BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004K11

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP21547.1|  unnamed protein product                                187   2e-51   Coffea canephora [robusta coffee]
ref|XP_009594458.1|  PREDICTED: pectinesterase                          179   2e-48   Nicotiana tomentosiformis
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    178   7e-48   Sesamum indicum [beniseed]
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                176   9e-47   Erythranthe guttata [common monkey flower]
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     174   1e-46   Nicotiana sylvestris
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                172   9e-46   Erythranthe guttata [common monkey flower]
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    168   2e-44   Solanum tuberosum [potatoes]
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    166   6e-44   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    165   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_010315470.1|  PREDICTED: pectinesterase                          164   3e-43   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    161   3e-42   Eucalyptus grandis [rose gum]
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    160   4e-42   Populus euphratica
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    160   5e-42   Eucalyptus grandis [rose gum]
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             161   5e-42   Capsella rubella
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    160   6e-42   Vitis vinifera
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    160   6e-42   Cucumis melo [Oriental melon]
ref|XP_002314364.1|  putative pectinesterase family protein             160   7e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002884519.1|  pectinesterase family protein                      160   7e-42   
emb|CBI39537.3|  unnamed protein product                                160   1e-41   Vitis vinifera
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    159   1e-41   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    159   2e-41   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    159   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    159   2e-41   Populus euphratica
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    159   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     159   2e-41   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             158   4e-41   
emb|CDY40719.1|  BnaC03g34350D                                          156   5e-41   Brassica napus [oilseed rape]
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    158   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    158   7e-41   Camelina sativa [gold-of-pleasure]
dbj|BAC42986.1|  putative pectinesterase                                158   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    157   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    157   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          157   1e-40   Amborella trichopoda
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    157   2e-40   Arabis alpina [alpine rockcress]
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    157   2e-40   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    157   2e-40   Brassica rapa
ref|XP_006382447.1|  pectin methylesterase family protein               155   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    155   3e-40   Populus euphratica
ref|XP_002872255.1|  pectinesterase family protein                      156   3e-40   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    155   3e-40   Camelina sativa [gold-of-pleasure]
gb|EPS69059.1|  hypothetical protein M569_05708                         158   4e-40   Genlisea aurea
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    155   4e-40   Morus notabilis
emb|CDY05188.1|  BnaC05g46150D                                          155   5e-40   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          155   5e-40   
emb|CDY27751.1|  BnaA05g31600D                                          155   6e-40   Brassica napus [oilseed rape]
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    155   6e-40   Brassica rapa
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    155   8e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74137.1|  BnaA03g29100D                                          155   9e-40   
emb|CDY19737.1|  BnaA09g03900D                                          153   1e-39   Brassica napus [oilseed rape]
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    153   2e-39   Cucumis sativus [cucumbers]
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    154   2e-39   Brassica rapa
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             153   2e-39   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    153   3e-39   
emb|CDO98832.1|  unnamed protein product                                152   3e-39   Coffea canephora [robusta coffee]
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    152   4e-39   Morus notabilis
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    152   5e-39   Vitis vinifera
emb|CBI22967.3|  unnamed protein product                                155   7e-39   Vitis vinifera
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    152   7e-39   Brassica rapa
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    152   7e-39   Prunus mume [ume]
emb|CDX99968.1|  BnaC09g03330D                                          152   7e-39   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             151   8e-39   Eutrema salsugineum [saltwater cress]
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    151   9e-39   Phoenix dactylifera
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             152   1e-38   Capsella rubella
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    153   1e-38   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    150   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    150   3e-38   Eucalyptus grandis [rose gum]
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    151   3e-38   Arabis alpina [alpine rockcress]
ref|XP_002512459.1|  Pectinesterase precursor, putative                 149   5e-38   Ricinus communis
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         149   8e-38   Jatropha curcas
gb|EPS65387.1|  pectinesterase                                          148   1e-37   Genlisea aurea
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         147   2e-37   Jatropha curcas
emb|CDO98833.1|  unnamed protein product                                147   2e-37   Coffea canephora [robusta coffee]
emb|CDX80613.1|  BnaC07g28310D                                          146   1e-36   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    146   1e-36   Brassica rapa
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         145   1e-36   Jatropha curcas
emb|CDY68790.1|  BnaAnng28400D                                          145   2e-36   Brassica napus [oilseed rape]
gb|EPS66234.1|  hypothetical protein M569_08543                         144   3e-36   Genlisea aurea
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     144   3e-36   Sesamum indicum [beniseed]
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    144   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    143   5e-36   Oryza brachyantha
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    143   5e-36   Cucumis melo [Oriental melon]
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     143   8e-36   Nicotiana tomentosiformis
gb|EAY94388.1|  hypothetical protein OsI_16156                          143   9e-36   Oryza sativa Indica Group [Indian rice]
emb|CAH67075.1|  OSIGBa0097P08.5                                        143   9e-36   Oryza sativa [red rice]
ref|NP_001052981.1|  Os04g0458900                                       143   9e-36   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             144   9e-36   Eutrema salsugineum [saltwater cress]
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    143   1e-35   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    145   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010276570.1|  PREDICTED: pectinesterase 2-like                   136   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    142   1e-35   Cucumis sativus [cucumbers]
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     142   1e-35   Prunus mume [ume]
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    142   2e-35   Eucalyptus grandis [rose gum]
emb|CDO98834.1|  unnamed protein product                                142   2e-35   Coffea canephora [robusta coffee]
gb|EAY94391.1|  hypothetical protein OsI_16158                          142   2e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     142   2e-35   Sesamum indicum [beniseed]
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    142   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    142   2e-35   Elaeis guineensis
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    141   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    141   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    141   4e-35   Phoenix dactylifera
ref|XP_009761202.1|  PREDICTED: pectinesterase                          140   5e-35   Nicotiana sylvestris
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    141   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             140   6e-35   Prunus persica
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    140   7e-35   Citrus sinensis [apfelsine]
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   140   7e-35   Citrus sinensis [apfelsine]
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     140   7e-35   Triticum urartu
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    140   8e-35   Nelumbo nucifera [Indian lotus]
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    140   8e-35   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          140   8e-35   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                140   9e-35   Erythranthe guttata [common monkey flower]
gb|ACF79975.1|  unknown                                                 140   1e-34   Zea mays [maize]
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    140   1e-34   
ref|XP_008219291.1|  PREDICTED: probable pectinesterase/pectinest...    139   1e-34   Prunus mume [ume]
ref|XP_002865716.1|  pectinesterase family protein                      139   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     139   2e-34   Nicotiana sylvestris
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     139   2e-34   Brachypodium distachyon [annual false brome]
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    139   2e-34   Brassica rapa
ref|NP_001105487.1|  pectin methylesterase1                             139   2e-34   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     139   2e-34   Nicotiana tomentosiformis
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             139   2e-34   Capsella rubella
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    139   3e-34   Setaria italica
ref|XP_002516960.1|  Pectinesterase precursor, putative                 139   3e-34   Ricinus communis
ref|XP_007222884.1|  hypothetical protein PRUPE_ppa003581mg             138   3e-34   Prunus persica
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    138   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010667122.1|  PREDICTED: pectinesterase                          138   3e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB57711.1|  hypothetical protein B456_009G176700                    138   3e-34   Gossypium raimondii
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     138   3e-34   Elaeis guineensis
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    138   3e-34   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    138   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     138   4e-34   Glycine soja [wild soybean]
emb|CDY71928.1|  BnaCnng75130D                                          136   5e-34   Brassica napus [oilseed rape]
ref|XP_004299720.1|  PREDICTED: probable pectinesterase/pectinest...    137   6e-34   Fragaria vesca subsp. vesca
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    137   7e-34   Cicer arietinum [garbanzo]
ref|XP_004298254.1|  PREDICTED: pectinesterase-like                     137   7e-34   Fragaria vesca subsp. vesca
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    137   7e-34   Glycine max [soybeans]
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     137   7e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    137   8e-34   Vitis vinifera
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              137   8e-34   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     137   9e-34   Pyrus x bretschneideri [bai li]
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     137   9e-34   Pyrus x bretschneideri [bai li]
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     137   1e-33   
gb|AFG69043.1|  hypothetical protein 2_5100_02                          129   1e-33   Pinus taeda
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          137   1e-33   Sorghum bicolor [broomcorn]
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     137   1e-33   Nicotiana sylvestris
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     137   1e-33   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    134   2e-33   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     136   2e-33   Nicotiana sylvestris
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     136   2e-33   Malus domestica [apple tree]
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    136   2e-33   Citrus sinensis [apfelsine]
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    136   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     136   2e-33   Nicotiana tomentosiformis
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   136   2e-33   Citrus sinensis [apfelsine]
gb|EYU33104.1|  hypothetical protein MIMGU_mgv1a012115mg                132   3e-33   Erythranthe guttata [common monkey flower]
emb|CDY34927.1|  BnaA01g32580D                                          135   3e-33   Brassica napus [oilseed rape]
emb|CDY33925.1|  BnaA02g30620D                                          135   3e-33   Brassica napus [oilseed rape]
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    135   3e-33   Brassica rapa
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    135   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    135   4e-33   Populus euphratica
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    135   4e-33   Camelina sativa [gold-of-pleasure]
emb|CDY57858.1|  BnaC08g47740D                                          135   4e-33   Brassica napus [oilseed rape]
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    135   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    137   4e-33   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    135   4e-33   Morus notabilis
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             135   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    135   5e-33   
gb|KJB38563.1|  hypothetical protein B456_006G260900                    135   6e-33   Gossypium raimondii
ref|XP_002324181.2|  pectinesterase family protein                      135   6e-33   
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   130   7e-33   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     134   7e-33   Nicotiana tomentosiformis
gb|AFG69049.1|  hypothetical protein 2_5100_02                          126   9e-33   Pinus taeda
gb|KJB38562.1|  hypothetical protein B456_006G260800                    134   9e-33   Gossypium raimondii
gb|KHN34209.1|  Putative pectinesterase/pectinesterase inhibitor 13     134   9e-33   Glycine soja [wild soybean]
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            134   9e-33   Morus notabilis
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             134   1e-32   Prunus persica
ref|XP_003591166.1|  Pectinesterase                                     134   1e-32   Medicago truncatula
ref|XP_007031044.1|  Pectinesterase, putative                           134   1e-32   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             134   1e-32   Capsella rubella
emb|CAA96436.1|  pectin methylesterase                                  130   1e-32   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     134   1e-32   Eucalyptus grandis [rose gum]
ref|XP_008347782.1|  PREDICTED: probable pectinesterase/pectinest...    134   1e-32   Malus domestica [apple tree]
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    134   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          134   2e-32   
gb|AEW08385.1|  hypothetical protein 2_7981_01                          126   2e-32   Pinus radiata
ref|XP_007138601.1|  hypothetical protein PHAVU_009G222600g             134   2e-32   Phaseolus vulgaris [French bean]
ref|XP_010240510.1|  PREDICTED: probable pectinesterase/pectinest...    135   2e-32   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                133   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             133   2e-32   Citrus clementina [clementine]
ref|XP_003591164.1|  Pectinesterase                                     133   2e-32   Medicago truncatula
ref|XP_002266980.1|  PREDICTED: pectinesterase                          133   2e-32   Vitis vinifera
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         133   2e-32   Jatropha curcas
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    133   2e-32   Solanum tuberosum [potatoes]
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    133   2e-32   Malus domestica [apple tree]
ref|XP_002512461.1|  Pectinesterase-2 precursor, putative               135   2e-32   
ref|XP_003609936.1|  Pectinesterase                                     133   2e-32   Medicago truncatula
dbj|BAF42040.1|  pectin methylesterase 3                                133   2e-32   Pyrus communis
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     135   3e-32   Triticum urartu
emb|CAA96434.1|  pectin methylesterase                                  130   3e-32   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CAA96435.1|  pectin methylesterase                                  130   3e-32   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    133   3e-32   Populus euphratica
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    133   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003604119.1|  Pectinesterase                                     134   3e-32   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    133   3e-32   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    133   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002882495.1|  pectinesterase family protein                      133   3e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    132   3e-32   
ref|XP_006597897.1|  PREDICTED: putative pectinesterase/pectinest...    134   3e-32   Glycine max [soybeans]
ref|XP_006587076.1|  PREDICTED: probable pectinesterase/pectinest...    132   3e-32   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    132   4e-32   Tarenaya hassleriana [spider flower]
gb|AFW03480.1|  pectin methylesterase 1                                 132   4e-32   Gossypium hirsutum [American cotton]
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     133   4e-32   Elaeis guineensis
ref|XP_004299719.1|  PREDICTED: probable pectinesterase/pectinest...    132   4e-32   Fragaria vesca subsp. vesca
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    133   4e-32   Morus notabilis
gb|AFB77929.1|  pectin methylesterase                                   132   4e-32   Gossypium hirsutum [American cotton]
gb|KHG08631.1|  Pectinesterase 3                                        132   4e-32   Gossypium arboreum [tree cotton]
gb|AFW03475.1|  pectin methylesterase 1                                 132   4e-32   Gossypium barbadense [Egyptian cotton]
gb|KHN45042.1|  Putative pectinesterase/pectinesterase inhibitor 13     130   4e-32   Glycine soja [wild soybean]
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    132   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    132   4e-32   Brassica rapa
gb|KJB57093.1|  hypothetical protein B456_009G147900                    132   4e-32   Gossypium raimondii
ref|XP_007154534.1|  hypothetical protein PHAVU_003G126700g             132   5e-32   Phaseolus vulgaris [French bean]
ref|XP_003591484.1|  Pectinesterase                                     129   5e-32   Medicago truncatula
emb|CAC09455.2|  H0423H10.1                                             134   5e-32   Oryza sativa [red rice]
gb|AAL66865.1|  pectin methylesterase                                   125   5e-32   Orobanche cernua var. cumana
ref|XP_007222797.1|  hypothetical protein PRUPE_ppa003578mg             132   5e-32   Prunus persica
ref|XP_004299718.2|  PREDICTED: pectinesterase-like                     132   6e-32   Fragaria vesca subsp. vesca
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     132   6e-32   Prunus mume [ume]
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    132   6e-32   Tarenaya hassleriana [spider flower]
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     132   6e-32   Solanum lycopersicum
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             132   7e-32   Prunus persica
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     131   7e-32   
gb|AGR44472.1|  pectin methylesterase 3                                 132   7e-32   Pyrus x bretschneideri [bai li]
emb|CDO99718.1|  unnamed protein product                                131   8e-32   Coffea canephora [robusta coffee]
ref|XP_002275000.1|  PREDICTED: pectinesterase                          131   9e-32   Vitis vinifera
gb|AAF63815.1|  pectin methylesterase, putative                         131   9e-32   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42959.2|  putative pectin methylesterase                         131   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    131   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     131   9e-32   Nicotiana sylvestris
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    131   1e-31   Gossypium arboreum [tree cotton]
emb|CBI26012.3|  unnamed protein product                                131   1e-31   Vitis vinifera
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 130   1e-31   Gossypium arboreum [tree cotton]
dbj|BAF95866.1|  pectin methylesterase isoform alpha                    127   1e-31   Vitis hybrid cultivar
emb|CDP19930.1|  unnamed protein product                                131   1e-31   Coffea canephora [robusta coffee]
gb|EAY95754.1|  hypothetical protein OsI_17629                          134   1e-31   Oryza sativa Indica Group [Indian rice]
emb|CAH68135.1|  B0414F07.5                                             134   1e-31   Oryza sativa [red rice]
ref|NP_001054042.1|  Os04g0641200                                       134   1e-31   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     134   1e-31   
ref|XP_006828613.1|  hypothetical protein AMTR_s00129p00074780          132   1e-31   
ref|XP_010556727.1|  PREDICTED: probable pectinesterase/pectinest...    131   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    131   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_003591498.1|  Pectinesterase                                     129   1e-31   
emb|CDO97716.1|  unnamed protein product                                130   1e-31   Coffea canephora [robusta coffee]
ref|XP_009364480.1|  PREDICTED: pectinesterase                          131   1e-31   Pyrus x bretschneideri [bai li]
emb|CDY05295.1|  BnaC05g45080D                                          131   1e-31   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          131   1e-31   Prunus mume [ume]
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             131   1e-31   Prunus persica
emb|CBI37070.3|  unnamed protein product                                127   1e-31   Vitis vinifera
ref|XP_006444393.1|  hypothetical protein CICLE_v10023718mg             130   1e-31   
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            132   1e-31   
ref|XP_008371117.1|  PREDICTED: pectinesterase                          130   1e-31   
gb|KDO40320.1|  hypothetical protein CISIN_1g048471mg                   125   1e-31   Citrus sinensis [apfelsine]
dbj|BAK06157.1|  predicted protein                                      133   1e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010507786.1|  PREDICTED: probable pectinesterase/pectinest...    126   1e-31   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    131   2e-31   Prunus mume [ume]
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    132   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008219290.1|  PREDICTED: probable pectinesterase/pectinest...    130   2e-31   Prunus mume [ume]
emb|CDY22045.1|  BnaA09g00740D                                          130   2e-31   Brassica napus [oilseed rape]
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             131   2e-31   Phaseolus vulgaris [French bean]
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 130   2e-31   Medicago truncatula
emb|CDP17208.1|  unnamed protein product                                130   2e-31   Coffea canephora [robusta coffee]
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     130   2e-31   
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         128   2e-31   Jatropha curcas
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     131   2e-31   Phoenix dactylifera
ref|XP_006480114.1|  PREDICTED: probable pectinesterase/pectinest...    130   2e-31   Citrus sinensis [apfelsine]
ref|XP_009111300.1|  PREDICTED: probable pectinesterase/pectinest...    130   2e-31   
emb|CDY52778.1|  BnaCnng23230D                                          130   2e-31   Brassica napus [oilseed rape]
ref|XP_009111299.1|  PREDICTED: probable pectinesterase/pectinest...    130   2e-31   Brassica rapa
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             132   2e-31   
emb|CDY24663.1|  BnaA05g30620D                                          130   2e-31   Brassica napus [oilseed rape]
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    132   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    130   2e-31   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             132   2e-31   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             132   3e-31   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             131   3e-31   
gb|KJB67143.1|  hypothetical protein B456_010G177500                    130   3e-31   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   130   3e-31   
ref|XP_004146188.1|  PREDICTED: pectinesterase/pectinesterase inh...    130   3e-31   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     130   3e-31   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                130   3e-31   
ref|XP_003604120.1|  Pectinesterase                                     130   3e-31   
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...    132   3e-31   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    130   3e-31   
ref|XP_003591482.1|  Pectinesterase                                     130   3e-31   
ref|XP_007012506.1|  Pectinesterase                                     130   3e-31   
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             130   4e-31   
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     130   4e-31   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        129   4e-31   
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            129   4e-31   
ref|XP_004293266.1|  PREDICTED: pectinesterase                          129   4e-31   
ref|XP_010687597.1|  PREDICTED: pectinesterase                          130   4e-31   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                130   4e-31   
gb|KHN10486.1|  Putative pectinesterase/pectinesterase inhibitor 13     130   4e-31   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    131   4e-31   
emb|CDY68840.1|  BnaCnng60750D                                          129   4e-31   
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    129   5e-31   
emb|CDY08030.1|  BnaC03g34930D                                          125   5e-31   
emb|CDY65637.1|  BnaAnng20820D                                          129   5e-31   
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    129   5e-31   
ref|XP_006474558.1|  PREDICTED: probable pectinesterase/pectinest...    129   6e-31   
gb|ACN40984.1|  unknown                                                 129   6e-31   
tpg|DAA44943.1|  TPA: hypothetical protein ZEAMMB73_754551              128   6e-31   
gb|AAL24207.1|  At2g47550/T30B22.15                                     127   6e-31   
gb|KGN55582.1|  hypothetical protein Csa_3G000060                       129   6e-31   
ref|XP_010269594.1|  PREDICTED: probable pectinesterase/pectinest...    129   6e-31   
gb|AAO11616.1|  At2g47550/T30B22.15                                     127   6e-31   
ref|XP_006382446.1|  hypothetical protein POPTR_0005s02250g             128   7e-31   
gb|AHC69829.1|  pectin methylesterase PME2.1                            129   7e-31   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 129   7e-31   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    129   8e-31   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    129   8e-31   
ref|XP_006828612.1|  hypothetical protein AMTR_s00129p00073090          129   8e-31   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     129   9e-31   
ref|XP_007163134.1|  hypothetical protein PHAVU_001G209300g             129   9e-31   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                     129   1e-30   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    128   1e-30   
gb|KEH41800.1|  pectinesterase/pectinesterase inhibitor                 128   1e-30   
gb|AAF16637.1|AC011661_15  T23J18.24                                    124   1e-30   
ref|XP_002447200.1|  hypothetical protein SORBIDRAFT_06g030310          130   1e-30   
ref|XP_009111298.1|  PREDICTED: probable pectinesterase/pectinest...    128   1e-30   
ref|XP_006431601.1|  hypothetical protein CICLE_v10003299mg             126   1e-30   
gb|KJB49889.1|  hypothetical protein B456_008G143700                    128   1e-30   
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    126   1e-30   
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    128   1e-30   
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    128   1e-30   
ref|XP_008448427.1|  PREDICTED: pectinesterase/pectinesterase inh...    128   1e-30   
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    128   1e-30   
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    128   2e-30   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              128   2e-30   
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 127   2e-30   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    128   2e-30   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    128   2e-30   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             128   2e-30   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     128   2e-30   
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    128   2e-30   
gb|ABK94644.1|  unknown                                                 125   2e-30   
dbj|BAA89480.1|  pectin methylesterase                                  128   2e-30   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     127   2e-30   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    127   2e-30   
gb|AAK84428.1|  papillar cell-specific pectin methylesterase-like...    127   2e-30   
emb|CDY63854.1|  BnaC04g51830D                                          127   2e-30   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    127   2e-30   
ref|XP_003626199.1|  Pectinesterase                                     128   2e-30   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    127   2e-30   
gb|ABY27643.1|  putative pectin methylesterase                          125   2e-30   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    127   2e-30   
emb|CDP21422.1|  unnamed protein product                                127   2e-30   
emb|CDO97787.1|  unnamed protein product                                124   3e-30   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             127   3e-30   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          127   3e-30   
ref|XP_006396438.1|  hypothetical protein EUTSA_v10029453mg             127   3e-30   
gb|AFK42744.1|  unknown                                                 124   3e-30   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    126   3e-30   
ref|XP_008789972.1|  PREDICTED: probable pectinesterase/pectinest...    127   3e-30   
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    127   3e-30   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        127   3e-30   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    127   4e-30   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    127   4e-30   
ref|XP_009625476.1|  PREDICTED: pectinesterase-like                     127   4e-30   
gb|AAB38794.1|  pectin methylesterase                                   126   4e-30   
emb|CDX80116.1|  BnaA05g00400D                                          127   4e-30   
gb|EPS70728.1|  pectinesterase                                          127   4e-30   
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  122   4e-30   
emb|CDY27478.1|  BnaC04g51190D                                          127   4e-30   
ref|XP_009142519.1|  PREDICTED: probable pectinesterase/pectinest...    127   4e-30   
ref|XP_006293931.1|  hypothetical protein CARUB_v10022923mg             127   4e-30   
ref|XP_011079963.1|  PREDICTED: probable pectinesterase/pectinest...    127   4e-30   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    127   4e-30   
ref|XP_006492597.1|  PREDICTED: pectinesterase 2-like                   124   4e-30   
ref|XP_010422609.1|  PREDICTED: probable pectinesterase/pectinest...    127   4e-30   
ref|XP_009335714.1|  PREDICTED: probable pectinesterase/pectinest...    127   4e-30   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     127   4e-30   
ref|XP_010456048.1|  PREDICTED: probable pectinesterase/pectinest...    127   4e-30   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 127   4e-30   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               127   4e-30   
gb|AAQ21126.1|  pectinesterase                                          122   4e-30   
gb|KDP23446.1|  hypothetical protein JCGZ_23279                         121   5e-30   
ref|XP_009335708.1|  PREDICTED: probable pectinesterase/pectinest...    127   5e-30   
ref|XP_008386683.1|  PREDICTED: probable pectinesterase/pectinest...    127   5e-30   
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         127   5e-30   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     126   5e-30   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                126   5e-30   
gb|KDO36004.1|  hypothetical protein CISIN_1g029714mg                   119   6e-30   
ref|XP_002894191.1|  predicted protein                                  126   6e-30   
ref|XP_010098737.1|  Putative pectinesterase/pectinesterase inhib...    125   6e-30   
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...    126   6e-30   
gb|EPS64331.1|  pectinesterase                                          126   6e-30   
ref|XP_010429512.1|  PREDICTED: probable pectinesterase/pectinest...    126   6e-30   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          126   6e-30   
ref|NP_566103.1|  probable pectinesterase/pectinesterase inhibito...    126   6e-30   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    126   6e-30   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     126   6e-30   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    126   6e-30   
ref|XP_002880312.1|  pectinesterase family protein                      126   6e-30   
ref|XP_002889876.1|  At1g11580/T23J18_33                                126   6e-30   
ref|XP_006397950.1|  hypothetical protein EUTSA_v10001380mg             126   7e-30   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     126   7e-30   
ref|NP_001234151.1|  pectinesterase 1 precursor                         126   7e-30   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    126   7e-30   
emb|CBI27741.3|  unnamed protein product                                124   7e-30   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     126   7e-30   
gb|KDP28189.1|  hypothetical protein JCGZ_13960                         126   7e-30   
gb|EYU46745.1|  hypothetical protein MIMGU_mgv1a003524mg                126   7e-30   
ref|XP_006452912.1|  hypothetical protein CICLE_v10007819mg             126   7e-30   
gb|AAR03544.1|  pectin methylesterase isoform 1                         122   7e-30   
gb|KFK37519.1|  hypothetical protein AALP_AA4G267600                    126   7e-30   
ref|XP_009108562.1|  PREDICTED: probable pectinesterase 56              124   8e-30   
ref|XP_003595372.1|  Pectinesterase                                     123   9e-30   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     125   9e-30   
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    125   9e-30   
ref|XP_010518460.1|  PREDICTED: probable pectinesterase/pectinest...    125   1e-29   
ref|XP_004513409.1|  PREDICTED: probable pectinesterase/pectinest...    125   1e-29   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    125   1e-29   
ref|NP_172624.1|  methylesterase PCR A                                  125   1e-29   
ref|XP_004513411.1|  PREDICTED: probable pectinesterase/pectinest...    125   1e-29   
gb|AAK59760.1|  At1g11580/T23J18_33                                     125   1e-29   
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21     125   1e-29   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             125   1e-29   
ref|NP_001274969.1|  pectin methyl esterase                             125   1e-29   
gb|AAB67740.1|  PME1.9                                                  124   1e-29   
ref|XP_010260072.1|  PREDICTED: pectinesterase-like                     125   1e-29   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    125   1e-29   
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     125   1e-29   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     125   1e-29   
ref|XP_008668795.1|  PREDICTED: pectinesterase-like                     126   1e-29   
ref|XP_002317208.1|  pectin methylesterase family protein               125   1e-29   
ref|XP_008439965.1|  PREDICTED: pectinesterase                          125   1e-29   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             125   1e-29   
ref|XP_010098738.1|  Pectinesterase 3                                   126   1e-29   
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    125   1e-29   
gb|EPS69324.1|  hypothetical protein M569_05439                         125   1e-29   
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     125   1e-29   
ref|NP_001145377.1|  uncharacterized protein LOC100278720               127   1e-29   
gb|AFW59628.1|  pectinesterase                                          127   1e-29   
emb|CDY51430.1|  BnaA04g27070D                                          125   1e-29   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       125   1e-29   
ref|NP_567227.1|  Probable pectinesterase/pectinesterase inhibito...    125   1e-29   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     125   1e-29   
ref|XP_008390793.1|  PREDICTED: probable pectinesterase/pectinest...    121   1e-29   
gb|AAL87311.1|  unknown protein                                         125   2e-29   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      125   2e-29   
ref|XP_009118697.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-29   
ref|XP_002512460.1|  Pectinesterase-2 precursor, putative               125   2e-29   
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g             125   2e-29   
gb|AFW03479.1|  pectin methylesterase 5                                 125   2e-29   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        124   2e-29   
ref|XP_002523112.1|  Pectinesterase-2 precursor, putative               125   2e-29   
ref|XP_006604725.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-29   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     125   2e-29   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    125   2e-29   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     125   2e-29   
gb|KJB06869.1|  hypothetical protein B456_001G018300                    124   2e-29   
ref|XP_009799791.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-29   
ref|XP_006287360.1|  hypothetical protein CARUB_v10000558mg             125   2e-29   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-29   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-29   
ref|XP_006289196.1|  hypothetical protein CARUB_v10002644mg             124   2e-29   
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     125   2e-29   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    125   2e-29   
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          125   2e-29   
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   119   2e-29   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     125   2e-29   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          125   2e-29   
gb|AER38245.1|  PME4                                                    124   2e-29   
gb|AFW03483.1|  pectin methylesterase 4                                 124   2e-29   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     124   2e-29   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          124   2e-29   
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          124   3e-29   
gb|ABE67980.1|  pectin methylesterase                                   120   3e-29   
gb|KJB06868.1|  hypothetical protein B456_001G018300                    124   3e-29   
gb|AAF23891.1|  pectin methyl esterase                                  124   3e-29   
ref|XP_006431597.1|  hypothetical protein CICLE_v10003723mg             122   3e-29   
gb|KHF97563.1|  Pectinesterase/pectinesterase inhibitor PPE8B           124   3e-29   
gb|KHN24739.1|  Putative pectinesterase/pectinesterase inhibitor 7      124   3e-29   
ref|XP_008235120.1|  PREDICTED: probable pectinesterase/pectinest...    124   3e-29   
ref|XP_010512807.1|  PREDICTED: probable pectinesterase/pectinest...    124   3e-29   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    125   3e-29   
gb|KJB06866.1|  hypothetical protein B456_001G018300                    124   3e-29   
ref|NP_001275775.1|  pectinesterase 2 precursor                         124   3e-29   
gb|KJB06867.1|  hypothetical protein B456_001G018300                    124   3e-29   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               124   3e-29   
emb|CDX76371.1|  BnaA08g10290D                                          122   3e-29   
gb|KDP23441.1|  hypothetical protein JCGZ_23274                         125   3e-29   
ref|XP_006418303.1|  hypothetical protein EUTSA_v10007177mg             124   3e-29   
gb|EPS72184.1|  pectinesterase family protein                           124   3e-29   
gb|KJB45965.1|  hypothetical protein B456_007G340800                    127   3e-29   
gb|KFK30820.1|  pectinesterase family protein                           124   3e-29   
ref|XP_010659815.1|  PREDICTED: pectinesterase-like                     118   3e-29   
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                     124   3e-29   
gb|EMS65302.1|  putative pectinesterase/pectinesterase inhibitor 21     120   3e-29   
gb|KEH24403.1|  pectinesterase/pectinesterase inhibitor                 124   3e-29   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     123   3e-29   



