Length=95

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = -2

Query  732  NVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKEFL  553
             VVKNA++E+RI++LF   +L      +   ++ +L++L+LAM CC+PSPS+RP +KE +
Sbjct  1    TVVKNAVLEERISELFDLELL---RAMRSPADEGLLQVLQLAMGCCAPSPSVRPHIKEVV  57

Query  552  TRLEEI  535
             +LEEI
Sbjct  58   RQLEEI  63



>gb|AFG43841.1| hypothetical protein 0_527_01, partial [Pinus taeda]
Length=95

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = -2

Query  732  NVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKEFL  553
             VVKNA++E+RI++LF   +L      +   ++ +L++L+LAM CC+PSPS+RP +KE +
Sbjct  1    TVVKNAVLEERISELFDLELL---RAMRSPADEGLLQVLQLAMGCCAPSPSVRPHIKEVV  57

Query  552  TRLEEI  535
             +LEEI
Sbjct  58   RQLEEI  63



>dbj|BAJ87469.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=406

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DIFLP   KN ++E +I+D F+  ++ QS  KK   E  +     LA  CCSPSPSLRP 
Sbjct  336  DIFLPASFKNLVLERKISDAFNSDLVRQS--KKSGNEKKLNAFFELATACCSPSPSLRPN  393

Query  567  VKEFLTRLEEIER  529
             K+ L RLE+I +
Sbjct  394  TKDILRRLEDIAK  406



>ref|XP_002972765.1| hypothetical protein SELMODRAFT_173095 [Selaginella moellendorffii]
 gb|EFJ25986.1| hypothetical protein SELMODRAFT_173095 [Selaginella moellendorffii]
Length=668

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP +VK A+IE+R  +LF   +L    G +  +ED +L+ L+LAM CC+PSP++RP +KE
Sbjct  574  LPTLVKTAVIEERTAELFDLDLL---RGLRSPMEDGLLQALQLAMGCCAPSPAVRPDIKE  630

Query  558  FLTRLEEI  535
             + +LEEI
Sbjct  631  VIRQLEEI  638



>ref|XP_002984340.1| hypothetical protein SELMODRAFT_120346 [Selaginella moellendorffii]
 gb|EFJ14390.1| hypothetical protein SELMODRAFT_120346 [Selaginella moellendorffii]
Length=668

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP +VK A+IE+R  +LF   +L    G +  +ED +L+ L+LAM CC+PSP++RP +KE
Sbjct  574  LPTLVKTAVIEERTAELFDLDLL---RGLRSPMEDGLLQALQLAMGCCAPSPAVRPDIKE  630

Query  558  FLTRLEEI  535
             + +LEEI
Sbjct  631  VIRQLEEI  638



>ref|XP_006837336.1| hypothetical protein AMTR_s00111p00085260 [Amborella trichopoda]
 gb|ERN00190.1| hypothetical protein AMTR_s00111p00085260 [Amborella trichopoda]
Length=348

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP  +KNAI++ R++++F   ++G+        E+ +L   +LAM CC+PSP LRP +K+
Sbjct  279  LPTTMKNAILDRRVSEIFDSGLIGKVADLNPKREEGLLAFFQLAMSCCAPSPYLRPQIKQ  338

Query  558  FLTRLEEI  535
             + RLEEI
Sbjct  339  IIRRLEEI  346



>ref|XP_003570014.1| PREDICTED: putative kinase-like protein TMKL1 [Brachypodium distachyon]
Length=419

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DIFLP   KN ++E +I+D F   ++ QS  +K   E  +     LA  CCSPSPSLRP 
Sbjct  349  DIFLPVSFKNLVLERKISDAFSSDLVRQS--RKAGNEKSLNAFFELATACCSPSPSLRPN  406

Query  567  VKEFLTRLEEIER  529
             K+ L RLEEI +
Sbjct  407  TKDILRRLEEIAK  419



>gb|ABR17460.1| unknown [Picea sitchensis]
Length=657

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+R   +F P +L    G +   +D +L  L+LAM CC+PSP++RP +KE
Sbjct  576  LPSIVKAAVLEERTMQIFDPEIL---RGIRSPADDGLLHALQLAMGCCAPSPAVRPDIKE  632

Query  558  FLTRLEEIE  532
             + +LEE+ 
Sbjct  633  VVRQLEELR  641



>ref|XP_010933622.1| PREDICTED: putative kinase-like protein TMKL1 [Elaeis guineensis]
Length=362

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
             D+  P  ++N ++E +++D+F   ++ +S  +  + ED +L   +LAM CCSP+P+LRP
Sbjct  289  QDLHPPTSLRNLVLEHKVSDMFSSELINRSKKQNSSNEDSLLMFFQLAMACCSPTPALRP  348

Query  570  TVKEFLTRLEEIER  529
             +K  + RLEEI +
Sbjct  349  DIKYIVRRLEEIGQ  362



>ref|XP_009402001.1| PREDICTED: putative kinase-like protein TMKL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402064.1| PREDICTED: putative kinase-like protein TMKL1 [Musa acuminata 
subsp. malaccensis]
Length=362

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            D+ LP+ ++  ++E +++D+F   +L +S  +  + ED ++ L  LA+ CCSPSP++RP 
Sbjct  290  DLHLPSFLRILVLEHKVSDVFTSELLKESINQNSSNEDGLVMLFHLAVACCSPSPTMRPD  349

Query  567  VKEFLTRLEEIER  529
            +K  L RLE+I R
Sbjct  350  IKTVLGRLEDIGR  362



>ref|XP_006647625.1| PREDICTED: putative kinase-like protein TMKL1-like [Oryza brachyantha]
Length=412

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   KN ++E +I+D F   ++ QS  KK   E ++     LA  CCSPSPSLRP 
Sbjct  342  DILLPVSFKNLVLERKISDAFSSDLVRQS--KKSGKEKNLNAFFELATTCCSPSPSLRPN  399

Query  567  VKEFLTRLEEIER  529
             K  L +LEEI +
Sbjct  400  TKYILKKLEEIAK  412



>emb|CAC39066.1| putative protein [Oryza sativa]
Length=411

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   KN ++E +I+D F   ++ QS  KK   E ++     LA  CCSPSPSLRP 
Sbjct  341  DILLPVSFKNLVLERKISDAFSSDLVRQS--KKSGKEKNLNAFFELATACCSPSPSLRPN  398

Query  567  VKEFLTRLEEIER  529
             K  L +LEEI +
Sbjct  399  TKFILKKLEEIAK  411



>ref|XP_009389299.1| PREDICTED: putative kinase-like protein TMKL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389300.1| PREDICTED: putative kinase-like protein TMKL1 [Musa acuminata 
subsp. malaccensis]
Length=362