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC+  ADP Y P RF++KSYLGRPWKE+SRTIIMESFI D IQPEGWL W   FAL 
Sbjct  445  VLQNCSFVADPAYFPYRFQLKSYLGRPWKEFSRTIIMESFIDDLIQPEGWLAWNGSFALD  504

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNNRGP ++K  R +W+G+KELP+  ++RF P+KFI G  WIK + VPYN  FI
Sbjct  505  TLFYAEFNNRGPSSNKMLRAQWNGVKELPSSRVERFLPSKFIDGNHWIKSARVPYNSGFI  564

Query  350  YPPP  339
            YPPP
Sbjct  565  YPPP  568



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + QNC+I AD  YD V+ ++K+YLGRPWKEYSRTIIMES I D IQPEGW+ W   FAL 
Sbjct  446  VFQNCSIVADSSYDEVKGEVKTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALN  505

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNNRG G+SKT+R KW G+KEL  + ++RFT ++F+ G +WI  +G+PY P F 
Sbjct  506  TLFYTEFNNRGSGSSKTERAKWQGVKELQINRVQRFTASQFLDGDAWIPSTGIPYTPGFF  565

Query  350  YPPP  339
             PPP
Sbjct  566  LPPP  569



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   178 bits (452),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC+IKAD  Y P+R +IKSYLGRPWK+YSRTIIMESF+ D IQP+GWLPW   FAL+
Sbjct  443  VIQNCSIKADEAYYPLRKQIKSYLGRPWKQYSRTIIMESFLDDLIQPQGWLPWNETFALQ  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNNRGP A K++RVKW GI+ELP++ I+RFT  +F+ G  WI  + VP+   FI
Sbjct  503  TLFYTEFNNRGPAAPKSERVKWAGIRELPSNRIRRFTLEEFLDGHRWIPQTKVPHASGFI  562

Query  350  YPPP  339
            +  P
Sbjct  563  FEVP  566



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   176 bits (447),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC+  ADP+  PVR KI SYLGRPWKEYSRTIIMESF+ DFIQP+GW+ W   FAL+
Sbjct  427  VIQNCSFVADPELYPVRHKILSYLGRPWKEYSRTIIMESFLDDFIQPDGWMKWNETFALE  486

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNNRGP A K KRVKW G+KELP   ++RFTP +F+ G  WI  + VPY   FI
Sbjct  487  TLFYTEFNNRGPAAPKMKRVKWPGVKELPPSRVQRFTPGEFLDGNRWIPPTQVPYAAGFI  546

Query  350  YPPP  339
            +P P
Sbjct  547  FPVP  550



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + QNC+I AD  Y+ V+ ++K+YLGRPWKEYSRTIIMES I D IQPEGW+ W   FAL 
Sbjct  446  VFQNCSIVADSSYNEVKGEVKTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALN  505

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNNRG G+SK +RVKW G+KEL  + ++RFT ++F+ G +WI  +G+PY P F 
Sbjct  506  TLFYTEFNNRGSGSSKKERVKWQGVKELQINRVQRFTASQFLDGDAWIPSTGIPYTPGFF  565

Query  350  YPPP  339
              PP
Sbjct  566  LSPP  569



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC+   DP Y PVR   K+YLGRPWKE+SRTIIMES+I D  Q  GWLPW  DFAL 
Sbjct  455  VLQNCSFVPDPAYYPVRNTNKAYLGRPWKEFSRTIIMESYISDSFQAAGWLPWFEDFALD  514

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNNRGP ++KT RVKWHGIKELP   +KRFT  +F+ G+ WI  + VPY+  FI
Sbjct  515  TLFYAEFNNRGPSSNKTDRVKWHGIKELPAKRVKRFTADEFLDGERWIPRTKVPYDGGFI  574

Query  350  YPPP  339
            +P P
Sbjct  575  FPLP  578



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + QNC+I AD  Y+ V+ ++K+YLGRPWK+YSRTIIMES I D IQPEGWL W   FA +
Sbjct  447  VFQNCSIVADESYNEVKGEVKTYLGRPWKQYSRTIIMESNIDDLIQPEGWLEWNKTFAFE  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNN+G G+SKT RV+W G+KELP   ++RFT + FI    WI  +GVPY   F 
Sbjct  507  TLFYTEFNNKGSGSSKTDRVRWSGVKELPIERVQRFTTSSFIDADLWIPSTGVPYTSGFF  566

Query  350  YPPP  339
              PP
Sbjct  567  LSPP  570



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI  DP+Y PV+ K K+YLGRPWKE+SRT+IM+S I D I PEGWLPW  DFAL 
Sbjct  564  VLQNCTISGDPEYLPVKDKNKAYLGRPWKEFSRTLIMQSQIDDIIAPEGWLPWNGDFALN  623

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+EF NRGPGA +T RV W GIK++   I +RFTP  F+ G  WI  +GVPY P  I
Sbjct  624  TLWYAEFGNRGPGAVQTHRVTWRGIKKINAAIARRFTPGVFLRGDDWIPKAGVPYTPGLI  683



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q C I+ +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDF+QP+GW PW  DF LK
Sbjct  446  VFQGCRIEGEPDYLAVKASSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWNADFGLK  505

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPG+    RV W GIK+L +  I +FTPAKFI G SWI  +GVPY P  +
Sbjct  506  TLFYSEIQNTGPGSDLASRVTWAGIKKLTSKDIDQFTPAKFIQGDSWIPATGVPYTPGLL  565



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC+I AD  Y+ V+ + K+YLGRPWK+YSRTIIMES I D IQPEGWL W   FA  
Sbjct  447  VLQNCSIVADESYNEVKGEAKTYLGRPWKQYSRTIIMESKIDDLIQPEGWLEWNKTFAFD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNN+G G+SK  RV W G+KELP   ++RFT + F+    WI  +GVPY   F+
Sbjct  507  TLFYTEFNNKGLGSSKADRVTWSGVKELPIERVQRFTASNFLDADLWIPSTGVPYTSGFL  566

Query  350  YPPP  339
              PP
Sbjct  567  LSPP  570



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNCTI AD  Y PV+ K +S+LGRPWKEYSRTIIM+SFI D IQPEGWLPW  DF +K
Sbjct  451  ILQNCTITADASYVPVKAKFRSFLGRPWKEYSRTIIMQSFIDDIIQPEGWLPWMGDFGIK  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FYSEF NRGPG+S T RVKW GIK + P H +  FT   F+ G +W+   GVP++   
Sbjct  511  TCFYSEFGNRGPGSSMTGRVKWKGIKTITPAHAVD-FTVGTFLRGNTWLPKFGVPFSAGM  569

Query  353  I  351
            +
Sbjct  570  V  570



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN TI A PD  P R + KSYLGRPWKEYSRTIIMESFI D IQPEGWLPW   F LK
Sbjct  456  IIQNSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWLGTFGLK  515

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T +Y+EFNN GPG+SK  RVKW+GIK +       FTP +F+ G SWIK +G+PY P  +
Sbjct  516  TCWYTEFNNYGPGSSKNLRVKWNGIKTINRQHAMDFTPGRFLKGDSWIKATGIPYTPFLV  575



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNCTI ADP Y P + +I SYLGRPWK YSRTIIMES+I D IQP+GW+PW  DF L 
Sbjct  454  ILQNCTITADPSYTPFKGQILSYLGRPWKAYSRTIIMESYIDDIIQPKGWMPWLGDFGLN  513

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+E+ NRGPGAS  +RVKW GIK++ P H ++ FT  +F+ G  WI+ +GVPY    
Sbjct  514  TCFYAEYKNRGPGASTARRVKWKGIKKITPQHAVE-FTAGRFMKGDRWIRTAGVPYVAGM  572

Query  353  I  351
            +
Sbjct  573  L  573



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDF+QP+GW PW+ DF LK
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWQGDFGLK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA+   RV W GIK L    I +FTPA++I G +W+   GVPY    +
Sbjct  507  TLFYSEVQNTGPGATVANRVTWAGIKTLSDEDILKFTPAQYIQGDTWVPGKGVPYTSGLL  566

Query  350  YPPP  339
               P
Sbjct  567  AGNP  570



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN T  ADP+Y P R ++KSYLGRPWKE+SRTIIMES+I D IQP GWLPW  DFAL+
Sbjct  456  IIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGWLPWAGDFALR  515

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+EF NRGPGA    RVKW GIK + P+H I  F P +F++G  WI  +GVPYN   
Sbjct  516  TCFYTEFRNRGPGAKTHDRVKWRGIKTIKPSHAID-FAPGRFLSGDRWIPSTGVPYNSGL  574



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QNC+IKAD D  PV+ + +S+LGRPWKEYSRTIIMES+I D IQPEGWLPW  D+ LK
Sbjct  454  IIQNCSIKADKDLAPVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLK  513

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPY  366
            T FY+E+NN GPG++K+KRVKW GIK + P H +  FT  +F+ G  WIK +GVPY
Sbjct  514  TCFYTEYNNYGPGSNKSKRVKWRGIKTITPQHALD-FTAGRFVMGDRWIKPTGVPY  568



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNCTI ADP Y PVR + K+YLGRPW+E SRTI+M+S I D I PEGWLPW   F L 
Sbjct  450  VIQNCTITADPQYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPWLGSFGLN  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE+NN+G GA +T RVKW GIK+L       +T AKFI G  WI  +GVPY    I
Sbjct  510  TLFYSEYNNKGQGAVETNRVKWAGIKKLTPEAADGYTAAKFIQGDEWIPQTGVPYTAGMI  569



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDF+QP+GW PW  DF LK
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPG++   RV W GIK L    I +FTPA++I G +W+   GVPY P  +
Sbjct  507  TLFYSEVQNTGPGSALANRVTWAGIKTLSDEDILKFTPAQYIQGDTWVPGKGVPYTPGLL  566

Query  350  YPPP  339
               P
Sbjct  567  AGNP  570



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN T  ADP+Y P R ++KSYLGRPWKE+SRTIIMES+I D IQP GWLPW  DFAL+
Sbjct  456  IIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGWLPWAGDFALR  515

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+EF NRGPGA    RVKW GIK + P+H I  F P +F++G  WI  +GVPYN   
Sbjct  516  TCFYTEFRNRGPGAKTHDRVKWRGIKTIKPSHAID-FAPGRFLSGDRWIPSTGVPYNSGL  574



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNC I + PD+ P+R   K++LGRPWK+YSRTIIM+S I D IQPEGWLPW  +FAL 
Sbjct  452  ILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALN  511

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+E NNRGPGA+  KRVKW GIK++       FT A+FI G  WIK +GVPY    +
Sbjct  512  TLFYAEINNRGPGAATDKRVKWKGIKKITMEHALDFTAARFIRGDPWIKPTGVPYTSGMM  571



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNC I + PD+ P+R   K++LGRPWK+YSRTIIM+S I D IQPEGWLPW  +FAL 
Sbjct  449  ILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALN  508

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+E NNRGPGA+  KRVKW GIK++       FT A+FI G  WIK +GVPY    +
Sbjct  509  TLFYAEINNRGPGAATDKRVKWKGIKKITMEHALDFTAARFIRGDPWIKPTGVPYTSGMM  568



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDFIQP+GWLPW  DF LK
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWLPWLGDFGLK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA    RV W GIK L    +  FTPA++I G  W+   GVPY P  +
Sbjct  507  TLFYSEVKNTGPGAGLANRVTWAGIKTLSDEEVLMFTPAQYIQGDIWVPGKGVPYTPGLL  566



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNCTI ADP Y PVR + K+YLGRPW+E SRTI+M+S I D I PEGWLPW  +F L 
Sbjct  450  VIQNCTITADPKYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPWLGNFGLN  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE++N+G GA +T RVKW GIK+L       +T AKFI G  WI  +GVPY    I
Sbjct  510  TLFYSEYDNKGQGAVETNRVKWAGIKKLTPEAADGYTAAKFIQGDEWIPQTGVPYTAGMI  569



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q C I  +PDY  V+   K+YLGRPWK YSRTIIM +FIPDF+QP+GW PW  DF L 
Sbjct  449  VFQGCQIAGEPDYLSVKATSKAYLGRPWKAYSRTIIMNTFIPDFVQPQGWQPWNGDFGLS  508

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPG+    RV W GIK+L  + + +FTPA+FI G SWI  +GVPY P F
Sbjct  509  TLFYSEIQNTGPGSDVVNRVTWAGIKKLTNNDLLQFTPAQFIQGDSWIPATGVPYTPGF  567



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNC I +DP + PVR   K+YLGRPWK+YSRTIIM+  I D IQPEGWLPW  DFAL 
Sbjct  449  ILQNCAISSDPTFFPVRHINKAYLGRPWKQYSRTIIMQCQIDDLIQPEGWLPWMGDFALH  508

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFY+E NNRGPGA+  KRVKW GIK++ P H +  FT  +FI G  WIK +GVPY+   
Sbjct  509  TLFYAEINNRGPGAATDKRVKWKGIKKITPQHALD-FTVGRFIRGDPWIKPTGVPYSSGM  567

Query  353  I  351
            +
Sbjct  568  M  568



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+Q+ TI A PD  P R + KSYLGRPWKEYSRTIIMESFI D IQPEGWLPW   F LK
Sbjct  456  IIQSSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWLGTFGLK  515

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            T +Y+EFNN GPG+SK  RVKW+GIK +       FTP +F+ G SWIK +G+PY P
Sbjct  516  TCWYTEFNNYGPGSSKNLRVKWNGIKTINRQHAMDFTPGRFLKGDSWIKATGIPYTP  572



>emb|CDY40719.1| BnaC03g34350D [Brassica napus]
Length=448

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPW+E+SRTIIM SF+PDF+QP+GW+PW  +F L 
Sbjct  145  VFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLD  204

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA    RV W GIK L    I +FTP +FI G  W+   GVPY P  +
Sbjct  205  TLFYSEAQNTGPGAGLANRVTWAGIKTLSNEEILKFTPDQFIQGGIWVPGKGVPYTPGLL  264

Query  350  YPPP  339
               P
Sbjct  265  AANP  268



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYS+TIIM +FIPDFIQP+GWLPW  DF LK
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWLGDFGLK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA    RV W GIK L    +  FTPA++I G  W+   GVPY P  +
Sbjct  507  TLFYSEVKNTGPGAGLANRVTWAGIKTLSDEEVLMFTPAQYIQGDIWVPGKGVPYTPGLL  566



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYS+TIIM +FIPDFIQP+GWLPW  DF LK
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWLGDFGLK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA    RV W GIK L    +  FTPA++I G  W+   GVPY P  +
Sbjct  507  TLFYSEVKNTGPGAGLANRVTWAGIKTLSDEEVLMFTPAQYIQGDIWVPGKGVPYTPGLL  566



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDF+QP+GW PW  DF LK
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPG++   RV W GIK L    I +FTPA++I G  WI   GVPY    +
Sbjct  507  TLFYSEVQNTGPGSALANRVTWAGIKTLSEEDILKFTPAQYIQGDDWIPGKGVPYTTGLL  566

Query  350  YPPP  339
               P
Sbjct  567  AGNP  570



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDF+QP+GW PW  DF LK
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPG++   RV W GIK L    I +FTPA++I G  WI   GVPY    +
Sbjct  507  TLFYSEVQNTGPGSALANRVTWAGIKTLSEEDILKFTPAQYIQGDDWIPGKGVPYTTGLL  566

Query  350  YPPP  339
               P
Sbjct  567  AGNP  570



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 87/121 (72%), Gaps = 2/121 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQ+C I ADP   PVR   +SYLGRPWKEYSRTIIM++ I D I P+GWLPW  DFALK
Sbjct  457  ILQSCRIVADPLLFPVRNTTRSYLGRPWKEYSRTIIMQTLIDDLINPDGWLPWSGDFALK  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKE--LPTHIIKRFTPAKFITGKSWIKHSGVPYNPA  357
            T FY+E+NNRGPGA  T+RVKW GIK   +     ++FT  +FI G SWIK +GVPY+  
Sbjct  517  TCFYAEYNNRGPGAVLTQRVKWRGIKTSIMTPEKAQQFTAGRFIRGDSWIKPTGVPYDSG  576

Query  356  F  354
             
Sbjct  577  L  577



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            IL NC+I ADP+Y P+R  + +YLGRPWKEYSR  I++S I D +QP GWLPW  DFAL 
Sbjct  460  ILHNCSIVADPEYYPLRNTLPTYLGRPWKEYSRAFILQSEIDDLVQPAGWLPWAGDFALN  519

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE++NRGPGA+  +RVKW G+K +     ++FT A+F+ G  WIK++ VP+ P  I
Sbjct  520  TLFYSEYDNRGPGAATAERVKWRGLKSITAEHAEKFTVARFLGGTEWIKNASVPFIPGLI  579



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM SFIPDF+QP+GW PW  DF LK
Sbjct  448  VFQGCTIAGEPDYLAVKQTSKAYLGRPWKEYSRTIIMNSFIPDFVQPQGWQPWLGDFGLK  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA+   RV W GIK L    I +F PA+FI   +W+   GVPY P  +
Sbjct  508  TLFYSEVQNIGPGAALASRVTWAGIKTLSNEEILKFAPAEFIQSDAWVPGKGVPYIPGLL  567

Query  350  YPPP  339
               P
Sbjct  568  DGNP  571



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   157 bits (397),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/120 (55%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPW+E+SRTIIM SF+PDF+QP+GW+PW  +F L 
Sbjct  447  VFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA    RV W GIK+L    I +FTP +FI G  W+   GVPY P  +
Sbjct  507  TLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEILKFTPDQFIQGGIWVPGKGVPYTPGLL  566



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   157 bits (398),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/120 (55%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPW+E+SRTIIM SF+PDF+QP+GW+PW  +F L 
Sbjct  447  VFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA    RV W GIK+L    I +FTP +FI G  W+   GVPY P  +
Sbjct  507  TLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEILKFTPDQFIQGGIWVPGKGVPYTPGLL  566



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN TI A PD  P R   KSYLGRPWKE+SRTIIMESFI D IQPEGWLPW   F LK
Sbjct  457  IIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLK  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            T +Y+EFNN GPG+SK  RVKW+GIK +       FTP +F  G +WIK +G+PY P
Sbjct  517  TCWYTEFNNNGPGSSKAARVKWNGIKTIDRQHALDFTPGRFFKGGAWIKTTGIPYTP  573



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QN TI A PD  P R   KSYLGRPWKE+SRTIIMESFI D IQPEGWLPW   F LK
Sbjct  457  VIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLK  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T +Y+EFNN GPG+SK  RVKW+GIK +       FTP +F  G +WIK +G+PY P  +
Sbjct  517  TCWYTEFNNNGPGSSKAARVKWNGIKTIDRQHALDFTPGRFFKGGAWIKTTGIPYTPFLV  576



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDFI PEGW PW  DF L 
Sbjct  443  VLQGCTIVGEPDYLAVKENSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWLGDFGLN  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA  TKRV W GIK+L    I  FTPA++I G +WI   GVPY P  
Sbjct  503  TLFYSEVQNTGPGAPITKRVTWPGIKKLSEEEILTFTPAQYIQGDAWIPGKGVPYIPGL  561



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  +PDY  V+   KSYLGRPWKEYSRTI M +FIPDFI PEGW PW  +FAL 
Sbjct  383  VLQGCTIAGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWLGNFALD  442

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA  TKRV W GIK+L    I +FTPA++I G +WI   GVPY P  
Sbjct  443  TLFYSEVRNTGPGAGVTKRVTWPGIKKLSEEEILKFTPAEYIQGDAWIPGKGVPYIPGL  501



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   158 bits (400),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNC+I+ D D   +R  IK+YLGRPWK+YSRT+IMESF+ D I P GWLPW   FAL 
Sbjct  440  ILQNCSIRPDRDLYAIRKNIKTYLGRPWKQYSRTVIMESFLDDLICPTGWLPWNGTFALD  499

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+EFNNRGP A K +R +W G+KELP+  I+RFT  +F+ G  WI  + VPY P F+
Sbjct  500  TLFYTEFNNRGPAAPKKQRARWPGVKELPSSRIQRFTAVEFLDGNGWIPRTQVPYTPGFV  559

Query  350  YPPP  339
            +P P
Sbjct  560  FPVP  563



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN T  ADPDY PVRF++ +YLGRPWKE+SRTIIMESFI D IQP GWLPW  DF L+
Sbjct  459  IIQNGTFVADPDYYPVRFELPAYLGRPWKEFSRTIIMESFIDDLIQPRGWLPWAGDFGLR  518

Query  530  TLFYSEFNNRGPGASK-TKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            T FY+EF NRGPGA + ++R KW G+K +     + FTP  F  G  WIK +G+PY
Sbjct  519  TCFYTEFGNRGPGAVEPSRRAKWKGVKNITAKHARDFTPGSFFKGDWWIKRTGIPY  574



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDFIQP+GW PW  +F L 
Sbjct  449  VFQGCTISGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLD  508

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA+   RV W GIK L    I +FTP ++I G  W+   GVPY P  +
Sbjct  509  TLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILKFTPDQYIQGDVWVHGKGVPYTPGLL  568

Query  350  YPPP  339
               P
Sbjct  569  AANP  572



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN TI ADPDY PV+ + K+YLGRPWKEYSRTIIM+S+I D IQPEGWLPW+ ++ LK
Sbjct  470  IIQNSTITADPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLK  529

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+E  N GP A+K +RV W GIK++  +    FTP +F  G  WI+ SGVPY P  
Sbjct  530  TCFYAELGNTGPAANKARRVTWRGIKKITENHAADFTPGRFFRGDKWIRLSGVPYIPGL  588



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDFIQP+GW PW  +F L 
Sbjct  449  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLD  508

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA+   RV W GIK L    I +FTP ++I G  W+   GVPY P  +
Sbjct  509  TLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILKFTPDQYIQGDVWVHGKGVPYTPGLL  568

Query  350  YPPP  339
               P
Sbjct  569  AANP  572



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDFIQP+GW PW  +F L 
Sbjct  449  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLD  508

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA+   RV W GIK L    I +FTP ++I G  W+   GVPY P  +
Sbjct  509  TLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILKFTPDQYIQGDVWVHGKGVPYTPGLL  568

Query  350  YPPP  339
               P
Sbjct  569  AANP  572



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  +PDY  V+ + K+YLGRPWKEYSRTIIM +FIPDF+ PEGW PW  +F L 
Sbjct  444  VLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIMNTFIPDFVPPEGWQPWLGEFGLN  503

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TLFYSE  N GPGA+ TKRV W GIK+L    I +FTPA++I G +WI   GVPY
Sbjct  504  TLFYSEVQNTGPGAAITKRVTWPGIKKLSDEEILKFTPAQYIQGDAWIPGKGVPY  558