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            D+ LP  ++  ++E +++D+F   +L  S  +    E+ +L L +LAM CCSPSP+LRP 
Sbjct  290  DLHLPTSLRILVLEHKVSDVFSSNLLEDSINQNSTNEEGLLMLFQLAMTCCSPSPALRPD  349

Query  567  VKEFLTRLEEIER  529
            ++  + RLE+I R
Sbjct  350  IRAVIRRLEDIGR  362



>ref|NP_001053480.1| Os04g0548400 [Oryza sativa Japonica Group]
 dbj|BAF15394.1| Os04g0548400, partial [Oryza sativa Japonica Group]
Length=150

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP+  K+ ++E +I+D F   ++ QS  K    E ++     LA  CC+PSPSLRP 
Sbjct  80   DIHLPSSFKDLVLERKISDAFSSELVKQS--KNSGKEQNLNAFFELATACCNPSPSLRPD  137

Query  567  VKEFLTRLEEIER  529
             K  L  LEEI R
Sbjct  138  TKRILKMLEEISR  150



>ref|NP_001047621.1| Os02g0655800 [Oryza sativa Japonica Group]
 dbj|BAD25331.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD25672.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF09535.1| Os02g0655800 [Oryza sativa Japonica Group]
 gb|EAY86943.1| hypothetical protein OsI_08328 [Oryza sativa Indica Group]
 gb|EAZ24055.1| hypothetical protein OsJ_07785 [Oryza sativa Japonica Group]
 dbj|BAG95307.1| unnamed protein product [Oryza sativa Japonica Group]
Length=411

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   KN ++E +I+D F   ++ QS  KK   E ++     LA  CCSPSPSLRP 
Sbjct  341  DILLPVSFKNLVLERKISDAFSSDLVRQS--KKSGKEKNLNAFFELATACCSPSPSLRPN  398

Query  567  VKEFLTRLEEIER  529
             K  L +LEEI +
Sbjct  399  TKFILKKLEEIAK  411



>gb|EMT22768.1| Putative kinase-like protein TMKL1 [Aegilops tauschii]
Length=1092

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -2

Query  747   DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
             DIFLP   KN ++E +I+D     ++ QS  +K   E  +     LA  CCSPSPSLRP 
Sbjct  1022  DIFLPASFKNLVLERKISDAISSDLVRQS--RKSGNERKLNAFFELATACCSPSPSLRPN  1079

Query  567   VKEFLTRLEEIER  529
              K  L RLE I +
Sbjct  1080  TKAILRRLEAIAK  1092



>ref|XP_002452814.1| hypothetical protein SORBIDRAFT_04g033010 [Sorghum bicolor]
 gb|EES05790.1| hypothetical protein SORBIDRAFT_04g033010 [Sorghum bicolor]
Length=411

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   KN ++E +I+D F   +    + K+   E ++     LA  CCSPSPSLRP 
Sbjct  341  DILLPASFKNLVLERKISDAFSSDL--ARHCKRSGKEKNLNAFFELATACCSPSPSLRPN  398

Query  567  VKEFLTRLEEIER  529
             ++ L RLEEI R
Sbjct  399  TRQILKRLEEIAR  411



>ref|XP_009388875.1| PREDICTED: putative kinase-like protein TMKL1 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            D  +P  ++N ++E +++D+F+  +L QS  +    E  +L L RLA+ CCSPSP+ RP 
Sbjct  295  DFHVPTSLRNLVLEHKVSDVFNSELLIQSIDQSSTNEQGLLMLFRLAIACCSPSPASRPD  354

Query  567  VKEFLTRLEEIER  529
             K  ++++E+I R
Sbjct  355  TKHVISQIEDIIR  367



>ref|XP_002448282.1| hypothetical protein SORBIDRAFT_06g024440 [Sorghum bicolor]
 gb|EES12610.1| hypothetical protein SORBIDRAFT_06g024440 [Sorghum bicolor]
Length=368

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   K+ ++E +I++ F   ++ QS  K    ED++     LA  CC+PSPSLRP 
Sbjct  298  DIHLPASFKDLVLERKISEAFSSELIKQS--KNSGKEDNLNAYFELATACCNPSPSLRPD  355

Query  567  VKEFLTRLEEIER  529
             K+ L RLE+I R
Sbjct  356  TKKILKRLEDIAR  368



>ref|NP_001167868.1| uncharacterized LOC100381572 [Zea mays]
 gb|ACN26358.1| unknown [Zea mays]
 gb|AFW72627.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=409

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   KN ++E +I+D F   +    + K+   E  +     LA  CCSPSPSLRP+
Sbjct  339  DILLPASFKNLVLERKISDAFSSDL--ARHCKRSGKEKSLNAFFELATACCSPSPSLRPS  396

Query  567  VKEFLTRLEEIER  529
             ++ L RLEEI R
Sbjct  397  TRQVLKRLEEIAR  409



>dbj|BAJ86003.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   K+ I+E +I D F   ++ QS  K    E  +     LA  CC+PSPSLRP 
Sbjct  295  DIHLPATFKDLILESKIADAFGSELIKQS--KNSGNEAKLNAFFELATACCNPSPSLRPD  352

Query  567  VKEFLTRLEEIER  529
             +  L RLEEI R
Sbjct  353  SRRILKRLEEISR  365



>gb|EMT15407.1| Putative kinase-like protein TMKL1 [Aegilops tauschii]
Length=249

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   K+ ++E +I D F   ++ QS  K    E  +     LA  CC+PSPSLRP 
Sbjct  179  DIHLPASFKDLVLERKIADAFGSGLIQQS--KNSGNEAKLNAFFELATACCNPSPSLRPD  236

Query  567  VKEFLTRLEEIER  529
             K  L RLEEI R
Sbjct  237  SKRILKRLEEISR  249



>emb|CDY02133.1| BnaA03g40340D [Brassica napus]
Length=358

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = -2

Query  732  NVVKNAIIE-DRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKEF  556
            N    +++E +++ +L    +LG   G+K+  ++++LE + LAM CCSPSPS+RP+ K+ 
Sbjct  291  NSTSGSVLEHEKLLNLCRSEILGGC-GEKDVTKEYVLEYIELAMSCCSPSPSIRPSFKQV  349

Query  555  LTRLEEIER  529
            L +LEEI++
Sbjct  350  LRKLEEIKK  358



>ref|XP_006653645.1| PREDICTED: putative kinase-like protein TMKL1-like [Oryza brachyantha]
Length=277

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP+  K+ ++E +I+D F   ++ QS  K    E ++     LA  CC+PSPSLRP 
Sbjct  207  DIHLPSSFKDLVLERKISDAFSSELIKQS--KNSGKEQNLNGFFELATACCNPSPSLRPD  264

Query  567  VKEFLTRLEEIER  529
             K  L  LEEI R
Sbjct  265  TKHILKTLEEISR  277



>emb|CAH67615.1| OSIGBa0106P14.5 [Oryza sativa Indica Group]
 gb|EAY95067.1| hypothetical protein OsI_16883 [Oryza sativa Indica Group]
Length=371