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPW+E+SRTIIM SF+PDF+QP+GW+PW  +F L 
Sbjct  447  VFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA    RV W GIK+L    I +FTP +FI G  W+   GVPY P  +
Sbjct  507  TLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEILKFTPDQFIQGGIWVPGKGVPYTPGLL  566



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  + DY  V+   K+YLGRPWKEYS+TIIME+FIPDFI  EGW PW+ +F L 
Sbjct  258  VLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLD  317

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA+   RV W GIK+L    I  +TPAK+I G  WI   GVPY P F
Sbjct  318  TLFYSEVRNTGPGAAVANRVTWQGIKKLSEEEIVEYTPAKYIQGDDWIPGKGVPYTPGF  376



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QNC+ K   D  PV+ + +S+LGRPWKEYSRTIIMES+I D IQPEGWLPW  D+ L+
Sbjct  454  IIQNCSFKPHADLVPVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLR  513

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPY  366
            T FY+E+NN GPG+ K+KRVKW GIK + P H +  FTP +F+ G  WIK +GVPY
Sbjct  514  TCFYTEYNNYGPGSDKSKRVKWRGIKNITPQHAVD-FTPGRFLKGDRWIKPTGVPY  568



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  + DY  V+   K+YLGRPWKEYS+TIIME+FIPDFI  EGW PW+ +F L 
Sbjct  443  VLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLD  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA+   RV W GIK+L    I  +TPAK+I G  WI   GVPY P F
Sbjct  503  TLFYSEVRNTGPGAAVANRVTWQGIKKLSEEEIVEYTPAKYIQGDDWIPGKGVPYTPGF  561



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QN TI ADPDY  V+   K+YLGRPWKEYSRTIIMES+I D IQPEGWLPW   + L+
Sbjct  470  VIQNSTITADPDYFLVKNVNKAYLGRPWKEYSRTIIMESYIDDVIQPEGWLPWAGQWGLR  529

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYN  363
            T FY+EF N GP A+K +RV W GIK++      +FTP KF  G  WIK SGVPY+
Sbjct  530  TCFYTEFRNTGPAANKARRVTWQGIKQITRRHAAQFTPGKFFRGDEWIKLSGVPYS  585



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN TI A+PDY PV+ + K+YLGRPWKEYSRTIIM+S+I D IQPEGWLPW+ ++ LK
Sbjct  465  IIQNSTITAEPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLK  524

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+E  N GP A+K +RV W GIK++  +    FTP +F  G  WI+ SGVPY P  
Sbjct  525  TCFYAESGNTGPAANKARRVTWRGIKQITENHTADFTPGRFFRGDKWIRLSGVPYIPGL  583



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I ADP +  V+  IK+YLGRPWKE+SRTIIM++ I  FI PEGW PW  +F + 
Sbjct  441  VLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMD  500

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T +Y+E+NNRGPGA  +KRV+W GIK++   I + FTP  +I G +WI  SGVPY P  
Sbjct  501  TCYYAEYNNRGPGADTSKRVQWKGIKKITPQIAQSFTPGAYIQGDAWITASGVPYAPGM  559



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI  DP Y PV+ + K YLGRPWKE+SRTIIM S I D I PEGWLPW  DFAL 
Sbjct  456  VLQNCTITGDPAYLPVKDQNKGYLGRPWKEFSRTIIMNSRIDDVIAPEGWLPWAGDFALN  515

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            T FY+E  NRGPG+    RVKW GIK++P      +TP +FI G  WIK +GVPY
Sbjct  516  TCFYTEILNRGPGSKLDGRVKWRGIKKVPAQRAVEYTPGRFIRGDWWIKAAGVPY  570



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI A  DY P + K KSYLGRPWK +SRTIIM+S I D I PEGWLPW  DF L 
Sbjct  464  VLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGWLPWMGDFGLN  523

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E+ NRGP ++ T RV W GIK++    +  FT  +FI+G  W+  SGVPY    +
Sbjct  524  TCFYAEYGNRGPASATTSRVTWRGIKQITGQHVNDFTVGRFISGHLWLGASGVPYTSDMM  583



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   155 bits (391),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 66/115 (57%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI A  DY P + K KSYLGRPWK +SRTIIM+S I D I PEGWLPW  DF L 
Sbjct  424  VLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGWLPWMGDFGLN  483

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            T FY+E+ NRGP ++ T RV W GIK++    +  FT  +FI+G  W+  SGVPY
Sbjct  484  TCFYAEYGNRGPASATTSRVTWRGIKQITGQHVNDFTVGRFISGHLWLGASGVPY  538



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 81/124 (65%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDFIQP+GW PW  +F L 
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA+   RV W GIK L    I  FTP ++I G  W+   GVPY P  +
Sbjct  507  TLFYSEVQNIGPGAALAGRVTWPGIKTLSDEEILSFTPDQYIQGDVWVPGKGVPYTPGLL  566

Query  350  YPPP  339
               P
Sbjct  567  AADP  570



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QN TI ADPDY PV+   ++YLGRPWKEYSRTIIMES+I D IQPEGWL W   + L+
Sbjct  472  VIQNSTITADPDYFPVKNVNRAYLGRPWKEYSRTIIMESYIDDVIQPEGWLAWAGQWGLR  531

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+EF N GP A+K +RV W GIK++      +FTP KF  G  WIK SGVP  P  
Sbjct  532  TCFYTEFCNTGPAANKARRVTWQGIKQITRRHAAQFTPGKFFRGDEWIKLSGVPCVPGL  590



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  + DY  V+   K+YLGRPWKEYS+TIIME+FIPDFI  EGW PW+ +F L 
Sbjct  443  VLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLD  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA+   RV W GIK+L    I  +TPAK+I G  WI   GVPY P F
Sbjct  503  TLFYSEVRNTGPGAAVANRVTWPGIKKLSEEEIVEYTPAKYIQGDDWIPGKGVPYTPGF  561



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            + Q CTI  +PDY  V+   K+YLGRPWKEYSRTIIM +FIPDF+QP+GW PW  +F L 
Sbjct  447  VFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGNFGLD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFYSE  N GPGA+   RV W GIK L    I +FTP ++I G  W+   GVPY P  +
Sbjct  507  TLFYSEVQNTGPGAALASRVTWPGIKTLSNDEILKFTPDQYIQGNVWVPGKGVPYTPGLL  566



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            IL NCTI ADPDY P+R +  SYLGRPWK YSRT++++S I DFI P+GWLPW  DF L 
Sbjct  461  ILHNCTIGADPDYLPLRARNPSYLGRPWKPYSRTLVVQSQIDDFIHPQGWLPWLGDFGLN  520

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E +NRGPGA+  KRV W G K++     ++FT  +FI G SW+K +GVPY P  +
Sbjct  521  TCFYAEVDNRGPGATIAKRVAWKGYKKIDYSHAQKFTVEQFIQGNSWLKPTGVPYIPGLL  580



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  +PDY  V+   KSYLGRPWKE+SRTIIM +FIPDFI PEGW PW  +F L+
Sbjct  442  VLQGCTIVGEPDYLAVKETSKSYLGRPWKEFSRTIIMNTFIPDFIPPEGWQPWLGNFGLE  501

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPG+  TKRV W GIK+L    I  FTPA++I G +WI   GVPY P  
Sbjct  502  TLFYSEVRNIGPGSGLTKRVTWPGIKKLSEEEILTFTPAQYIQGDAWIPGKGVPYIPGL  560



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  +PDY  V+   KSYLGRPWKEYSRTI M +FIPDFI PEGW PW  +F L+
Sbjct  444  VLQGCTIVGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWLGNFGLE  503

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA  TKRV W GIK+L    I + TPA++I G +WI   GVPY P  
Sbjct  504  TLFYSEVGNTGPGADVTKRVTWPGIKKLSEEEILKITPAEYIQGDAWIPGKGVPYIPGL  562



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNCTI ADP Y P+R K K++LG PWK++SRTIIM+SF+PD I PEGW PW   F   
Sbjct  468  ILQNCTIMADPLYYPLRLKSKAFLGHPWKKFSRTIIMQSFLPDSIAPEGWKPWMGTFGQS  527

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            + F+SE+ NRGPGA+   RVKWHGIK++       FTP+KF  G  WI  +GVPY P  +
Sbjct  528  SCFFSEYENRGPGAALLGRVKWHGIKKITPQQADGFTPSKFYQGNHWIIPTGVPYEPGMM  587

Query  350  Y  348
            +
Sbjct  588  H  588



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI ADP Y P+R   K+YLGRPWK+YSRTIIM+S I D IQP+GWL W  +FAL 
Sbjct  457  VLQNCTISADPAYYPLRNINKAYLGRPWKDYSRTIIMQSQIDDLIQPQGWLAWMGNFALN  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITG-KSWIKHSGVPYNPAF  354
            T FY+E+ NRG G++ T R KW GIK +    I  FTP  F  G  +WI  +GVPY+P  
Sbjct  517  TCFYAEYGNRGAGSATTGRAKWRGIKSMTAQHIVDFTPKAFFKGDDAWITATGVPYSPKL  576

Query  353  I  351
            +
Sbjct  577  M  577



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  + DY  V+   K+YLGRPWKEYSRTIIM +FIPDFI PEGW PW  +F L+
Sbjct  446  VLQGCTISGETDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWLDNFGLE  505

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA    RV W GIK+L    I +FTPA++I G +WI   GVPY P  
Sbjct  506  TLFYSEVRNTGPGAPAMNRVTWPGIKKLGEEEILKFTPAQYIQGDAWIPGKGVPYTPGL  564



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN TI A P+ +PV+ + KSYLGRPWKE+SRTIIME+FI D IQPEGW PW   F LK
Sbjct  461  IIQNSTITAHPELEPVKDQYKSYLGRPWKEFSRTIIMETFIDDLIQPEGWSPWFGSFGLK  520

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T +Y E+NN GPG+    RVKW+GIK +       FTP +F+ G SWIK +GVPY P   
Sbjct  521  TCWYGEYNNYGPGSDMKNRVKWNGIKPVSRQHAIDFTPGRFLRGDSWIKPTGVPYAPYLT  580

Query  350  YP  345
             P
Sbjct  581  RP  582



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I ADP+Y PVRF+ K+YLGRPWKEYSRT+ M+  I D I P+GWLPW   FAL 
Sbjct  448  VLQNCNITADPEYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWMGSFALD  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL YSE+ NRGPG+    RV W GIK+L       FT AKFI G  WI  +GV Y    +
Sbjct  508  TLSYSEYENRGPGSVTKDRVTWKGIKKLSAQDAAAFTVAKFIGGDLWIPATGVSYASGMM  567



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC++  DP Y PV    K+YL RPWK YSR +IMES+I   IQP+G+L W   FAL 
Sbjct  432  VLQNCSVVGDPAYYPVMDVNKAYLARPWKLYSRAVIMESYIDRIIQPDGYLEWNGTFALD  491

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHS--GVPYNPA  357
            TLFY+EFNNRGPGA K++R+KW GIKEL    +KRFT   FI G  W KH+   +PY   
Sbjct  492  TLFYTEFNNRGPGADKSRRLKWTGIKELTGKRMKRFTGDDFIDGSRWTKHNKMKIPYKGG  551

Query  356  FI  351
            F+
Sbjct  552  FV  553



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QN T  A P+  PV+ + KSYLGRPWK++SRTIIMES+I D I+PEGWLPW   F LK
Sbjct  460  IIQNGTFTAHPELVPVKKQYKSYLGRPWKQFSRTIIMESYIDDIIEPEGWLPWFGTFGLK  519

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T +Y+EFNN GPG+ K  RVKW+GIK +       FTP +F+ G +WIK +G+PY+P   
Sbjct  520  TCWYTEFNNYGPGSDKKARVKWNGIKTIDRQHALDFTPGRFLRGDTWIKPTGIPYSPFLT  579

Query  350  YP  345
             P
Sbjct  580  RP  581



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I ADP +  V+  IK+YLGRPWKE+SRTIIM++ I  FI PEGW PW  +F + 
Sbjct  425  VLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMD  484

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            T +Y+E+NNRGPGA  +KRV+W GIK++   I + FTP  +I G +WI  SGV Y
Sbjct  485  TCYYAEYNNRGPGADTSKRVQWKGIKKITPQIAQSFTPGAYIQGDAWITASGVTY  539



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  + DY  V+   K+YLGRPWK YS+TIIM++FIPDFI  EGW  WK +F + 
Sbjct  429  VLQGCTIAGEADYLAVKESSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGID  488

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA  T RV W GIK+L    I  +TPAK+I G  WI   GVPY P  
Sbjct  489  TLFYSEARNTGPGAGVTGRVTWPGIKKLSDEDILGYTPAKYIQGDEWIPSKGVPYTPGL  547



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  + DY  V+   K+YLGRPWK YS+TIIM++FIPDFI  EGW  WK +F + 
Sbjct  443  VLQGCTIAGEADYLAVKETSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGID  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA  T RV W GIK+L    I  +TPAK+I G  WI   GVPY P  
Sbjct  503  TLFYSEARNTGPGAGVTGRVTWPGIKKLSDEDILGYTPAKYIQGDEWIPSKGVPYTPGL  561



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I AD +Y PVRF+ K+YLGRPWKEYSRT+ M+  I D I P+GWLPW   FAL 
Sbjct  448  VLQNCNITADREYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWMGSFALD  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL YSE+ NRGPG+    RV W GIK+L       FT AKFI G  WI  +G+ Y    +
Sbjct  508  TLSYSEYENRGPGSVTKDRVTWKGIKKLSAQDADAFTVAKFIGGDLWIPDTGISYASGMM  567



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI  + DY  V+   K+YLGRPWK YS+TIIM++FIPDFI  EGW  WK +F + 
Sbjct  443  VLQGCTIAGEADYLAVKETSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGID  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA  T RV W GIK+L    I  +TPAK+I G  WI   GVPY P  
Sbjct  503  TLFYSEARNTGPGAGVTGRVTWPGIKKLSDEDILGYTPAKYIQGDEWIPSKGVPYTPGL  561



>gb|EPS66234.1| hypothetical protein M569_08543 [Genlisea aurea]
Length=598

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I AD   +PV+ + ++YLGRPWKEYSRTI+MES I D I P GWL W  DFALK
Sbjct  478  VLQNCKILADDQLEPVKARFQTYLGRPWKEYSRTIVMESEIGDLISPAGWLEWSGDFALK  537

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TLFY E+NN+GPG+  + RVKW G K L  +   RFT   F+ G++W+  + VP
Sbjct  538  TLFYGEYNNKGPGSGTSDRVKWAGYKTLQRNDALRFTAGPFLQGETWLDAAVVP  591



>ref|XP_011078157.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=590

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I A     P + K KSYLGRPWKEYSRTIIME+ I DFIQ EGW+ W+ DFALK
Sbjct  470  VLQNCRILAADTLKPEKAKFKSYLGRPWKEYSRTIIMETEIGDFIQAEGWMEWEGDFALK  529

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+EFNN+GPG+S + RVKW G K +       FT   F+ G+SWIK++ VP
Sbjct  530  TLYYAEFNNKGPGSSTSGRVKWPGYKTIKKEEALEFTVGPFLQGESWIKNADVP  583



>ref|XP_009369731.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=594

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  D D +PV+ + K+YLGRPWKE+SRTI+MES I D I P+GW PW+ DFALK
Sbjct  473  VLQNCQIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMESTIEDLIHPDGWTPWEGDFALK  532

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPGA    RVKW G K++      ++T   F+ G +W+K  GVP
Sbjct  533  TLYYAEYNNKGPGAKTDNRVKWDGYKKINKEEAMQYTVGPFLKGHAWLKVEGVP  586



>ref|XP_006652375.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Oryza brachyantha]
Length=568

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKEYSR +IMES I DFI+PEG++PW  DFAL 
Sbjct  448  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGDFALN  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E+NNRGPGA  +KRV W G + +     ++FT   F+ G +W+K +G P+   F
Sbjct  508  TLYYAEYNNRGPGAGTSKRVNWKGFRVIGQKEAEQFTTGPFVDGATWLKFTGTPHFLGF  566



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I Q C    DP Y P +   K+YLGRPWK+YSRTII+ S I D IQPEGWLPW  DF L 
Sbjct  456  IFQGCHFMGDPAYLPFKSINKAYLGRPWKQYSRTIIIGSQIDDIIQPEGWLPWMGDFGLN  515

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+E  N+GPGA +TKRVKW GIK +       FTP +FI G +WI   G+PY+   +
Sbjct  516  TLFYAEVQNKGPGAVETKRVKWRGIKHITPQHAADFTPRRFIDGDAWIPAKGIPYSSGMM  575



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC IKA+ D+   +  IK+YLGRPWKE+SRTIIM+S I  FI PEGW PW  +FAL 
Sbjct  424  VMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALD  483

Query  530  TLFYSEFNNRGPGASKTKRVKWHGI-KELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFY+E+ NRGPG+    RV W G  K +   +  +FTPA FI G  W+K SGVPY P  
Sbjct  484  TLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPAVFIMGDEWVKLSGVPYEPGM  543

Query  353  I  351
            I
Sbjct  544  I  544



>gb|EAY94388.1| hypothetical protein OsI_16156 [Oryza sativa Indica Group]
Length=568

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKEYSR +IMES I DFI+PEG++PW  +FAL 
Sbjct  448  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALN  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+EFNNRGPGA  +KRV W G + +     ++FT   F+ G +W+K +G P+
Sbjct  508  TLYYAEFNNRGPGAGTSKRVNWKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPH  562



>emb|CAH67075.1| OSIGBa0097P08.5 [Oryza sativa Indica Group]
Length=568

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKEYSR +IMES I DFI+PEG++PW  +FAL 
Sbjct  448  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALN  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+EFNNRGPGA  +KRV W G + +     ++FT   F+ G +W+K +G P+
Sbjct  508  TLYYAEFNNRGPGAGTSKRVNWKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPH  562



>ref|NP_001052981.1| Os04g0458900 [Oryza sativa Japonica Group]
 emb|CAD40902.1| OSJNBa0036B21.20 [Oryza sativa Japonica Group]
 dbj|BAF14895.1| Os04g0458900 [Oryza sativa Japonica Group]
 gb|EAZ30965.1| hypothetical protein OsJ_15044 [Oryza sativa Japonica Group]
 dbj|BAH00497.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45776.1| ORW1943Ba0077G13.4 [Oryza rufipogon]
Length=568

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKEYSR +IMES I DFI+PEG++PW  +FAL 
Sbjct  448  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALN  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+EFNNRGPGA  +KRV W G + +     ++FT   F+ G +W+K +G P+
Sbjct  508  TLYYAEFNNRGPGAGTSKRVNWKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPH  562



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ C I  + DY  V+   K+YLGRPWKEYS+TIIM +FIPDF+  +GW PW+ +F L 
Sbjct  445  VLQGCRIAGESDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFVPAQGWQPWQGNFGLD  504

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFYSE  N GPGA  T RV W GIK+L    +  FTP+++I G +WI   GVPY P  
Sbjct  505  TLFYSEVRNTGPGAPVTNRVTWPGIKKLSEEEVLEFTPSRYIQGDAWIPGKGVPYTPGL  563



>ref|XP_007035986.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06912.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=597

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  D    PVRFKI+SYLGRPWKE+SRT+IMES I DFIQP GWL W  +FAL 
Sbjct  471  VIQNCRIVPDQALFPVRFKIRSYLGRPWKEHSRTVIMESTIGDFIQPAGWLEWAGNFALN  530

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ NRGPGA+   RVKW G K +   +   +FT   F+ G++W+  SGVP+
Sbjct  531  TLYYAEYANRGPGAATNGRVKWKGYKVITNRNEALQFTAGPFLQGQTWLAESGVPF  586



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+ N   +ADPDY PVR K K+YLGRPWKEYS+TIIMES I D IQPEGWLPW+ +F L 
Sbjct  477  IIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIMESEIGDLIQPEGWLPWEGNFGLD  536

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T +Y E+NN G GA  T RVKW G+K +     ++F P        WI+ SG+PY+PA I
Sbjct  537  TSYYGEYNNFGDGARLTNRVKWRGVKTIVRTRAEKFMPPILYENDDWIRDSGIPYDPALI  596

Query  350  YPPP  339
               P
Sbjct  597  GIAP  600



>ref|XP_010276570.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=211

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  D      + KI S+LGRPWK+Y+ TIIMES I DFI+PEGW+PW  +FAL 
Sbjct  90   VIQNCNIVPDQQLSVDKLKIPSFLGRPWKKYATTIIMESAIGDFIRPEGWMPWSGNFALD  149

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+NNRGPGA+  +RVKW G K +   +   RFT   FI G  W+K++G P+
Sbjct  150  TLFYAEYNNRGPGANTAQRVKWKGFKVITNRNEALRFTAGPFILGNEWLKNTGAPF  205



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I Q+C    DP Y P +   K+YLGRPWKEYSRTII+ S I D IQPEGWLPW  DF L 
Sbjct  457  IFQSCHFMGDPAYLPFKAINKAYLGRPWKEYSRTIIIGSTIDDIIQPEGWLPWMGDFGLN  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TLFY+E  N+G GA ++KRVKW GIK +       FTP +FI G +WI   G+PY+   +
Sbjct  517  TLFYAEVQNKGAGADESKRVKWRGIKHITPQHAADFTPRRFIDGDAWIPAKGIPYSSGMM  576



>ref|XP_008242146.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=596

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  D D +PV+ + K+YLGRPWKE+SRTI+M+S I D I P+GW PW+ DFALK
Sbjct  475  VLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMDSTIEDLIHPDGWTPWQGDFALK  534

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPGA    RVKW G K +      ++T   F+ G +W++  GVP
Sbjct  535  TLYYAEYNNKGPGAKTDNRVKWSGYKVIDKQEAMKYTVGPFLKGNAWLRVKGVP  588



>ref|XP_010047427.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Eucalyptus grandis]
Length=590

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I AD    PV+ K ++YLGRPWKE+SRTIIMES I DFI P G++PW+ DFALK
Sbjct  471  VLQNCRITADKKLIPVKSKFQTYLGRPWKEFSRTIIMESSIEDFIDPAGFMPWEGDFALK  530

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+EFNN+GPGA+   RVKW G K++      +FT   F+ G  WIK +GVP
Sbjct  531  TLYYAEFNNKGPGANINARVKWPGYKKINKQEAAKFTVGTFLDG-DWIKGAGVP  583



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC+I ADP        +++YLGRPWKEYSRTIIM+S I  FI P+GW PW   F LK
Sbjct  445  VLQNCSIVADPALLSADPPVRAYLGRPWKEYSRTIIMQSNIDGFIDPQGWSPWMGTFGLK  504

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+E+ NRGPGA+  +RV W GI+ +   + + FTP K+  G SWI  SG PY P  +
Sbjct  505  TLYYAEYQNRGPGANTDQRVDWPGIQHITPQVAESFTPGKYFIGDSWITASGFPYVPGML  564



>gb|EAY94391.1| hypothetical protein OsI_16158 [Oryza sativa Indica Group]
Length=568

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI +YLGRPWKEYSR +IMES I DFI+PEG++PW  +FAL 
Sbjct  448  VIQNCRLVPDQKLFPDRFKIPAYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALN  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+EFNNRGPGA  +KRV W G + +     ++FT   F+ G +W+K +G P+
Sbjct  508  TLYYAEFNNRGPGAGTSKRVNWKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPH  562



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I A+P +   +  +K+YLGRPWK++SRTIIM++ I  FI PEGW PW+ +FAL 
Sbjct  451  VIQNCHILAEPAFLSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWEGNFALD  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y EF NRGPG+  ++RV+W GI+ +   I + FTP +   G  W++ SGVPY    +
Sbjct  511  TLYYGEFKNRGPGSDMSRRVRWKGIQTITPAIAESFTPGRLFAGDEWVRQSGVPYVAGMV  570



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  +P Y PV+   K+YLGRPWKE+SRTIIM + I D I P GWLPW  DFAL 
Sbjct  452  VLQNCHITGEPAYIPVKSINKAYLGRPWKEFSRTIIMGTTIDDVIDPAGWLPWNGDFALN  511

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E+ N GPG+++ +RVKW GIK+L      RFTPA+F+ G  WI  + VPY   F
Sbjct  512  TLYYAEYENNGPGSNQAQRVKWPGIKKLSPKQALRFTPARFLRGNLWIPPNRVPYMGNF  570



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            IL NCTI AD +Y P   +  SYLGRPWK YSRTIIM+S I +FI PEGWLPW  D  L 
Sbjct  462  ILHNCTISADSEYLPFHIQNPSYLGRPWKPYSRTIIMQSQIDEFIHPEGWLPWLGDVGLH  521

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E +N G GA+ TKRV W G K++ +   ++FT  +FI G SW++ +GVPY P  +
Sbjct  522  TCFYAEVDNHGLGANVTKRVTWRGYKKIDSSHAQQFTVQRFIQGNSWLRPTGVPYIPGLL  581



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            IL NCTI ADP Y P R K+ ++LGRPWKE+SRT +++S + D I P+GWLPW  DF L 
Sbjct  431  ILHNCTISADPAYFPARKKLPTFLGRPWKEFSRTFVLQSQLDDLIDPKGWLPWSGDFGLN  490

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            + FY+E +NRGPGA  ++RV W G+K +     ++FT   FI G +W+  +GVP+ P  +
Sbjct  491  SCFYTELDNRGPGADMSQRVNWKGVKSIDYAHAQKFTVEHFIQGNAWLPKTGVPFIPGLL  550



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NCTI ADP + P R K+ ++LGRPWKE+SRT +++S + D I P+GWLPW  +F L 
Sbjct  431  VLHNCTISADPAFFPFREKLPTFLGRPWKEFSRTFVLQSQLDDLIDPKGWLPWFENFGLN  490

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E +NRGPGA+ ++RVKW G+K +     ++FT   FI G +W+  SGVPY P  +
Sbjct  491  TCFYTELDNRGPGANTSQRVKWKGVKTIGYAHAQKFTVEHFIQGNTWLPKSGVPYIPGLL  550



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNCTI +DP Y P R K+ +YLGRPWK YSRT+I++S + D + P+GW+PW  +  L 
Sbjct  444  VIQNCTITSDPAYYPSRKKLPTYLGRPWKPYSRTLILQSQLDDLVHPDGWMPWNGNIGLD  503

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E +NRGPGA+ TKRV W GIK+L     +RFT   ++ G++WI  +GVP+ P  +
Sbjct  504  TCFYAELDNRGPGANLTKRVTWPGIKKLSYDEAQRFTVEHYLFGQTWIPRTGVPFIPGLL  563



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I+A+P +   +  IK+YLGRPWKEYSRTIIM+S+I  FI PEGW PW  +FAL 
Sbjct  441  VLQNCDIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQSYIDAFIDPEGWAPWNGNFALN  500

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIK-ELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ NRGPGA+  KRVKW G K  +     +++ PA FI   +WIK +G+ Y
Sbjct  501  TLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIKKTGISY  556



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTI ADP   P +   KSYLGRPWKE+SRTIIME+ I D I P+GW+PW  DF L+
Sbjct  471  VLQGCTISADPSLVPEKNVFKSYLGRPWKEFSRTIIMETDIDDSISPDGWMPWMGDFGLQ  530

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKE-LPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T +Y+EFNNRGPGA  T RVKW GIK  L     + +T A +I    W+K  G+PY P  
Sbjct  531  TCYYAEFNNRGPGAVLTNRVKWPGIKTPLTPEQAQEYTAAPYIQADDWVKPLGIPYVPGL  590

Query  353  I  351
            +
Sbjct  591  M  591



>ref|XP_007203102.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
 gb|EMJ04301.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
Length=596

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  D D +PV+ + K+YLGRPWKE+SRTI+M S I D I P+GW PW+ DFALK
Sbjct  475  VLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMGSTIEDLIHPDGWTPWQGDFALK  534

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPGA    RVKW G K +      ++T   F+ G +W++  GVP
Sbjct  535  TLYYAEYNNKGPGAKTDNRVKWSGYKVIDKQEAMKYTVGPFLKGNAWLRVKGVP  588



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QN +I AD  Y PVR KIKSYLGRPW+ +SRT+IME+FI D IQP+GWLPW+ +F + 
Sbjct  477  VIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIH  536

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELP-THIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+E+ N GPGA+KT RV W G+K +        FT  KF  G  WIK  GVPY   F
Sbjct  537  TCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGVPYVSGF  596

Query  353  I  351
            +
Sbjct  597  V  597



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QN +I AD  Y PVR KIKSYLGRPW+ +SRT+IME+FI D IQP+GWLPW+ +F + 
Sbjct  473  VIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIH  532

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELP-THIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FY+E+ N GPGA+KT RV W G+K +        FT  KF  G  WIK  GVPY   F
Sbjct  533  TCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGVPYVSGF  592

Query  353  I  351
            +
Sbjct  593  V  593



>gb|EMS49616.1| Putative pectinesterase/pectinesterase inhibitor 28 [Triticum 
urartu]
Length=563

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D      RFKI SYLGRPWKE+SR +IMES I DFI+PEG++PW  DFALK
Sbjct  443  VIQNCRLVPDQKLFADRFKIPSYLGRPWKEFSRLVIMESMIADFIKPEGYMPWNGDFALK  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+EF NRGPGA  +KRV W G + +     ++FT   FI G +W+K +G+P
Sbjct  503  TLYYAEFGNRGPGAGTSKRVTWPGFRVIGNKEAEQFTAGPFIDGATWLKFTGMP  556



>ref|XP_010273980.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Nelumbo nucifera]
Length=599

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QN  I  D    P R KIKSYLGRPWKEYSRTIIMES I D IQP+GWLPW  DFAL 
Sbjct  480  VIQNSRILPDDKLVPDRTKIKSYLGRPWKEYSRTIIMESTISDVIQPDGWLPWDGDFALN  539

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFY+E+NNRGPGA  T RVKW G K +      +FT   F+   +WI+ SG P+    
Sbjct  540  TLFYAEYNNRGPGAKLTARVKWPGFKVIKKDEADKFTVGTFLE-TNWIQASGAPFRQGL  597



>ref|XP_007025998.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
 gb|EOY28620.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
Length=543

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D  PV+  IKSYLGRPWKEYSRT++M+S+I D I P GW  W  DFALKT
Sbjct  425  IQNCNIIASADLRPVKASIKSYLGRPWKEYSRTVVMQSYIADHIDPSGWSIWNGDFALKT  484

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELP-THIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ NRGPGA   KRVKW G + L      K FT A+ I G SW+K +GV Y    
Sbjct  485  LYYGEYMNRGPGAGTCKRVKWPGYRILTKAEEAKPFTVAELIQGGSWLKSTGVAYTEGL  543



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I A+P +      +K+YLGRPWK++SRTIIM++ I  FI PEGW PW+ +FAL 
Sbjct  451  VIQNCHILAEPAFLSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWQGNFALD  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y EF NRGPG+  ++RV+W GI+ +   I   FTP +   G  W++ SGVPY    +
Sbjct  511  TLYYGEFKNRGPGSDMSRRVRWKGIQTITPAIADSFTPGRLFAGDEWVRQSGVPYVAGMV  570



>gb|EYU28291.1| hypothetical protein MIMGU_mgv1a003232mg [Erythranthe guttata]
Length=598

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I AD   +P + K +SYLGRPWKEYSRT++ME+ I DFI+ EGW+ W  DFALK
Sbjct  478  VIQNCRILADDKLEPEKAKFRSYLGRPWKEYSRTVVMETEIGDFIEAEGWMEWSGDFALK  537

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TLFY+E+NN+G GAS T RVKW G K +      +F+   F+ G++W+K+  VP
Sbjct  538  TLFYAEYNNKGAGASTTGRVKWPGCKVIKKEDAVKFSVGPFLQGETWLKNPDVP  591



>gb|ACF79975.1| unknown [Zea mays]
 gb|ACG46952.1| pectinesterase-1 precursor [Zea mays]
 gb|AFW58467.1| pectinesterase [Zea mays]
Length=563

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 10/126 (8%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKE+SR +IMES I DF++PEG++PW  DFALK
Sbjct  443  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFVKPEGYMPWNGDFALK  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKR-----FTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+NNRGPGA  +KRV W G      H+I R     FT   FI G  W+K++G P+
Sbjct  503  TLYYAEYNNRGPGAGTSKRVNWPGF-----HVIGRKEAEPFTAGPFIDGAMWLKYTGAPH  557

Query  365  NPAFIY  348
               F +
Sbjct  558  ILGFKF  563



>ref|XP_008391931.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Malus domestica]
Length=599

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  D D +PV+ + K+YLGRPWKE+SRTI+MES I D I  +GW PW+ DFALK
Sbjct  478  VLQNCQIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMESTIEDLIHXDGWTPWEGDFALK  537

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPG     RVKW G K++      ++T   F+ G +W+K  GVP
Sbjct  538  TLYYAEYNNKGPGXKTDNRVKWDGYKKINKEEAMQYTVGPFLKGHAWLKVEGVP  591



>ref|XP_008219291.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Prunus mume]
Length=564

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NCTIK  PD     F +K+YLGRPWKEYSRT+ M++F+   I P GWL W  DFAL T
Sbjct  446  IHNCTIKPTPDLASSNFTVKTYLGRPWKEYSRTVYMQTFMASLIDPAGWLAWSGDFALST  505

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+NN GPG++ T RV W G   + + +   FT   F+TG +W+  +GVPY    I
Sbjct  506  LYYAEYNNTGPGSNTTNRVTWPGYHVINSTVAANFTVTNFLTGDNWLPATGVPYTGGLI  564



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  +P Y PV+   K+YLGRPWKE+SRTIIM + I + I P GWLPW  DFAL 
Sbjct  453  VLQNCHITGEPAYLPVKSINKAYLGRPWKEFSRTIIMGTTIDNIIDPAGWLPWNGDFALN  512

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ N GPG+ + +RVKW GIK++     +RFTPA+F+ G  WI  + VPY
Sbjct  513  TLYYAEYENNGPGSDQAQRVKWPGIKKISPKQARRFTPARFLRGNLWIPPNRVPY  567



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC IKA+  +   +  IK+YLGRPWKE+SRTIIM+S I  FI PEGW PW  +FAL 
Sbjct  424  VMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALD  483

Query  530  TLFYSEFNNRGPGASKTKRVKWHGI-KELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFY+E+ NRGPG+    RV W G  K +   +  +FTP  FI G  W+K SGVPY P  
Sbjct  484  TLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPGVFIMGDEWVKLSGVPYEPGM  543

Query  353  I  351
            I
Sbjct  544  I  544



>ref|XP_003579894.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=563

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKE+SR +IMES I DF++PEG++PW  DFALK
Sbjct  443  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFVKPEGYMPWNGDFALK  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E+ NRGPGA  +KRV W G + +     ++FT   F+ G +W+K +G P+   F
Sbjct  503  TLYYAEYANRGPGAGTSKRVNWPGFRVIGQKEAEQFTAGPFVDGATWLKFTGTPHYLGF  561



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  DP Y PVR   K+YLGRPWKE+SRTI+M++ + D I P GWLPW  DFALK
Sbjct  442  VLHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVMKTIVDDVIDPAGWLPWSGDFALK  501

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E  N GPGA++ +RVKW GIK+L       +T  +F++G +WI  + VPY    
Sbjct  502  TLYYAEHLNVGPGANQAQRVKWPGIKKLTPEQALSYTGDRFLSGNTWIPRTQVPYTAGM  560



>ref|NP_001105487.1| pectin methylesterase1 [Zea mays]
 emb|CAA73733.1| pectin methylesterase-like protein [Zea mays]
Length=563