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP+  K+ ++E +I+D F   ++ QS  K    E ++     LA  CC+PSPSLRP 
Sbjct  301  DIHLPSSFKDLVLERKISDAFSSELVKQS--KNSGKEQNLNAFFELATACCNPSPSLRPD  358

Query  567  VKEFLTRLEEIER  529
             K  L  LEEI R
Sbjct  359  TKRILKMLEEISR  371



>gb|EEE61444.1| hypothetical protein OsJ_15680 [Oryza sativa Japonica Group]
Length=377

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP+  K+ ++E +I+D F   ++ QS  K    E ++     LA  CC+PSPSLRP 
Sbjct  307  DIHLPSSFKDLVLERKISDAFSSELVKQS--KNSGKEQNLNAFFELATACCNPSPSLRPD  364

Query  567  VKEFLTRLEEIER  529
             K  L  LEEI R
Sbjct  365  TKRILKMLEEISR  377



>emb|CAI64491.1| OSJNBa0065H10.10 [Oryza sativa Japonica Group]
Length=371

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP+  K+ ++E +I+D F   ++ QS  K    E ++     LA  CC+PSPSLRP 
Sbjct  301  DIHLPSSFKDLVLERKISDAFSSELVKQS--KNSGKEQNLNAFFELATACCNPSPSLRPD  358

Query  567  VKEFLTRLEEIER  529
             K  L  LEEI R
Sbjct  359  TKRILKMLEEISR  371



>gb|EMS58728.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
IMK2 [Triticum urartu]
Length=214

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 40/73 (55%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   K+ ++E +I D F   ++ QS  K    E  +     LA  CC+PSPSLRP 
Sbjct  144  DIHLPASFKDLVLERKIADAFGSDLIQQS--KNSGNEAKLNAFFELATACCNPSPSLRPD  201

Query  567  VKEFLTRLEEIER  529
             +  L RLEEI R
Sbjct  202  SRRILKRLEEISR  214



>ref|XP_003580275.1| PREDICTED: putative kinase-like protein TMKL1 [Brachypodium distachyon]
Length=363

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   K+ ++E +I+D F   ++ QS  K    E ++     LA  CC+PSPSLRP 
Sbjct  293  DIHLPASFKDLVLERKISDAFSSELIKQS--KNSGKERNLNAFFELATACCNPSPSLRPD  350

Query  567  VKEFLTRLEEIER  529
                L RLEEI R
Sbjct  351  TNRILKRLEEIAR  363



>ref|XP_009136493.1| PREDICTED: putative kinase-like protein TMKL1 isoform X1 [Brassica 
rapa]
Length=362

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -2

Query  705  DRITDLFHPMVLGQSNGKKEAV-EDHILELLRLAMDCCSPSPSLRPTVKEFLTRLEEIER  529
            +++ DL    +LG+  G    V ++++LE + LAM CCSP+PSLRP+ K+ L +LEEI++
Sbjct  303  EKLLDLCRAEILGRGEGDGVGVTKEYVLEYIELAMSCCSPTPSLRPSFKQVLRKLEEIKK  362



>ref|XP_009136494.1| PREDICTED: putative kinase-like protein TMKL1 isoform X2 [Brassica 
rapa]
Length=359

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -2

Query  705  DRITDLFHPMVLGQSNGKKEAV-EDHILELLRLAMDCCSPSPSLRPTVKEFLTRLEEIER  529
            +++ DL    +LG+  G    V ++++LE + LAM CCSP+PSLRP+ K+ L +LEEI++
Sbjct  300  EKLLDLCRAEILGRGEGDGVGVTKEYVLEYIELAMSCCSPTPSLRPSFKQVLRKLEEIKK  359



>ref|XP_004976425.1| PREDICTED: putative kinase-like protein TMKL1-like [Setaria italica]
Length=367

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   K+ ++E +I++ F   ++ QS  K    E+++     LA  CC+PSPSLRP 
Sbjct  297  DIHLPASFKDLVLERKISEAFSSELIKQS--KNSGKEENLNAYFELATACCNPSPSLRPD  354

Query  567  VKEFLTRLEEIER  529
             K+ L RLE+I R
Sbjct  355  TKKILKRLEDIAR  367



>ref|XP_009407822.1| PREDICTED: putative kinase-like protein TMKL1 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            D  LP  ++N +++ +I+D+F   +L QS  K       +L L +LA+ CCSPSP+ RP 
Sbjct  297  DFHLPISLRNLVLDHKISDVFDSELLSQSLDKNSGKAHGLLMLFQLAIACCSPSPASRPD  356

Query  567  VKEFLTRLEEI  535
             K  ++RLE I
Sbjct  357  TKHVISRLEVI  367



>ref|XP_006830618.1| hypothetical protein AMTR_s00120p00076230 [Amborella trichopoda]
 gb|ERM98034.1| hypothetical protein AMTR_s00120p00076230 [Amborella trichopoda]
Length=671

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            + + LP++VK A++E+   ++F   VL    G + A+E+ +++ L+LAM CC+P+PS+RP
Sbjct  579  EQVDLPSIVKVAVLEESTMEVFDAEVL---RGVRSAMEEGLVQALKLAMGCCAPAPSVRP  635

Query  570  TVKEFLTRLEE  538
             + + + +LEE
Sbjct  636  DMAQVVRQLEE  646



>emb|CDY23057.1| BnaC07g31300D [Brassica napus]
Length=361

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  705  DRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKEFLTRLEEIER  529
            +++ DL    +LG+  G+++  ++++LE + LAM CCSPSPS+RP+ K+ L +LEEI++
Sbjct  304  EKLLDLCRSEILGRC-GEEDVTKEYVLEYIELAMSCCSPSPSIRPSFKQVLRKLEEIKK  361



>dbj|BAB09001.1| disease resistance protein kinase Pto-like protein [Arabidopsis 
thaliana]
Length=340

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 7/72 (10%)
 Frame = -2

Query  732  NVVKNAIIEDRITDLFHPMV----LGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTV  565
            N   + +  +R++DL+ P +    L   NG     E+ +LE  +LAM CCSPSP+LRP+ 
Sbjct  272  NPTGSVLDRNRLSDLYRPEIIRRCLKDGNG---VTEECVLEYFQLAMSCCSPSPTLRPSF  328

Query  564  KEFLTRLEEIER  529
            K+ L +LEEI +
Sbjct  329  KQVLRKLEEIRK  340



>ref|NP_200965.2| protein kinase-like protein [Arabidopsis thaliana]
 gb|AED97490.1| protein kinase-like protein [Arabidopsis thaliana]
Length=361