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 10/126 (8%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKE+SR +IMES I DF++PEG++PW  DFALK
Sbjct  443  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFVKPEGYMPWNGDFALK  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKR-----FTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+NNRGPGA  +KRV W G      H+I R     FT   FI G  W+K++G P+
Sbjct  503  TLYYAEYNNRGPGAGTSKRVNWPGF-----HVIGRKEAEPFTAGPFIDGAMWLKYTGAPH  557

Query  365  NPAFIY  348
               F +
Sbjct  558  ILGFKF  563



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I+A+P +   +  IK+YLGRPWKEYSRTII++S+I  FI PEGW PW  +FAL 
Sbjct  441  VLQNCDIRAEPAFTSAQPPIKAYLGRPWKEYSRTIIIQSYIDAFIDPEGWAPWNGNFALN  500

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIK-ELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ NRGPGA+  KRVKW G K  +     +++ PA FI   +WIK +G+ Y
Sbjct  501  TLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIKKTGISY  556



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P+Y PV+   K+YLGRPWKE+SRTIIM + I + I P GWLPW  DFAL 
Sbjct  452  VLHNCHIMGEPEYIPVKSINKAYLGRPWKEFSRTIIMRTNIDNVIDPAGWLPWDGDFALS  511

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+EF N GPG+ +++RVKW GIK+L      RFTPA+F+ G  WI  + VPY
Sbjct  512  TLYYAEFENTGPGSDQSQRVKWPGIKKLSPKQALRFTPARFLRGNLWIPPNRVPY  566



>ref|XP_004975844.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Setaria italica]
Length=563

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKE+SR +IMES I DFI+PEG++PW  DF LK
Sbjct  442  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFIKPEGYMPWNGDFGLK  501

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NNRGPGA  ++RVKW G + + T    ++FT   FI G +W+K +G P
Sbjct  502  TLYYAEYNNRGPGAGTSQRVKWPGYRGVITRQEAEQFTAGPFIDGATWLKFTGTP  556



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI A+ DY PV+    S+LGRPWK YSRTI+M+S I D I P+GW PW   F + 
Sbjct  458  VLQNCTITAEKDYLPVKLDSPSFLGRPWKPYSRTIVMQSSIDDIIDPKGWAPWMGTFGID  517

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T   SE+ NRGPGA+ T RV W GI +L     + FT  KF+ G SWI  +GVPY    +
Sbjct  518  TCSLSEYGNRGPGATLTSRVTWKGIVKLSPQDAEAFTAGKFLEGDSWIAATGVPYTSGMM  577



>ref|XP_007222884.1| hypothetical protein PRUPE_ppa003581mg [Prunus persica]
 gb|EMJ24083.1| hypothetical protein PRUPE_ppa003581mg [Prunus persica]
Length=564

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NCTIK  PD     F +K+YLGRPWKEYSRT+ M++F+   I P GWL W  DFAL T
Sbjct  446  IHNCTIKPTPDLASSNFTVKTYLGRPWKEYSRTVYMQTFMASLIDPAGWLAWSGDFALST  505

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+NN GPG++ T RV W G   + + +   FT   F+ G +W+  +GVPY    I
Sbjct  506  LYYAEYNNTGPGSNTTNRVTWPGYHVINSTVAANFTVTNFLMGDNWLAATGVPYTGGLI  564



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            IL NCTI ADP Y   R K+ ++LGRPWK YSRT I++S I D I P+GWLPW  DF L 
Sbjct  431  ILHNCTISADPAYYDFRTKLPTFLGRPWKMYSRTFILQSQIDDLIHPDGWLPWFGDFGLN  490

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E +NRGPGA K+KRV W G+K +     K+F+  +F+ G  W+  +GVP+    +
Sbjct  491  TCFYTEVDNRGPGADKSKRVTWKGVKNIDYAHAKKFSVQQFLHGGKWLPRTGVPFTAELL  550



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I + CT+ ++P Y  V+ K  +YLGRPWKEYS+TI M S I D I P+GW  W+ +FAL 
Sbjct  461  IFEGCTVSSEPGYKAVKAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWTEWQGNFALD  520

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAK-FITGKSWIKHSGVPYNPA  357
            TL+Y+EF N+G GA K++RVKW GIK L       FTPAK F++G  WI  SGVPY P 
Sbjct  521  TLYYAEFENKGAGADKSQRVKWKGIKTLSAQEADGFTPAKLFVSGDKWIPESGVPYAPG  579



>gb|KJB57711.1| hypothetical protein B456_009G176700 [Gossypium raimondii]
Length=547

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D +PV+  IKSYLGRPWKEYSRT++M+S+I D I P GW  W  DFALKT
Sbjct  429  IQNCNILASADLEPVKGSIKSYLGRPWKEYSRTVVMQSYIGDHIDPSGWSVWSGDFALKT  488

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPY  366
            L+Y E+ NRG GA  +KRVKW G   + +    K+FT A+ I G SW+K +GV +
Sbjct  489  LYYGEYMNRGSGADTSKRVKWPGFHVITSAEEAKKFTVAELIQGGSWLKSTGVTF  543



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI +DP Y P R  + +YLGRPWK YSRT+I++S + D I P+GWLPW  D  L 
Sbjct  446  VLQNCTITSDPAYYPHRKVLPTYLGRPWKPYSRTLILQSQLDDLIHPDGWLPWTGDVGLD  505

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E +NRGPGA  TKRV W GIK L     + +T   ++ G++WI  +GVP+ P  +
Sbjct  506  TCFYAELDNRGPGADLTKRVTWPGIKNLTYVEAQEYTIENYLYGQTWISRAGVPFIPGLL  565



>sp|P83947.1|PME1_FICPW RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; Flags: 
Precursor [Ficus pumila var. awkeotsang]
Length=545

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D +PV    KSYLGRPWKEYSRT++MES+I D I P GWL W  DFALKT
Sbjct  425  IQNCEIFASADLEPVEDTFKSYLGRPWKEYSRTVVMESYISDVIDPAGWLEWDRDFALKT  484

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            LFY E+ N GPG+  ++RVKW G   + +  + ++FT A+ I G SW+  +GV Y    
Sbjct  485  LFYGEYRNGGPGSGTSERVKWPGYHVITSPEVAEQFTVAELIQGGSWLGSTGVDYTAGL  543



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NCTI ADP          SYLGRPWKEYSRTIIM+S I   I  +GW PW  +F LK
Sbjct  457  VLHNCTISADPTLSSASTTTVSYLGRPWKEYSRTIIMQSQIDGLINEDGWQPWLGEFGLK  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T FY+E  NRGPGA+ TKRV W G K++      ++T  +FI GK+W+  +GVP+ P  +
Sbjct  517  TCFYTEIGNRGPGAATTKRVTWKGYKKVDLTHAHKYTVQQFIQGKTWLPKTGVPFTPGLM  576



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 81/118 (69%), Gaps = 3/118 (3%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+Q  +I ADP Y PVRF  K+YL RPWK +SRTI M+S+I D I P+G++PW+    L+
Sbjct  454  IIQGGSIVADPMYYPVRFDNKAYLARPWKNFSRTIFMDSYIGDLITPDGYMPWQTLEGLR  513

Query  530  ---TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
               T FYSEFNNRGPG+ K KRVKW GIK L +  I  F PAKF  G  WI+ + VPY
Sbjct  514  GMDTCFYSEFNNRGPGSDKAKRVKWEGIKALDSDGISNFLPAKFFHGDDWIRVTRVPY  571



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P Y PV+   K+YLGRPWKE++RTI+M + I D I P GW  W  DFALK
Sbjct  252  VLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWSAWSGDFALK  311

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TLFY+E+ N GPG++K +RVKW GI+ +       F P +F++G SWI  +GVPY P
Sbjct  312  TLFYAEYENSGPGSNKAQRVKWPGIQRITRPQALGFAPGRFLSGGSWIPQTGVPYLP  368



>ref|XP_004299720.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Fragaria vesca subsp. vesca]
Length=565

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNCT+ A  D     F +K+YLGRPWKEYSRTI M+ FI  FI P GWL W  DFAL T
Sbjct  447  IQNCTVTAAADLASSTFTVKNYLGRPWKEYSRTIFMQGFIDSFIDPAGWLAWNGDFALST  506

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+NN GPG++   RV W G   +       FT + FI G +W+  +GVPY    I
Sbjct  507  LYYAEYNNSGPGSNTNNRVTWPGYHVIGATEAANFTVSNFILGDNWLPQTGVPYTGGLI  565



>ref|XP_004508050.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cicer arietinum]
Length=593

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L  C IKAD    PV+  IKSYLGRPWKE+SRTI+MES I DFI P+GW PW  +FAL 
Sbjct  474  VLHKCQIKADEKLVPVKDTIKSYLGRPWKEFSRTIVMESEIGDFIHPDGWTPWMGNFALD  533

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+EFNN GPGAS + RVKW G K +      ++T   F+ G +W++ SGVP      
Sbjct  534  TLYYAEFNNTGPGASTSARVKWPGYKVIDKEEASQYTVGAFLKG-AWVQTSGVPSQQGLY  592

Query  350  Y  348
            +
Sbjct  593  F  593



>ref|XP_004298254.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=577

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P+RF+I SYLGRPWK YSRT+IMES   DFIQP GWL W+ +FAL 
Sbjct  456  VIQNCRIVPEEALFPLRFQIMSYLGRPWKMYSRTVIMESEFGDFIQPAGWLEWQGNFALD  515

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ NRGPGA  T RVKW G   +   ++  +FTP  F+ G  W+K +G PY
Sbjct  516  TLYYAEYANRGPGAVTTGRVKWKGFHVITDRNVALQFTPGNFLAGGLWLKGTGAPY  571



>ref|XP_003550590.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Glycine max]
 gb|KHN17766.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine 
soja]
Length=603

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTIKAD    P + KI+SYLGRPWKE+SRTI+MES I DFI P+GW  W+ DFALK
Sbjct  484  VLQKCTIKADDSLVPEKDKIRSYLGRPWKEFSRTIVMESEIGDFIHPDGWTAWEGDFALK  543

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+ N GPGAS   R+KW G + +      +FT   F+ G +W++++GVP
Sbjct  544  TLYYAEYGNTGPGASTNARIKWPGYQVINKDEASQFTVGSFLRG-TWLQNTGVP  596



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P RFKI+SYLGRPWKEYSRT+IMES I D IQPEGW+PW  DFAL 
Sbjct  441  VIQNCRIVPEEKLFPQRFKIRSYLGRPWKEYSRTVIMESTIGDLIQPEGWMPWSGDFALD  500

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPYN  363
            TLFY+E+ NRGPGA+  KRV W G K +       +FT   F+ G  W+  +  P++
Sbjct  501  TLFYAEYGNRGPGAATGKRVNWKGFKVITNKREALQFTAGPFLEGDKWLPGTTTPFD  557



>ref|XP_010656076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Vitis vinifera]
Length=597

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  D D  P + ++KSYLGRPWKE+SRTI+MES I D IQP+GWLPW+ +FAL 
Sbjct  475  VLQNCRILPDQDLIPTKTQVKSYLGRPWKEFSRTIVMESTIEDLIQPQGWLPWEGNFALS  534

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIK  384
            TL+Y+E+NN+GPGA+ + RVKW G K +      ++T   FI G  W+K
Sbjct  535  TLYYAEYNNKGPGAALSARVKWPGYKVIEKEEAVKYTVGPFIQGDDWLK  583



>tpg|DAA37472.1| TPA: hypothetical protein ZEAMMB73_350063 [Zea mays]
Length=562

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D    P RFKI SYLGRPWKE+SR +IMES I DFI+PEG++PW  DF +K
Sbjct  442  VIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFIKPEGYMPWNGDFGIK  501

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+E+NNRGPGA  +KRV W G   +     ++FT   FI G  W+K +G P+   F 
Sbjct  502  TLYYAEYNNRGPGAGTSKRVTWPGFHVIGRKDAEQFTAGPFIDGGLWLKFTGTPHILGFK  561

Query  350  Y  348
            +
Sbjct  562  F  562



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P+RFKI SYLGRPWK Y+RT+IMES + DFIQP GWLPW  +FAL 
Sbjct  447  VIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ NRGPGA+  +RV+W G   +  +   +FT   F+    W+K SG+PY
Sbjct  507  TLYYAEYGNRGPGAATNQRVRWKGYHVINRNDALQFTAGPFLLADRWLKTSGIPY  561



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P+RFKI SYLGRPWK Y+RT+IMES + DFIQP GWLPW  +FAL 
Sbjct  447  VIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ NRGPGA+  +RV+W G   +  +   +FT   F+    W+K SG+PY
Sbjct  507  TLYYAEYGNRGPGAATNQRVRWKGYHVINRNDALQFTAGPFLLADRWLKTSGIPY  561



>ref|XP_010027125.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=567

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 84/125 (67%), Gaps = 11/125 (9%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    PVR +I SYLGRPWK+YSRT+IMES I D IQP G++PW  +FAL 
Sbjct  445  VIQNCRIVPEQKLYPVRLQIPSYLGRPWKQYSRTVIMESTIGDLIQPAGYMPWSGNFALD  504

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIK------RFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+ NRGPGA+  KRVKW G      H+IK      +FT + FI G  W+K +G+P
Sbjct  505  TLYYAEYANRGPGAATDKRVKWKGF-----HVIKNRNEALQFTASPFIQGNQWLKPTGMP  559

Query  368  YNPAF  354
            Y   F
Sbjct  560  YLLGF  564



>gb|AFG69043.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69044.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69045.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69046.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69047.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69048.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69050.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69051.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69052.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69053.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69054.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
Length=123

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = -1

Query  698  CTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKTLFY  519
            C + A PD  PV+   ++YLGRPWKEYSRT+ M+SF+ D IQP GWL W   FAL TL+Y
Sbjct  1    CNVTAAPDLAPVKSSFEAYLGRPWKEYSRTVFMQSFLGDLIQPAGWLEWNGSFALSTLYY  60

Query  518  SEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPY  366
             E+ NRGPGA  T RVKW G + +  +     FT +KFI G SW+  +GV Y
Sbjct  61   GEYMNRGPGAGTTNRVKWPGYRVINSSSEASSFTVSKFIEGDSWLPSTGVKY  112



>ref|XP_002447958.1| hypothetical protein SORBIDRAFT_06g018850 [Sorghum bicolor]
 gb|EES12286.1| hypothetical protein SORBIDRAFT_06g018850 [Sorghum bicolor]
Length=563

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D      RFKI SYLGRPWKE+SR +IMES I DFI+PEG++PW  DF +K
Sbjct  443  VIQNCRLVPDQKLFADRFKIPSYLGRPWKEFSRLVIMESTIADFIKPEGYMPWNGDFGIK  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFY+E+NNRGPGA  +KRV W G   +     ++FT   FI G  W+K +G P+   F
Sbjct  503  TLFYAEYNNRGPGAGTSKRVNWPGFHVITRKDAEQFTAGPFIDGALWLKFTGTPHILGF  561



>ref|XP_009800039.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=586

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QNC I  +   +PVRFKI SYLGRPWK YSRT+IMES + DFIQP GW+ W  +FAL 
Sbjct  465  IIQNCRIVPEQLLEPVRFKIPSYLGRPWKMYSRTVIMESTLADFIQPAGWMHWSGNFALD  524

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPY  366
            T +Y+E+ NRGPGA+   RVKW G K +   +   +FT A FI G  W+  +G PY
Sbjct  525  TCYYAEYGNRGPGANTNNRVKWKGFKVITDRNEALQFTTAPFIQGNQWLGSTGSPY  580



>gb|EMT00807.1| Putative pectinesterase/pectinesterase inhibitor 28 [Aegilops 
tauschii]
Length=563

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC +  D      R KI SYLGRPWKE+SR +IMES I DFI+PEG++PW  DF LK
Sbjct  443  VIQNCRLVPDQKLFADRLKIPSYLGRPWKEFSRLVIMESMIADFIKPEGYMPWNGDFGLK  502

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+EF NRGPGA  +KRV W G + +     ++FT   FI G +W+K +G+P
Sbjct  503  TLYYAEFGNRGPGAGTSKRVTWPGFRVIGNKEAEQFTAGPFIDGATWLKFTGMP  556



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNCTI  DP+Y PV+ K KSYLGRPWK  +RT++M+S I   I PEGW+ W      +
Sbjct  242  ILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQ  301

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            + ++ E+ NRGPG+  +KRVKW GIK L       FT  KF+ G  WIK SGVPY    +
Sbjct  302  SCWFGEYRNRGPGSHMSKRVKWSGIKNLSADQAVAFTSGKFVEGDKWIKPSGVPYVAGMV  361



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D  PV+  +K+YLGRPWK YSRT+ M+S I D I PEGW  W+ DFALKT
Sbjct  431  IQNCDIIATSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWQGDFALKT  490

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRVKW G   L     ++FT  + I G +W+K +GV Y    
Sbjct  491  LYYGEYMNKGPGAGTSKRVKWPGYHILNAAEARKFTVGQLIQGGAWLKSTGVAYTEGL  548



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P+RFKI SYLGRPWK Y+RT+IMES + DFIQP GWLPW  +FAL 
Sbjct  446  VIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALD  505

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ NRGPGA+  +RV+W G   +  +   +FT   F+    W+K +G+PY
Sbjct  506  TLYYAEYGNRGPGAATNQRVRWKGYHVINRNDAVQFTAGPFLLADRWLKTTGIPY  560



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 80/124 (65%), Gaps = 11/124 (9%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q C + A  D +PV+  I+SYLGRPWKEYSRT++M+S I D I P GW  W  DFALKT
Sbjct  438  IQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKT  497

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHII------KRFTPAKFITGKSWIKHSGVPY  366
            L+Y E+ NRGPGA  +KRVKW G      H+I      K+FT A+ I G SW+K +GV Y
Sbjct  498  LYYGEYLNRGPGAGTSKRVKWPGY-----HVITDPEEAKKFTVAELIGGGSWLKSTGVAY  552

Query  365  NPAF  354
                
Sbjct  553  TEGL  556



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P+Y PV+   K+YLGRPWK++SRTIIM + I D + P GWLPW   FAL 
Sbjct  451  VLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIDDVVDPAGWLPWNGSFALN  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ N GPG+ +++RVKW GIK+L      RFTPA+F+ G  WI  + VPY
Sbjct  511  TLYYAEYENNGPGSDQSQRVKWPGIKKLSPKQALRFTPARFLRGNLWIPPTRVPY  565



>ref|XP_009623162.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=584

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+QNC I  +   +PVRF I +YLGRPWK YSR++IMES + DFIQP GW+PW  +FAL 
Sbjct  463  IMQNCRIVPEQLLEPVRFNIPTYLGRPWKMYSRSVIMESTLADFIQPAGWMPWSGNFALD  522

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPY  366
            T +Y+E+ NRGPGA+   RVKW G K +   +   +FT A FI G  W+  +G PY
Sbjct  523  TCYYAEYGNRGPGANTNNRVKWKGFKVITDRNEALQFTTAPFIQGNQWLGSTGSPY  578



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 80/124 (65%), Gaps = 11/124 (9%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q C + A  D +PV+  I+SYLGRPWKEYSRT++M+S I D I P GW  W  DFALKT
Sbjct  438  IQKCDVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKT  497

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHII------KRFTPAKFITGKSWIKHSGVPY  366
            L+Y E+ NRGPGA  +KRVKW G      H+I      K+FT A+ I G SW+K +GV Y
Sbjct  498  LYYGEYLNRGPGAGTSKRVKWPGY-----HVITDPEEAKKFTVAELIGGGSWLKSTGVAY  552

Query  365  NPAF  354
                
Sbjct  553  TEGL  556



>gb|EYU33104.1| hypothetical protein MIMGU_mgv1a012115mg [Erythranthe guttata]
Length=261

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +   +P+RFKI +YLGRPWK+YS+TIIMES + DFIQP GW+PW  +FAL 
Sbjct  140  VIQNCRIVPEQKLEPLRFKIPTYLGRPWKKYSKTIIMESTLADFIQPAGWMPWSGNFALD  199

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIK-RFTPAKFITGKSWIKHSGVPY  366
            TL+Y E+ N+GPGA   KRVKW G   +       +FT A FI    W+  +GVPY
Sbjct  200  TLYYREYANKGPGAPTDKRVKWKGYSVITNRDDALQFTAAPFIQADQWLTTTGVPY  255



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++ NC I  DP Y PVR   K+YLGRPWKE+SRTI++++ + D I P GWLPW  DFALK
Sbjct  441  VVHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVIKTTVDDVIDPAGWLPWSGDFALK  500

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E  N GPGA++ +RVKW GIK+L       +T  +F++G +WI  + VPY    
Sbjct  501  TLYYAEHLNVGPGANQAQRVKWPGIKKLTHEQALSYTCDRFLSGNTWIPRTQVPYTAGM  559



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P Y PV+   K+YLGRPWKE++RTI+M + I D I P GW  W  DFALK
Sbjct  451  VLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALK  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TLFY+E+ N GPG++K +RVKW GI+ +       F P +F+ G SWI  +GVPY P
Sbjct  511  TLFYAEYENSGPGSNKAQRVKWPGIQRITRPQALGFAPGRFLRGGSWIPQTGVPYLP  567



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P Y PV+   K+YLGRPWKE++RTI+M + I D I P GW  W  DFALK
Sbjct  451  VLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALK  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TLFY+E+ N GPG++K +RVKW GI+ +       F P +F+ G SWI  +GVPY P
Sbjct  511  TLFYAEYENSGPGSNKAQRVKWPGIQRITRPQALGFAPGRFLRGGSWIPQTGVPYLP  567



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  DP Y PV+   KSYLGRPWK++SRTI+M++ I D I P GWL W  DFALK
Sbjct  447  VLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTLIDDVIDPAGWLEWSGDFALK  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TL+Y+E+ N GPG+++ +RVKW GI+++       +T  +F+ G +WI  + VPY P
Sbjct  507  TLYYAEYLNTGPGSNQAQRVKWPGIRKITPQDALSYTGDRFLGGNTWIPQTQVPYTP  563



>ref|XP_011005056.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Populus euphratica]
Length=595

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 80/118 (68%), Gaps = 9/118 (8%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I+ D D  PV+ KI+SYLGRPWKE+SRTIIMES I DFI P+GWLPW+ DF LK
Sbjct  478  VLQNCRIEPDKDLVPVKTKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQGDFGLK  537

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFIT----GKSWIKHSGVP  369
            TL+Y+E+NN+G GA    R+KW G      HIIK+    KF       + WI  +G P
Sbjct  538  TLYYAEYNNKGIGAQTNARIKWRGY-----HIIKKEEAMKFTVETFYQEDWISATGSP  590



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  DP Y PV+   KSYLGRPWK++SRTIIM++ I D I P GWL W  DFALK
Sbjct  450  VLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIIMKTMIDDVIDPAGWLAWSGDFALK  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TL+Y+E  N GPG+++ +RVKW GI++L       +T  +F+ G +WI  + VPY P
Sbjct  510  TLYYAEHLNTGPGSNQAQRVKWPGIRKLTPQDALLYTGDRFLGGNTWIPQTQVPYTP  566



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 77/116 (66%), Gaps = 0/116 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++ N  I  D  Y PV+ K +++LGRPWKEYSRTIIM + I D I PEGWL W   FALK
Sbjct  351  VIHNSRITGDATYRPVKDKNRAFLGRPWKEYSRTIIMNTDIDDVIDPEGWLKWNETFALK  410

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYN  363
            TLFYSE+ NRG G+ + +RV+W GI+ +     + F P +F+ G +WI    +PYN
Sbjct  411  TLFYSEYRNRGRGSGQARRVRWRGIQRISARQARGFAPGEFLRGNAWITKRRIPYN  466



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNCTI  DP+Y PV+ K KSYLGRPWK  +RT++M+S I   I PEGW+ W      +
Sbjct  457  ILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQ  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            + ++ E+ NRGPG+  +KRVKW GIK L       FT  KF+ G  WIK SGVPY    +
Sbjct  517  SCWFGEYRNRGPGSDMSKRVKWSGIKNLGADQAVAFTSGKFVEGDKWIKPSGVPYVAGMV  576



>ref|XP_010247575.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nelumbo nucifera]
Length=922

 Score =   137 bits (346),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  +      R KI SYLGRPWKEY+ T+IMES I D I+PEGW+PW  DFAL 
Sbjct  450  VLQNCKIVPEQRLVAERLKIPSYLGRPWKEYAVTVIMESTIGDVIRPEGWMPWAGDFALD  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+NNRGPGA+   RVKW G K +       R+T   FI G  W+K +G P+
Sbjct  510  TLFYAEYNNRGPGANTDHRVKWKGFKVITKKDEALRYTVGPFIQGDEWLKDTGSPF  565



>ref|XP_010091418.1| putative pectinesterase/pectinesterase inhibitor 21 [Morus notabilis]
 gb|EXB44455.1| putative pectinesterase/pectinesterase inhibitor 21 [Morus notabilis]
Length=570

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++ NC I  +      RFKI +YLGRPWKE+SRT+IMES + DFIQP GW PW  +FAL 
Sbjct  450  VIHNCRIVPEQKLFADRFKIPTYLGRPWKEFSRTVIMESTLADFIQPAGWFPWAGNFALD  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E+ NRGPGA   +RV W G   +  H  ++FT  +F+ G+ W+  +G P+ P+F
Sbjct  510  TLYYAEYANRGPGARTNRRVHWRGYHVIGRHEAQQFTVGQFLEGQRWLPATGAPFLPSF  568



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P Y PV+   K+YLGRPWK +SRTI+M + I + I P GWLPW  DFAL 
Sbjct  448  VLHNCRITGEPAYIPVKAVNKAYLGRPWKVFSRTIVMMTNIDNVIDPAGWLPWDGDFALN  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TL+Y+E+ N GPG+++ +RV W GIK +      +FTPA+F+ G  WI  + VPY P
Sbjct  508  TLYYAEYQNSGPGSNQAQRVNWAGIKNISPRQALKFTPARFLRGNLWIPQTHVPYTP  564



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ILQNCTI  DP+Y PV+ K KSYLGRPWK  +RT++M+S I   I PEGW+ W      +
Sbjct  457  ILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQ  516

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            + ++ E+ NRGPG+  +KRVKW GIK L       FT  KF+ G  WIK SGVPY    +
Sbjct  517  SCWFGEYRNRGPGSHMSKRVKWSGIKNLSADQAVAFTSGKFVEGDKWIKPSGVPYVAGMV  576



>gb|KJB38563.1| hypothetical protein B456_006G260900 [Gossypium raimondii]
Length=561

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI   PDY PV+   K+YLGRPWK+++R+IIM+S I D IQPEG+ P      + 
Sbjct  439  VLQNCTISGAPDYIPVKDTNKAYLGRPWKQFARSIIMQSRIDDIIQPEGYAPMTGTIGID  498

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T F +EF NRGPGA  ++RV W GIK++  +   ++TP  F+  ++WI  SGVPY+P  +
Sbjct  499  TSFIAEFGNRGPGADTSRRVAWKGIKKIDINEANKWTPRVFLESETWIPSSGVPYSPDMV  558



>ref|XP_002324181.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEF02746.2| pectinesterase family protein [Populus trichocarpa]
Length=593

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I+ D D  PV+ KI+SYLGRPWKE+SRTIIMES I DFI P+GWLPW+ +F LK
Sbjct  475  VLQNCRIEPDKDLVPVKTKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQGEFGLK  534

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+G GA  T R+KW G   +      +FT   F  G  WI  +G P
Sbjct  535  TLYYAEYNNKGAGAKTTARIKWPGYHIINNEEAMKFTAEPFYQG-DWISATGSP  587



>ref|XP_009590338.1| PREDICTED: pectinesterase 3-like, partial [Nicotiana tomentosiformis]
Length=244

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 11/125 (9%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q C I A PD +PV+ + K+YLGRPWKEYSRT++MES++ D I P GW  W  DFALKT
Sbjct  124  IQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTVVMESYLGDLIDPAGWSEWSGDFALKT  183

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKR------FTPAKFITGKSWIKHSGVPY  366
            L+Y E+ N GPGA  +KRVKW G      HII        FT A+ I G SW+  +GV +
Sbjct  184  LYYGEYMNNGPGAGTSKRVKWSGY-----HIITNPAEAMPFTVAELIQGGSWLSSTGVTF  238

Query  365  NPAFI  351
                +
Sbjct  239  VQGLV  243



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D  PV+  +K+YLGRPWK YSRT+ M+S I D I PEGW  W  DFALKT
Sbjct  431  IQNCDIIASSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKT  490

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRVKW G   L      +FT ++ I G  W+K +GV Y    
Sbjct  491  LYYGEYMNKGPGAGTSKRVKWPGYHVLSASEATKFTVSQLIQGGVWLKSTGVAYTEGL  548



>gb|AFG69049.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
Length=123

 Score =   126 bits (317),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 73/112 (65%), Gaps = 1/112 (1%)
 Frame = -1

Query  698  CTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKTLFY  519
            C + A PD  PV+   ++YLGRPWKEYSRT+ M+SF+ D IQP GWL W   FAL TL+Y
Sbjct  1    CNVTAAPDLAPVKSSFEAYLGRPWKEYSRTVFMQSFLGDLIQPAGWLEWNGSFALSTLYY  60

Query  518  SEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPY  366
             E+ NRGPGA  T RVKW G + +  +     FT +KFI G  W+  +GV Y
Sbjct  61   GEYMNRGPGAGTTNRVKWPGYRVINSSSEASSFTVSKFIEGDLWLPSTGVKY  112



>gb|KJB38562.1| hypothetical protein B456_006G260800 [Gossypium raimondii]
Length=561

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI   PDY PV+   K+YLGRPWK+++R+IIM+S I D IQPEG+ P      + 
Sbjct  439  VLQNCTISGAPDYIPVKDTNKAYLGRPWKQFARSIIMQSRIDDIIQPEGYAPMTGTIGID  498

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T F +EF NRGPGA  ++RV W GIK++  +   ++TP  F+  ++WI  SG+PY+P  +
Sbjct  499  TSFIAEFGNRGPGADTSRRVAWKGIKKIDINEANKWTPRVFLESETWIPSSGIPYSPDMV  558



>gb|KHN34209.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine 
soja]
Length=537

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ C IKAD D  P++  IK+YLGRPWKEYSRTIIME+ I D I P+G+LPW+ +FAL 
Sbjct  418  VLQKCVIKADTDLVPLKDTIKNYLGRPWKEYSRTIIMETQIDDLIHPDGFLPWEGNFALS  477

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y E+NN G G+S T RV W G K +      R+T   F+ G +WI  +GVP
Sbjct  478  TLYYGEYNNNGAGSSTTARVNWPGRKVINRDEATRYTVEAFLQG-TWINGTGVP  530



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (63%), Gaps = 11/124 (9%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q C I A  D +PV+   KSYLGRPWKEYSRT++M+S I D I P GW  W  DFALKT
Sbjct  434  IQKCEISASSDLEPVKASYKSYLGRPWKEYSRTVVMQSTIGDLIDPAGWAEWDKDFALKT  493

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHII------KRFTPAKFITGKSWIKHSGVPY  366
            L+Y E+ N+GPGA  +KRV W G      H+I      ++FT A+ I G  W+K+SGV Y
Sbjct  494  LYYGEYANQGPGAGTSKRVNWAGY-----HVITSPSEAQKFTVAELIQGGYWLKNSGVAY  548

Query  365  NPAF  354
                
Sbjct  549  TEGL  552



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI  DP+Y PV+ K K+YLGRPWK  +RTI+M+S I D I PEGW+ W      K
Sbjct  454  VLQNCTISGDPEYIPVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGWMEWTGSTNHK  513

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            + ++ E+ NRGPG+  T+RV W GIK+L P H +  FT  + + G  WIK SGVPY    
Sbjct  514  SCWFGEYGNRGPGSDMTRRVTWSGIKKLTPEHAVD-FTAGRLMEGDRWIKPSGVPYVAGM  572

Query  353  I  351
            +
Sbjct  573  V  573



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 83/122 (68%), Gaps = 3/122 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFA--  537
            ++Q  +I ADP++ PVRF  KSYL RPWK +SRTIIM++FI D I P+G+ PW  +    
Sbjct  454  VIQGGSIVADPEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLIHPDGFFPWHTEVGPI  513

Query  536  -LKTLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
             + T FY+E++N GPG++K+KRVKW GI  + +    RF P+KF  G  WIK +G+PY P
Sbjct  514  NMDTCFYAEYHNYGPGSNKSKRVKWAGIYNINSKAAHRFAPSKFFHGGDWIKDTGIPYFP  573

Query  359  AF  354
              
Sbjct  574  TI  575



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QN T  A P+  PV+ K  +YLGRPW  +SRTIIMES++ D I+PEGW  W   + L 
Sbjct  481  VIQNSTFTAAPELVPVKDKYPTYLGRPWGNFSRTIIMESYLDDLIKPEGWAIWDGPWGLN  540

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            T FYSEFNN GPG++KT RV W GIK +       FTP KFI G +WIK   VPY P F
Sbjct  541  TSFYSEFNNYGPGSNKTGRVTWRGIKRISQATAFGFTPGKFINGAAWIKPRRVPYTPGF  599



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  D  Y PV+ + K+YLGRPWKE+SRTI+M++ I D I P GWLPW  DFALK
Sbjct  450  VLHNCHITGDSAYIPVKSESKAYLGRPWKEFSRTIVMKTAIDDVIDPAGWLPWSGDFALK  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E  N GPG+++  RVKW GIK+L       +T  KF+ G++WI  + VPY
Sbjct  510  TLYYAEHLNTGPGSNQAHRVKWPGIKKLTPQDALLYTGDKFLGGETWIPQTQVPY  564



>emb|CAA96436.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=274

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 73/118 (62%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I    D  PV+  +K+YLGRPWK YSRT+ M+S I D I PEGW  W  DFALKT
Sbjct  157  IQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKT  216

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRVKW G   L      +FT  + I G  W+K +GV Y    
Sbjct  217  LYYGEYMNKGPGAGTSKRVKWPGYHILSAAEATKFTVGQLIQGGVWLKSTGVAYTEGL  274



>ref|XP_010057972.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q+C + A  D  PV+  IKSYLGRPWKEYSRT++M+S I D I P GW  W  DFALKT
Sbjct  431  IQSCNMTASSDLVPVKGSIKSYLGRPWKEYSRTVVMQSNIGDHIDPTGWSVWSGDFALKT  490

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRV W G   + +    K+FT A+ I G +W+K SGV Y    
Sbjct  491  LYYGEYMNKGPGAGTSKRVNWPGYHVITSATEAKKFTVAELIQGGTWLKSSGVSYTEGL  549



>ref|XP_008347782.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Malus domestica]
Length=564

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NCTI   PD     + +K+YLGRPWKEYSRT+ M++F+   I P GWL W  DFAL T
Sbjct  446  IHNCTITPTPDLASSNYTVKTYLGRPWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALST  505

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+NN GPG+S T RV W G   +   +   FT + F+ G +W+  +GVPY    +
Sbjct  506  LYYAEYNNTGPGSSTTNRVTWPGYHVINATVAANFTVSNFLLGDNWLPDTGVPYTGGLV  564



>ref|XP_009359677.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=599

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  D D +PV+ + K+YLGRP KE+SRTI+M+S I D I P+GW  W+ DFALK
Sbjct  478  VLQNCKIMPDKDLEPVKSQFKTYLGRPSKEFSRTIVMDSTIEDLIHPDGWTQWEGDFALK  537

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPGA    RVKW G K++       +T   F+ G +W+   GVP
Sbjct  538  TLYYAEYNNKGPGAKTDNRVKWDGYKKIDKQEAMHYTAGPFLKGHAWLMGVGVP  591