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 7/72 (10%)
 Frame = -2

Query  732  NVVKNAIIEDRITDLFHPMV----LGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTV  565
            N   + +  +R++DL+ P +    L   NG     E+ +LE  +LAM CCSPSP+LRP+ 
Sbjct  293  NPTGSVLDRNRLSDLYRPEIIRRCLKDGNG---VTEECVLEYFQLAMSCCSPSPTLRPSF  349

Query  564  KEFLTRLEEIER  529
            K+ L +LEEI +
Sbjct  350  KQVLRKLEEIRK  361



>ref|NP_001078779.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AAY25458.1| At5g61570 [Arabidopsis thaliana]
 gb|AED97491.1| protein kinase-like protein [Arabidopsis thaliana]
Length=358

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 7/72 (10%)
 Frame = -2

Query  732  NVVKNAIIEDRITDLFHPMV----LGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTV  565
            N   + +  +R++DL+ P +    L   NG     E+ +LE  +LAM CCSPSP+LRP+ 
Sbjct  290  NPTGSVLDRNRLSDLYRPEIIRRCLKDGNG---VTEECVLEYFQLAMSCCSPSPTLRPSF  346

Query  564  KEFLTRLEEIER  529
            K+ L +LEEI +
Sbjct  347  KQVLRKLEEIRK  358



>ref|XP_006414950.1| hypothetical protein EUTSA_v10024625mg [Eutrema salsugineum]
 gb|ESQ56403.1| hypothetical protein EUTSA_v10024625mg [Eutrema salsugineum]
Length=662

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P PS+RPT++E
Sbjct  576  LPSLVKIAVLEETTMEVFDLEVL---KGIRSPMEDGLVQALKLAMGCCAPVPSVRPTMEE  632

Query  558  FLTRLEE  538
             + +LEE
Sbjct  633  VVRQLEE  639



>ref|XP_004139717.1| PREDICTED: putative kinase-like protein TMKL1-like [Cucumis sativus]
Length=712

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   D+F   VL    G +  +ED I++ L+LAM CC+P  S+RP++ E
Sbjct  626  LPSIVKVAVLEETTMDVFDVEVL---KGIRSPMEDGIVQALKLAMGCCAPVASVRPSIDE  682

Query  558  FLTRLEE  538
             + +LEE
Sbjct  683  VVKQLEE  689



>ref|XP_004953334.1| PREDICTED: putative kinase-like protein TMKL1-like [Setaria italica]
Length=414

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   KN ++E +I++ F   +    + ++   E ++     LA  CCSPSPSLRP 
Sbjct  344  DILLPASFKNLVLERKISEAFSSDL--ARHCRRSGKERNLNAYFELATACCSPSPSLRPN  401

Query  567  VKEFLTRLEEIER  529
             K  L RLEEI R
Sbjct  402  TKHVLKRLEEIAR  414



>gb|KGN44574.1| hypothetical protein Csa_7G336530 [Cucumis sativus]
Length=690

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   D+F   VL    G +  +ED I++ L+LAM CC+P  S+RP++ E
Sbjct  604  LPSIVKVAVLEETTMDVFDVEVL---KGIRSPMEDGIVQALKLAMGCCAPVASVRPSIDE  660

Query  558  FLTRLEE  538
             + +LEE
Sbjct  661  VVKQLEE  667



>ref|XP_004154481.1| PREDICTED: LOW QUALITY PROTEIN: putative kinase-like protein 
TMKL1-like [Cucumis sativus]
Length=729

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   D+F   VL    G +  +ED I++ L+LAM CC+P  S+RP++ E
Sbjct  643  LPSIVKVAVLEETTMDVFDVEVL---KGIRSPMEDGIVQALKLAMGCCAPVASVRPSIDE  699

Query  558  FLTRLEE  538
             + +LEE
Sbjct  700  VVKQLEE  706



>ref|XP_003571274.1| PREDICTED: putative kinase-like protein TMKL1 [Brachypodium distachyon]
Length=659

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 6/67 (9%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP +VK A++E+   +LFHP +           E  +++ L+LAM CC+P P+ RPT+ E
Sbjct  568  LPALVKVAVLEETTMELFHPEL------AARGAEGGLVQALKLAMGCCAPVPAARPTMAE  621

Query  558  FLTRLEE  538
             + +LEE
Sbjct  622  VVRQLEE  628



>ref|XP_008457968.1| PREDICTED: putative kinase-like protein TMKL1 isoform X2 [Cucumis 
melo]
Length=706

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   D+F   VL    G +  +ED I++ L+LAM CC+P  S+RP++ E
Sbjct  623  LPSMVKVAVLEETTMDVFDVEVL---KGIRSPMEDGIVQALKLAMGCCAPVASVRPSIDE  679

Query  558  FLTRLEE  538
             + +LEE
Sbjct  680  VVKQLEE  686



>ref|XP_008457969.1| PREDICTED: putative kinase-like protein TMKL1 isoform X3 [Cucumis 
melo]
Length=645

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   D+F   VL    G +  +ED I++ L+LAM CC+P  S+RP++ E
Sbjct  559  LPSMVKVAVLEETTMDVFDVEVL---KGIRSPMEDGIVQALKLAMGCCAPVASVRPSIDE  615

Query  558  FLTRLEE  538
             + +LEE
Sbjct  616  VVKQLEE  622



>ref|XP_008457967.1| PREDICTED: putative kinase-like protein TMKL1 isoform X1 [Cucumis 
melo]
Length=709

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   D+F   VL    G +  +ED I++ L+LAM CC+P  S+RP++ E
Sbjct  623  LPSMVKVAVLEETTMDVFDVEVL---KGIRSPMEDGIVQALKLAMGCCAPVASVRPSIDE  679

Query  558  FLTRLEE  538
             + +LEE
Sbjct  680  VVKQLEE  686



>ref|XP_010684950.1| PREDICTED: putative kinase-like protein TMKL1 [Beta vulgaris 
subsp. vulgaris]
Length=675

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP++VK A++E+   ++F   VL    G +  +ED ++  L+LAM CC+P  S RP
Sbjct  585  DYMDLPSMVKTAVLEETTMEVFDVEVL---KGIRSPMEDGLVHALKLAMGCCAPVASARP  641

Query  570  TVKEFLTRLEE  538
            T++E L +LEE
Sbjct  642  TMEEVLKQLEE  652



>ref|NP_001151835.1| protein Kinase-like protein TMKL1 [Zea mays]
 gb|ACG44517.1| protein Kinase-like protein TMKL1 precursor [Zea mays]
Length=411

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = -2

Query  723  KNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKEFLTRL  544
            KN ++E +I+D F    L +        E  +     LA  CCSPSPSLRP+ ++ L RL
Sbjct  347  KNLVLERKISDAFGSSGLARQCRSGAGKERSLGAFFELATACCSPSPSLRPSARQVLQRL  406

Query  543  EEIER  529
            +EI R
Sbjct  407  QEIAR  411



>ref|NP_001168329.1| uncharacterized LOC100382097 [Zea mays]
 gb|ACN27838.1| unknown [Zea mays]
 gb|AFW63256.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=400

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = -2

Query  723  KNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKEFLTRL  544
            KN ++E +I+D F    L +        E  +     LA  CCSPSPSLRP+ ++ L RL
Sbjct  336  KNLVLERKISDAFGSSGLARQCRSGAGKERSLGAFFELATACCSPSPSLRPSARQVLQRL  395

Query  543  EEIER  529
            +EI R
Sbjct  396  QEIAR  400



>ref|XP_007049845.1| Transmembrane kinase-like 1 isoform 1 [Theobroma cacao]
 gb|EOX94002.1| Transmembrane kinase-like 1 isoform 1 [Theobroma cacao]
Length=680

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P  S+RP
Sbjct  590  DAVDLPSMVKVAVLEETTMEVFDVEVL---KGIRSPMEDGLVQALKLAMGCCAPVASVRP  646

Query  570  TVKEFLTRLEE  538
            T+ E + +LEE
Sbjct  647  TMDEVVKQLEE  657



>ref|XP_007049846.1| Transmembrane kinase-like 1 isoform 2 [Theobroma cacao]
 gb|EOX94003.1| Transmembrane kinase-like 1 isoform 2 [Theobroma cacao]
Length=676

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P  S+RP
Sbjct  586  DAVDLPSMVKVAVLEETTMEVFDVEVL---KGIRSPMEDGLVQALKLAMGCCAPVASVRP  642

Query  570  TVKEFLTRLEE  538
            T+ E + +LEE
Sbjct  643  TMDEVVKQLEE  653



>ref|XP_010532869.1| PREDICTED: putative kinase-like protein TMKL1 [Tarenaya hassleriana]
Length=679

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP +VK A++E+   +LF   VL    G +  +E+ +++ L+LAM CC+P PS+RPT+ E
Sbjct  593  LPALVKVAVLEETTMELFDMEVL---KGIRSPLEEGLVQALKLAMGCCAPVPSVRPTMDE  649

Query  558  FLTRLEE  538
             + +LEE
Sbjct  650  VVRQLEE  656



>gb|KDP26419.1| hypothetical protein JCGZ_17577 [Jatropha curcas]
Length=684

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +E+ +++ L+LAM CC+P PS+RPT+ E
Sbjct  598  LPSMVKVAVLEETTMEVFDVEIL---KGIRNPMEEGLVQALKLAMGCCAPVPSVRPTMDE  654

Query  558  FLTRLEE  538
             + +LEE
Sbjct  655  VVKQLEE  661



>ref|XP_009131002.1| PREDICTED: putative kinase-like protein TMKL1 [Brassica rapa]
Length=341

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -2

Query  723  KNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKEFLTRL  544
            K AI +     L+ P +L  SNG  +  E+ +L+  +LAM CCSPSPSLRP  K+ L +L
Sbjct  280  KEAINKGDDHKLYRPEIL-TSNGCDDLSEEGLLKYFQLAMSCCSPSPSLRPNTKQVLMKL  338

Query  543  EEI  535
            ++I
Sbjct  339  QDI  341



>gb|KFK39767.1| hypothetical protein AALP_AA3G285100 [Arabis alpina]
Length=664

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P P++RP ++E
Sbjct  578  LPSLVKIAVLEETTMEVFDLEVL---KGIRSPMEDGLVQALKLAMGCCAPVPAVRPAMEE  634

Query  558  FLTRLEE  538
             + +LEE
Sbjct  635  VVRQLEE  641



>ref|XP_010243991.1| PREDICTED: putative kinase-like protein TMKL1 [Nelumbo nucifera]
Length=669

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P  S+RPT+ E
Sbjct  583  LPSLVKVAVLEETTMEVFDVEVL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPTMDE  639

Query  558  FLTRLEE  538
             + +LEE
Sbjct  640  VVKQLEE  646



>gb|KHF99201.1| Putative kinase-like protein TMKL1 [Gossypium arboreum]
Length=670

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P  S+RPT+ E
Sbjct  584  LPSIVKAAVLEETTMEVFDVEVL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPTMDE  640

Query  558  FLTRLEE  538
             + +LE+
Sbjct  641  VVKQLED  647



>ref|XP_010264034.1| PREDICTED: putative kinase-like protein TMKL1 isoform X1 [Nelumbo 
nucifera]
Length=706

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P  S+RPT+ E
Sbjct  582  LPSLVKVAVLEETTMEVFDVEVL---KGIRSPMEDGLIQSLKLAMGCCAPVASVRPTMDE  638

Query  558  FLTRLEE  538
             + +LEE
Sbjct  639  VVKQLEE  645



>ref|XP_010264035.1| PREDICTED: putative kinase-like protein TMKL1 isoform X2 [Nelumbo 
nucifera]
Length=670

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P  S+RPT+ E
Sbjct  582  LPSLVKVAVLEETTMEVFDVEVL---KGIRSPMEDGLIQSLKLAMGCCAPVASVRPTMDE  638

Query  558  FLTRLEE  538
             + +LEE
Sbjct  639  VVKQLEE  645



>gb|KJB42427.1| hypothetical protein B456_007G152400 [Gossypium raimondii]
Length=670

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +ED +++ L+LAM CC+P  S+RPT+ E
Sbjct  584  LPSIVKAAVLEETTMEVFDVEVL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPTMDE  640

Query  558  FLTRLEE  538
             + +LE+
Sbjct  641  VVKQLED  647



>gb|EAZ08043.1| hypothetical protein OsI_30307 [Oryza sativa Indica Group]
Length=201

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = -2

Query  738  LPNVVKNAIIED-RITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVK  562
            LP VVK A++E+  + ++F   V   + G +   E+ +L+ L+LAM CC+P  S RPT+ 
Sbjct  107  LPAVVKAAVLEEVTMMEVFDAEV---ARGVRSPAEEGLLQALKLAMGCCAPVASARPTMA  163

Query  561  EFLTRLEEI  535
            E + +LEE+
Sbjct  164  EVVRQLEEV  172



>gb|EPS73747.1| hypothetical protein M569_01008 [Genlisea aurea]
Length=675

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDH-ILELLRLAMDCCSPSPSLRPTVK  562
            LP +VK A++E+   D+F   V+    G +  +ED  +++ LRLAM CCSP  ++RPT++
Sbjct  588  LPALVKGAVLEETTVDVFDGEVV---KGVRNPMEDGGLIQALRLAMGCCSPVAAVRPTME  644

Query  561  EFLTRLEE  538
            E + +LEE
Sbjct  645  EVVRQLEE  652



>ref|XP_008663534.1| PREDICTED: putative kinase-like protein TMKL1 [Zea mays]
 gb|AFW59287.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=375

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   ++ ++E +I++ F   +L + + K   +E  +     LA  CC+PSPSLRP 
Sbjct  303  DIHLPASFRDLVLERKISEAFGSELLLKRS-KDSGMEGRLDAYFELATACCNPSPSLRPD  361

Query  567  VKEFLTRLEEIER  529
             K+ L RLE+I R
Sbjct  362  TKKILKRLEDIAR  374



>gb|KDO65868.1| hypothetical protein CISIN_1g0057491mg, partial [Citrus sinensis]
Length=212

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   ++    G +  +E+ +++ L+LAM CC+P  S+RPT+ E
Sbjct  126  LPSIVKVAVLEETTMEVFDMEIM---KGIRSPMEEGLVQALKLAMGCCAPVASVRPTMDE  182

Query  558  FLTRLEE  538
             + +LEE
Sbjct  183  VVKQLEE  189



>ref|XP_010935684.1| PREDICTED: putative kinase-like protein TMKL1 [Elaeis guineensis]
Length=664

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +   ED +++ LRLAM CC+P  S+RP + E
Sbjct  578  LPSLVKVAVLEEATIEVFDVEIL---KGIRSPTEDGLVQALRLAMGCCAPVASVRPGMNE  634

Query  558  FLTRLEE  538
             + +LEE
Sbjct  635  VVKQLEE  641



>ref|XP_009395304.1| PREDICTED: putative kinase-like protein TMKL1 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP++VK A++E+   ++F   VL    G +   E+ +++ LRLAM CC+P  S+RP
Sbjct  596  DVVDLPSLVKVAVLEEATMEVFDAEVL---KGVRSPTEEGLVQALRLAMGCCAPVASVRP  652

Query  570  TVKEFLTRLEE  538
             + E + +LEE
Sbjct  653  DMNEVVKQLEE  663



>ref|XP_010652466.1| PREDICTED: putative kinase-like protein TMKL1 [Vitis vinifera]
Length=675

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RP
Sbjct  585  DFVDLPSMVKVAVLEETTMEVFDVEVL---KGIRSPMEEGLVQALKLAMGCCAPVASVRP  641

Query  570  TVKEFLTRLEE  538
            T+ E + +LEE
Sbjct  642  TMDEVVKQLEE  652



>ref|XP_007140555.1| hypothetical protein PHAVU_008G122400g [Phaseolus vulgaris]
 gb|ESW12549.1| hypothetical protein PHAVU_008G122400g [Phaseolus vulgaris]
Length=687

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +ED +++ L+LAM CC+P  S+RP+++E
Sbjct  601  LPSMVKVAVLEETTMEVFDVELL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPSIEE  657

Query  558  FLTRLEE  538
             + +LEE
Sbjct  658  VVRQLEE  664



>emb|CAN75299.1| hypothetical protein VITISV_008676 [Vitis vinifera]
Length=628

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RP
Sbjct  538  DFVDLPSMVKVAVLEETTMEVFDVEVL---KGIRSPMEEGLVQALKLAMGCCAPVASVRP  594

Query  570  TVKEFLTRLEE  538
            T+ E + +LEE
Sbjct  595  TMDEVVKQLEE  605



>gb|EYU17973.1| hypothetical protein MIMGU_mgv1a002458mg [Erythranthe guttata]
Length=671

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   V+    G +  +E+ +++ L+LAM CC+P  S+RPT++E
Sbjct  585  LPSIVKVAVLEETTMEVFDVEVV---RGMRSPMEEGLVQALKLAMGCCAPVGSVRPTMEE  641

Query  558  FLTRLEE  538
             + +LEE
Sbjct  642  VVRQLEE  648



>ref|XP_002303085.2| kinase-like protein TMKL1 precursor [Populus trichocarpa]
 gb|EEE82358.2| kinase-like protein TMKL1 precursor [Populus trichocarpa]
Length=678

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RPT+ E
Sbjct  592  LPSMVKVAVLEETTMEVFDLEVL---KGVRSPMEEGLVQALKLAMGCCAPVASVRPTMDE  648

Query  558  FLTRLEE  538
             + +LEE
Sbjct  649  VVKQLEE  655



>ref|XP_011024555.1| PREDICTED: putative kinase-like protein TMKL1 [Populus euphratica]
Length=678

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RPT+ E
Sbjct  592  LPSMVKVAVLEETTMEVFDLEVL---KGVRSPMEEGLVQALKLAMGCCAPVASVRPTMDE  648

Query  558  FLTRLEE  538
             + +LEE
Sbjct  649  VVKQLEE  655



>ref|XP_008382654.1| PREDICTED: putative kinase-like protein TMKL1 [Malus domestica]
Length=675

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP +VK A++E+   ++F   VL    G + A+E+ +++ L+LAM CC+P  S+RP
Sbjct  585  DFVDLPLMVKVAVLEETTLEVFDVEVL---KGVRSAMEEGLVQALKLAMGCCAPVASVRP  641

Query  570  TVKEFLTRLEE  538
            ++ E + +LEE
Sbjct  642  SMDEVVRQLEE  652



>ref|XP_004515613.1| PREDICTED: putative kinase-like protein TMKL1-like [Cicer arietinum]
Length=682

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +ED +++ L+LAM CC+P  S+RP++ E
Sbjct  596  LPSIVKVAVLEETTMEVFDVELL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPSMDE  652

Query  558  FLTRLEE  538
             + +LEE
Sbjct  653  VVRQLEE  659



>ref|XP_010069673.1| PREDICTED: putative kinase-like protein TMKL1 [Eucalyptus grandis]
 gb|KCW58087.1| hypothetical protein EUGRSUZ_H00812 [Eucalyptus grandis]
Length=680

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = -2

Query  753  KDDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLR  574
             D + LP++VK A++E+   ++F   V   + G +  +E+ +++ L+LAM CC+P  S+R
Sbjct  589  SDYVDLPSMVKVAVLEETTLEVFDIEV---TRGIRSPMEEGLVQALKLAMGCCAPVASVR  645

Query  573  PTVKEFLTRLEE  538
            PT+ E + +LEE
Sbjct  646  PTMDEVVKQLEE  657



>gb|KEH22828.1| LRR receptor-like kinase [Medicago truncatula]
Length=681

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +ED +++ L+LAM CC+P  S+RP+++E
Sbjct  595  LPSMVKVAVLEETTMEVFDVELL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPSMEE  651

Query  558  FLTRLEE  538
             + +LEE
Sbjct  652  VVRQLEE  658



>ref|XP_009624535.1| PREDICTED: putative kinase-like protein TMKL1 [Nicotiana tomentosiformis]
Length=667

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D++ LP +VK A++E+   ++F   +L    G +  +E+ +++ LRLAM CC+P  ++RP
Sbjct  577  DNVDLPALVKVAVLEETTMEVFDVELL---KGIRNPMEEGLVQALRLAMGCCAPVATVRP  633

Query  570  TVKEFLTRLEE  538
            +++E + +LEE
Sbjct  634  SMEEVVRQLEE  644



>ref|XP_008669060.1| PREDICTED: putative kinase-like protein TMKL1 [Zea mays]
 tpg|DAA36577.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=365

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  747  DIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPT  568
            DI LP   ++ ++E +I++ F   ++ QS  K    E ++     LA  CC+PS SLRP 
Sbjct  295  DIHLPVSFRDLVLERKISEAFSSELIIQS--KNSGKEGNLNAYFELATACCNPSSSLRPD  352

Query  567  VKEFLTRLEEIER  529
             K+ L RLE+I R
Sbjct  353  TKKILKRLEDIAR  365



>ref|XP_009804998.1| PREDICTED: putative kinase-like protein TMKL1 [Nicotiana sylvestris]
Length=670

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D++ LP +VK A++E+   ++F   +L    G +  +E+ +++ LRLAM CC+P  ++RP
Sbjct  580  DNVDLPALVKVAVLEETTMEVFDVELL---KGIRNPMEEGLVQALRLAMGCCAPVATVRP  636

Query  570  TVKEFLTRLEE  538
            +++E + +LEE
Sbjct  637  SMEEVVRQLEE  647



>ref|XP_006443656.1| hypothetical protein CICLE_v10019548mg [Citrus clementina]
 gb|ESR56896.1| hypothetical protein CICLE_v10019548mg [Citrus clementina]
Length=556

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   ++    G +  +E+ +++ L+LAM CC+P  S+RPT+ E
Sbjct  470  LPSIVKVAVLEETTMEVFDMEIM---KGIRSPMEEGLVQALKLAMGCCAPVASVRPTMDE  526

Query  558  FLTRLEE  538
             + +LEE
Sbjct  527  VVKQLEE  533



>ref|XP_010109686.1| Putative kinase-like protein TMKL1 [Morus notabilis]
 gb|EXC24156.1| Putative kinase-like protein TMKL1 [Morus notabilis]
Length=697

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RPT+ E
Sbjct  611  LPSMVKVAVLEETTMEVFDVEVL---KGIRSPMEEGLIQALKLAMGCCAPVRSVRPTMDE  667

Query  558  FLTRLEE  538
             + +LEE
Sbjct  668  VVKQLEE  674



>ref|XP_002521132.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF41283.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=687

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP +VK A++E+   ++F   +L    G +  +E+ +++ L+LAM CC+P PS+RP
Sbjct  597  DFVDLPAMVKVAVLEETTMEVFDVELL---RGIRSPMEEGLVQALKLAMGCCAPVPSVRP  653

Query  570  TVKEFLTRLEE  538
             + E + +LEE
Sbjct  654  AMDEVVKQLEE  664



>ref|XP_006480189.1| PREDICTED: putative kinase-like protein TMKL1-like [Citrus sinensis]
Length=679

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   ++    G +  +E+ +++ L+LAM CC+P  S+RPT+ E
Sbjct  593  LPSIVKVAVLEETTMEVFDMEIM---KGIRSPMEEGLVQALKLAMGCCAPVASVRPTMDE  649

Query  558  FLTRLEE  538
             + +LEE
Sbjct  650  VVKQLEE  656



>ref|XP_008789531.1| PREDICTED: putative kinase-like protein TMKL1 [Phoenix dactylifera]
Length=664

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            + + LP++VK A++E+   ++F   +L    G +   ED +++ L+LAM CC+P  S+RP
Sbjct  574  EGVDLPSLVKVAVLEETTMEVFDVEIL---KGIRSPTEDGLVQALKLAMGCCAPVASVRP  630

Query  570  TVKEFLTRLEE  538
             + E + +LEE
Sbjct  631  DMNEVVKQLEE  641



>gb|KHN25001.1| Putative kinase-like protein TMKL1 [Glycine soja]
Length=690

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +ED +++ L+LAM CC+P  S+RP++ E
Sbjct  604  LPSMVKVAVLEETTMEVFDVELL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPSMDE  660

Query  558  FLTRLEE  538
             + +LEE
Sbjct  661  VVRQLEE  667



>gb|KHN07823.1| Putative kinase-like protein TMKL1 [Glycine soja]
Length=687

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +ED +++ L+LAM CC+P  S+RP++ E
Sbjct  601  LPSMVKVAVLEETTMEVFDVELL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPSMDE  657

Query  558  FLTRLEE  538
             + +LEE
Sbjct  658  VVRQLEE  664



>ref|XP_010527218.1| PREDICTED: LOW QUALITY PROTEIN: putative kinase-like protein 
TMKL1 [Tarenaya hassleriana]
Length=680

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 44/67 (66%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP +VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P P++RP + E
Sbjct  594  LPALVKVAVLEETTMEVFDVEVL---KGIRSPMEEGLVQALKLAMGCCAPVPTVRPAMDE  650

Query  558  FLTRLEE  538
             + +LEE
Sbjct  651  VVRQLEE  657



>ref|XP_003551441.1| PREDICTED: putative kinase-like protein TMKL1-like [Glycine max]
Length=699

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +ED +++ L+LAM CC+P  S+RP++ E
Sbjct  613  LPSMVKVAVLEETTMEVFDVELL---KGIRSPMEDGLVQALKLAMGCCAPVASVRPSMDE  669

Query  558  FLTRLEE  538
             + +LEE
Sbjct  670  VVRQLEE  676



>ref|XP_006350300.1| PREDICTED: putative kinase-like protein TMKL1-like [Solanum tuberosum]
 gb|AGO98726.1| ovary receptor kinase 7 [Solanum chacoense]
Length=663

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D++ LP +VK A++E+   ++F   +L    G +  +E+ +++ LRLAM CC+P  ++RP
Sbjct  573  DNVDLPALVKVAVLEETTMEVFDMELL---KGIRNPMEEGLVQALRLAMGCCAPVATVRP  629

Query  570  TVKEFLTRLEE  538
            ++ E + +LEE
Sbjct  630  SMDEVVRQLEE  640



>emb|CBI38658.3| unnamed protein product [Vitis vinifera]
Length=10376

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  639    EDHILELLRLAMDCCSPSPSLRPTVKEFLTRLEEI  535
              E+ +L+L +LAM CCSPSP+LRP +K+ L ++EEI
Sbjct  10340  EECVLKLFQLAMACCSPSPTLRPNIKQILRKMEEI  10374



>dbj|BAD10321.1| putative SERK2 protein [Oryza sativa Japonica Group]
 dbj|BAD12945.1| putative SERK2 protein [Oryza sativa Japonica Group]
Length=616

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = -2

Query  738  LPNVVKNAIIED-RITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVK  562
            LP VVK A++E+  + ++F   V   + G +   E+ +L+ L+LAM CC+P  S RPT+ 
Sbjct  522  LPAVVKAAVLEEVTMMEVFDAEV---ARGVRSPAEEGLLQALKLAMGCCAPVASARPTMA  578

Query  561  EFLTRLEEI  535
            E + +LEE+
Sbjct  579  EVVRQLEEV  587



>gb|EAZ43686.1| hypothetical protein OsJ_28311 [Oryza sativa Japonica Group]
Length=624

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = -2

Query  738  LPNVVKNAIIED-RITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVK  562
            LP VVK A++E+  + ++F   V   + G +   E+ +L+ L+LAM CC+P  S RPT+ 
Sbjct  530  LPAVVKAAVLEEVTMMEVFDAEV---ARGVRSPAEEGLLQALKLAMGCCAPVASARPTMA  586

Query  561  EFLTRLEEI  535
            E + +LEE+
Sbjct  587  EVVRQLEEV  595



>ref|XP_007201714.1| hypothetical protein PRUPE_ppa003735mg [Prunus persica]
 gb|EMJ02913.1| hypothetical protein PRUPE_ppa003735mg [Prunus persica]
Length=552

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RP++ E
Sbjct  466  LPSMVKVAVLEETTLEVFDVEVL---KGVRSPMEEGLVQALKLAMGCCAPVASVRPSMDE  522

Query  558  FLTRLEE  538
             + +LEE
Sbjct  523  VVKQLEE  529



>ref|NP_001062532.2| Os08g0564700 [Oryza sativa Japonica Group]
 dbj|BAF24446.2| Os08g0564700 [Oryza sativa Japonica Group]
Length=662

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = -2

Query  738  LPNVVKNAIIED-RITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVK  562
            LP VVK A++E+  + ++F   V   + G +   E+ +L+ L+LAM CC+P  S RPT+ 
Sbjct  568  LPAVVKAAVLEEVTMMEVFDAEV---ARGVRSPAEEGLLQALKLAMGCCAPVASARPTMA  624

Query  561  EFLTRLEEI  535
            E + +LEE+
Sbjct  625  EVVRQLEEV  633



>ref|XP_008372436.1| PREDICTED: putative kinase-like protein TMKL1 [Malus domestica]
Length=671

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 44/67 (66%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ + + L+LAM CC+P  S+RP++ E
Sbjct  586  LPSMVKVAVLEETTLEVFDVEVL---KGVRSPMEEGLFQALKLAMGCCAPVASVRPSMDE  642

Query  558  FLTRLEE  538
             + +LEE
Sbjct  643  VVKQLEE  649



>ref|XP_008235521.1| PREDICTED: putative kinase-like protein TMKL1 [Prunus mume]
Length=687

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RP++ E
Sbjct  601  LPSMVKVAVLEETTLEVFDVEVL---KGVRSPMEEGLVQALKLAMGCCAPVASVRPSMDE  657

Query  558  FLTRLEE  538
             + +LEE
Sbjct  658  VVKQLEE  664



>emb|CDP03844.1| unnamed protein product [Coffea canephora]
Length=336

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -2

Query  750  DDIFLPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRP  571
            D + LP++VK A++E+   ++F   +L    G +  +E+ +++ L+LAM CC+P  S+RP
Sbjct  246  DFVDLPSLVKVAVLEETTMEVFDVELL---KGTRSPMEEGLVQALKLAMGCCAPVASVRP  302

Query  570  TVKEFLTRLEE  538
             + E + +LEE
Sbjct  303  AMDEVVRQLEE  313



>ref|XP_009371182.1| PREDICTED: putative kinase-like protein TMKL1 [Pyrus x bretschneideri]
Length=672

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RP++ E
Sbjct  586  LPSMVKVAVLEETTPEVFDVEVL---KGVRSPMEEGLVQALKLAMGCCAPVASVRPSMDE  642

Query  558  FLTRLEE  538
             + +LEE
Sbjct  643  VVKQLEE  649



>ref|XP_011083107.1| PREDICTED: putative kinase-like protein TMKL1 [Sesamum indicum]
Length=662

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +E+ +++ L+LAM CC+P  S+RPT+ E
Sbjct  576  LPSLVKVAVLEETTMEVFDVELL---KGIRNPMEEGLVQALKLAMGCCAPVASVRPTMDE  632

Query  558  FLTRLEE  538
             + +LEE
Sbjct  633  VVRQLEE  639



>ref|XP_004292387.1| PREDICTED: putative kinase-like protein TMKL1 [Fragaria vesca 
subsp. vesca]
Length=671

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   VL    G +  +E+ +++ L+LAM CC+P  S+RP++ E
Sbjct  585  LPSLVKVAVLEETTLEVFDVEVL---KGIRNPMEEGLVQALKLAMGCCAPVASVRPSMDE  641

Query  558  FLTRLEE  538
             + +LEE
Sbjct  642  VVKQLEE  648



>ref|XP_009349843.1| PREDICTED: putative kinase-like protein TMKL1 [Pyrus x bretschneideri]
Length=672

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP +VK A++E+   ++F   +L    G + A+E+ +++ L+LAM CC+P  S+RP++ E
Sbjct  586  LPLMVKVAVLEETTLEVFDVELL---KGVRSAMEEGLVQALKLAMGCCAPVASVRPSMDE  642

Query  558  FLTRLEE  538
             + +LEE
Sbjct  643  VVRQLEE  649



>ref|XP_011080164.1| PREDICTED: LOW QUALITY PROTEIN: putative kinase-like protein 
TMKL1 [Sesamum indicum]
Length=657

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  738  LPNVVKNAIIEDRITDLFHPMVLGQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            LP++VK A++E+   ++F   +L    G +  +E+ ++++L+LAM CC+P  S+RP + E
Sbjct  571  LPSLVKVAVLEETTMEIFDVELL---KGIRNPMEEGLVQILKLAMGCCAPVTSVRPAMDE  627

Query  558  FLTRLEE  538
             + +LEE
Sbjct  628  IVRQLEE  634



>ref|XP_006394491.1| hypothetical protein EUTSA_v10004479mg [Eutrema salsugineum]
 gb|ESQ31777.1| hypothetical protein EUTSA_v10004479mg [Eutrema salsugineum]
Length=357

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = -2

Query  732  NVVKNAIIEDRITDLFHPMVL--GQSNGKKEAVEDHILELLRLAMDCCSPSPSLRPTVKE  559
            N   + +  +++ DL+   +L  G  +G     ++ +LE ++LAM CCSPS SLRP+ K+
Sbjct  289  NPTGSVLDHNKLLDLYRTEILRRGVKDGTG-VTKECVLEYIQLAMSCCSPSTSLRPSFKQ  347

Query  558  FLTRLEEIER  529
             L  LEEI R
Sbjct  348  VLRNLEEIRR  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050