>ref|XP_006851559.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
 gb|ERN13140.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
Length=586

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 82/126 (65%), Gaps = 12/126 (10%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            I+ NC I  D    P R K ++YLGRPWKEY+RTI+MES + D IQP+GW+PW+ DFALK
Sbjct  468  IIHNCRIVPDKRLYPERLKFRTYLGRPWKEYARTIVMESTLGDLIQPDGWMPWEGDFALK  527

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKR-----FTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ N+GPGA   +RVKW       + +IKR     FT   F+  + W+  +GVPY
Sbjct  528  TLFYAEYGNKGPGAQTARRVKW-------SRVIKRSDALQFTAGPFLQARQWLPSTGVPY  580

Query  365  NPAFIY  348
                ++
Sbjct  581  VLGLVH  586



>gb|AEW08385.1| hypothetical protein 2_7981_01, partial [Pinus radiata]
 gb|AFG58848.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58849.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58850.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58851.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58852.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58853.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58854.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58855.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58856.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58857.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58858.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58859.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58860.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58861.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58862.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58863.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
Length=138

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNCT+ A  D  PV+   ++YLGRPW+ YSRT+ M+S++ D IQP GWL W   FAL T
Sbjct  22   IQNCTVTAASDLVPVKTSFEAYLGRPWRNYSRTVFMKSYLDDLIQPAGWLEWNGSFALST  81

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPY  366
            L+Y E+ N GPGA    RV+W G + +  +   K+FT ++FI G SW+  +GV Y
Sbjct  82   LYYGEYMNSGPGAGTANRVRWAGYQVIKKSKEAKKFTVSQFIEGNSWLPSTGVRY  136



>ref|XP_007138601.1| hypothetical protein PHAVU_009G222600g [Phaseolus vulgaris]
 gb|ESW10595.1| hypothetical protein PHAVU_009G222600g [Phaseolus vulgaris]
Length=635

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ C IKA  D  PV+  +++YLGRPWKEYSRTIIME+ I D I P+GWLPW+ DFAL 
Sbjct  516  VLQKCVIKAADDLVPVKAGVRNYLGRPWKEYSRTIIMETEIQDLIHPDGWLPWEGDFALN  575

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y EFNN G G++   RV W   K + T    R+T   F+ G +WI  +GVP
Sbjct  576  TLYYGEFNNNGAGSNTNARVNWPNRKVIDTDEATRYTVEAFLQG-AWINGTGVP  628



>ref|XP_010240510.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brachypodium distachyon]
Length=786

 Score =   135 bits (340),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/120 (50%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ C I  + +  P R  I SYLGRPWKEYSRT++MES I D I+PEGW  W  D  LK
Sbjct  666  VLQGCKIVPEQELFPARLTIASYLGRPWKEYSRTVVMESTIGDLIRPEGWSEWMGDLGLK  725

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+E+NN GPGA  +KRV W G + +       FT   FI G SW++ +G P    FI
Sbjct  726  TLYYAEYNNNGPGAGTSKRVAWPGYRVIGQAEATHFTAGVFIDGISWLQSTGTPNVMGFI  785



>gb|EYU26212.1| hypothetical protein MIMGU_mgv1a003546mg [Erythranthe guttata]
Length=579

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +   +P+RFKI +YLGRPWK+YS+TIIMES + DFIQP GW+PW  +FAL 
Sbjct  458  VIQNCRIVPEQKLEPLRFKIPTYLGRPWKKYSKTIIMESTLADFIQPAGWMPWSGNFALD  517

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIK-RFTPAKFITGKSWIKHSGVPY  366
            TL+Y E+ N+GPGA   KRVKW G   +       +FT A FI    W+  +GVPY
Sbjct  518  TLYYREYANKGPGAPTDKRVKWKGYSVITNRDDALQFTAAPFIQADQWLTTTGVPY  573



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 11/124 (9%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q C + A  D +PV+  I+SYLGRPWKEYSRT++M+S I   I P GW  W  DFALKT
Sbjct  438  IQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGGHIDPAGWSEWSGDFALKT  497

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHII------KRFTPAKFITGKSWIKHSGVPY  366
            L+Y E+ NRGPGA  +KRVKW G      H+I      K+FT A+ I G SW+K +GV Y
Sbjct  498  LYYGEYLNRGPGAGTSKRVKWPGY-----HVITDPGEAKKFTVAELIGGGSWLKSTGVAY  552

Query  365  NPAF  354
                
Sbjct  553  TEGL  556



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 84/120 (70%), Gaps = 3/120 (3%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLD---F  540
            +++  +I ADP++ PVRF  KSYL RPWK +SRTIIM++FI D I P+G+LPW  +    
Sbjct  449  VIEGGSIVADPEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPI  508

Query  539  ALKTLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
             + T +Y+E++N GPG+ K+KRVKW GI  + T   ++F P+KF  G  WIK +G+PY P
Sbjct  509  NMDTCYYAEYHNYGPGSDKSKRVKWAGIYNINTKAAQKFAPSKFFHGGDWIKDTGIPYYP  568



>ref|XP_002266980.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=528

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D +PV+  IKSYLGRPWKEYSR ++++S+I D I P GW  W  +FALKT
Sbjct  410  IQNCNIIASSDLEPVKGTIKSYLGRPWKEYSRAVVLQSYIGDHIDPAGWSVWDGEFALKT  469

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKR-FTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ NRGPGA  +KRVKW G + + +    R FT A+ I G +W++ +GV Y    
Sbjct  470  LYYGEYVNRGPGAGTSKRVKWPGYRVITSPAEARNFTVAELIQGGTWLESTGVAYTEGL  528



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q C I A  D +PV+  +KSYLGRPWKEYSRT++M+S I D I P GW  W+ DFALKT
Sbjct  426  IQKCEIIASSDLEPVKSSVKSYLGRPWKEYSRTVVMQSNIADHIDPAGWSIWEGDFALKT  485

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ NRG GA  +KRVKW G + + +    ++FT A+ I G  W+K +GV +    
Sbjct  486  LYYGEYMNRGAGAGTSKRVKWAGYRVITSATEAQKFTVAELIQGGVWLKSTGVAFTEGL  544



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L+NC I+A+P +   +  IK+YLGRPWKEYSRTIIM++ I  FI PEGW PW  +FAL 
Sbjct  437  VLRNCEIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQTQIDAFIDPEGWAPWNGNFALN  496

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIK-ELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ NRGPGA+  KRVKW G K  +     +++ P  FI   SWIK +G+ Y
Sbjct  497  TLYYAEYQNRGPGANTDKRVKWAGYKRNISPQEAEKYAPNIFIDQDSWIKKTGISY  552



>ref|XP_008337792.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Malus domestica]
Length=603

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I  D D +PV+ + K+YLGRP KE+SRTI+M+S I D I P+GW  W+ DFALK
Sbjct  482  VLQNCKIMPDKDLEPVKSQFKTYLGRPSKEFSRTIVMDSTIEDLIHPDGWTQWEGDFALK  541

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPGA    RVKW G K++       +T   F+ G +W+   GVP
Sbjct  542  TLYYAEYNNKGPGAKTDNRVKWDGYKKIDKQEAMHYTVGPFLKGHAWLMGVGVP  595



>ref|XP_002512461.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF49913.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=923

 Score =   135 bits (340),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/119 (50%), Positives = 73/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC+IK   D       IK+YLGRPWKEYSRTI M+S+I   I P GW PW  DFAL T
Sbjct  448  IQNCSIKEAKDLATSNLTIKTYLGRPWKEYSRTIFMQSYIASLIDPAGWTPWSGDFALAT  507

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+EFNN G G+    RV W G   +       FT  KF+ G SW++ +GVPY+   I
Sbjct  508  LYYAEFNNTGVGSRTDNRVTWAGYHVINATDAANFTVTKFVQGDSWLQATGVPYSGGLI  566



>ref|XP_003609936.1| Pectinesterase [Medicago truncatula]
 gb|AES92133.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=595

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L  CTIKAD    PV+  +KSYLGRPWK++SRT++MES I DFI PEGW PW  +FAL 
Sbjct  476  VLHKCTIKADDALVPVKATVKSYLGRPWKQFSRTVVMESDIGDFISPEGWSPWNGNFALS  535

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+ N GPGAS T RVKW   K +      ++T   ++TG +W+++SGVP
Sbjct  536  TLYYAEYANTGPGASTTARVKWPTFKVINKAEASKWTVGTYLTG-TWVQNSGVP  588



>dbj|BAF42040.1| pectin methylesterase 3 [Pyrus communis]
Length=564

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NCTI   PD     + +K+YLGRPWKEYSRT+ M++F+   I P GWL W  DFAL T
Sbjct  446  IHNCTITPTPDLASSNYTVKTYLGRPWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALST  505

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+NN GPG++ T RV W G   +   +   FT + F+ G +W+  +GVPY  + +
Sbjct  506  LYYAEYNNTGPGSNTTNRVTWPGYHVINATVAANFTVSNFLLGDNWLPDTGVPYTGSLV  564



>gb|EMS52976.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=1044

 Score =   135 bits (341),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  710   ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
             +LQ C I  +    PVR  + SYLGRPWKEYSRT++MES I D I+PEGW  W  DF LK
Sbjct  924   VLQGCKIVPEDALFPVRQTVPSYLGRPWKEYSRTVVMESTIGDLIKPEGWSEWMGDFGLK  983

Query  530   TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
             TL+Y+E+ N GPGA  +KRV W G + +      +FT   FI G SW+K++G P    FI
Sbjct  984   TLYYAEYANTGPGAGTSKRVTWPGYRVIGQAEATQFTAGVFIDGMSWLKNTGTPNVMGFI  1043



>emb|CAA96434.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 73/118 (62%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I    D  PV+  +K+YLGRPWK YSRT+ M+S I D I PEGW  W  DFALKT
Sbjct  198  IQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKT  257

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRVKW G   L      +FT  + I G  W+K +GV Y    
Sbjct  258  LYYGEYMNKGPGAGTSKRVKWPGYHILSAAEATKFTVGQLIQGGVWLKSTGVAYTEGL  315



>emb|CAA96435.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 73/118 (62%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I    D  PV+  +K+YLGRPWK YSRT+ M+S I D I PEGW  W  DFALKT
Sbjct  198  IQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKT  257

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRVKW G   L      +FT  + I G  W+K +GV Y    
Sbjct  258  LYYGEYMNKGPGAGTSKRVKWPGYHILSAAEATKFTVGQLIQGGVWLKSTGVAYTEGL  315



>ref|XP_011015792.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 45 [Populus euphratica]
Length=593

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNC I+ D D  PV+ KI+SYLGRPWKE+SRTIIMES I DFI P+GWLPW+ +F LK
Sbjct  475  VLQNCRIEPDKDLVPVKTKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQGEFGLK  534

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+G GA  T R+KW G   +      + T   F  G  WI  +G P
Sbjct  535  TLYYAEYNNKGAGAKTTARIKWPGYHIINNEEAMKLTAEPFYQG-DWISATGSP  587



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  DP Y PV+   KSYLGRPWK++SRTI+M++ I D I P GWL W  DFALK
Sbjct  446  VLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTMIDDVIDPAGWLAWSGDFALK  505

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TL+Y+E  N GPG+++ +RVKW GI++L       +T  +F+ G +WI  + VPY P
Sbjct  506  TLYYAEHLNTGPGSNQAQRVKWPGIRKLTPQDALLYTGDRFLGGNTWIPPTQVPYTP  562



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLD---F  540
            ++Q  +I ADP++ PVRF  KSYL RPWK +SRTIIM++FI D I P+G+LPW  +    
Sbjct  454  VIQGGSIVADPEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPI  513

Query  539  ALKTLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
             + T +Y E++N GPG+ K+KRVKW GI  + T   ++F P+KF  G  WIK +G+PY P
Sbjct  514  NMDTCYYVEYHNYGPGSDKSKRVKWAGIYNINTKAAQKFAPSKFFHGGDWIKDTGIPYYP  573



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P+Y PV+   K+YLGRPWK++SRTIIM + I D + P GWLPW   FAL 
Sbjct  451  VLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALN  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ N G G+ +++RVKW GIK+L      RFTPA+F+ G  WI  + VPY
Sbjct  511  TLYYAEYENNGLGSDQSQRVKWPGIKKLSPKQALRFTPARFLRGNLWIPPTRVPY  565



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  +P+Y PV+   K+YLGRPWK++SRTIIM + I D + P GWLPW   FAL 
Sbjct  451  VLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALN  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ N G G+ +++RVKW GIK+L      RFTPA+F+ G  WI  + VPY
Sbjct  511  TLYYAEYENNGLGSDQSQRVKWPGIKKLSPKQALRFTPARFLRGNLWIPPTRVPY  565



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L  C I  DP Y PV+   K+YLGRPWKE+SRTIIM++ I D I P GWLPW  DFALK
Sbjct  452  VLHGCHITGDPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALK  511

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E  N GPG+++ +RVKW GIK+L       +T  +F+ G +WI  + VPY
Sbjct  512  TLYYAEHMNTGPGSNQAQRVKWPGIKKLTPQDALLYTGDRFLRGDTWIPQTQVPY  566



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D   V+  +K+YLGRPWK YSRT+ M+S I D I PEGW  W  DFALKT
Sbjct  431  IQNCDIIATSDLASVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKT  490

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRVKW G   L      +FT ++ I G +W+K +GV Y    
Sbjct  491  LYYGEYMNKGPGAGTSKRVKWPGYHVLSASEATKFTVSQLIQGGAWLKSTGVAYTEGL  548



>ref|XP_006597897.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
isoform X1 [Glycine max]
 ref|XP_006597898.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
isoform X2 [Glycine max]
Length=654

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ C IKAD D  P++  IK+YLGRPWKEYSRTIIME+ I D I P+G+LPW+ +FAL 
Sbjct  535  VLQKCVIKADTDLVPLKDTIKNYLGRPWKEYSRTIIMETQIDDLIHPDGFLPWEGNFALS  594

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y E+NN G G+S T RV W G K +      R+T   F+ G +WI  +GVP
Sbjct  595  TLYYGEYNNNGAGSSTTARVNWPGRKVINRDEATRYTVEAFLQG-TWINGTGVP  647



>ref|XP_006587076.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like 
[Glycine max]
Length=573

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ C IKAD D  PV+ +IK+YLGRPWKEYSRTIIME+ I D I P+G+LPW+ +FAL 
Sbjct  454  VLQKCVIKADTDLVPVKDRIKNYLGRPWKEYSRTIIMETQIDDLIHPDGFLPWEGNFALS  513

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y E+NN G G+  T RV W G K +      R+T   F+ G +WI  +GVP
Sbjct  514  TLYYGEYNNNGAGSITTARVNWPGRKVINRDEATRYTVEAFLQG-TWINGTGVP  566



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  DP Y PV+   K+YLGRPWK++SRTIIM + I D I P+GWL W  +FAL 
Sbjct  452  VLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALD  511

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL Y+EF N+GPG+++  RVKW GIK+        FT  KF+ G +WI  + VPY
Sbjct  512  TLEYAEFENKGPGSNQATRVKWPGIKKFTPRQAGEFTAGKFLQGGTWIPQTQVPY  566



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++Q C I A  D  PVR    +YLGRPWKEYSRT++M+S I D IQP GW  W   FALK
Sbjct  463  VIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALK  522

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ N G GAS + RVKW G K + +    + FTP +FI G SW+  +G P+
Sbjct  523  TLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPF  578



>ref|XP_010932334.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=602

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L +C   AD    P + KI+SYLGRPWKEYSRT+IMES I DFI  +G++PW+ DFALK
Sbjct  478  VLHHCRFTADSKLVPDKDKIRSYLGRPWKEYSRTVIMESDIGDFIHKDGYMPWEGDFALK  537

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVP  369
            TLFY+E+ N+GPGA  + RV+W G K +        FTP  FI G+ WIK +G P
Sbjct  538  TLFYAEYKNKGPGADTSARVQWPGFKVISNRTEAVGFTPEVFIQGRDWIKRTGGP  592



>ref|XP_004299719.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Fragaria vesca subsp. vesca]
Length=566

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNCTI A  D     F +K+YLGRPWKEYSRT+ +++F+   I P GWL W  DFAL T
Sbjct  448  IQNCTITAADDLASSNFTVKTYLGRPWKEYSRTVYLQNFMDSLIDPAGWLAWSGDFALST  507

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y E++N+GPGA  + RV W G   +       FT + F+ G SW+  +GVPY    +
Sbjct  508  LYYGEYDNKGPGADTSNRVTWPGYHIIGATDASNFTVSNFVLGDSWLPQTGVPYTGGLM  566



>ref|XP_010107091.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
 gb|EXC13612.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
Length=607

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I AD   +PV+ +I+SYLGRPWKEYSRTI+MES I D I P+GWLPW+ DFAL 
Sbjct  487  VLHNCRILADRKLEPVKDRIRSYLGRPWKEYSRTIVMESTIHDVIHPDGWLPWQGDFALN  546

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPGA   KRV W G K + T     ++T   F+ G  W+   GVP
Sbjct  547  TLYYAEYNNKGPGAKVDKRVHWPGYKSVITREEALQYTVQNFLQG-DWVTVKGVP  600



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++Q C I A  D  PVR    +YLGRPWKEYSRT++M+S I D IQP GW  W   FALK
Sbjct  463  VIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALK  522

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ N G GAS + RVKW G K + +    + FTP +FI G SW+  +G P+
Sbjct  523  TLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPF  578



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++Q C I A  D  PVR    +YLGRPWKEYSRT++M+S I D IQP GW  W   FALK
Sbjct  463  VIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALK  522

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ N G GAS + RVKW G K + +    + FTP +FI G SW+  +G P+
Sbjct  523  TLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPF  578



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++Q C I A  D  PVR    +YLGRPWKEYSRT++M+S I D IQP GW  W   FALK
Sbjct  463  VIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALK  522

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ N G GAS + RVKW G K + +    + FTP +FI G SW+  +G P+
Sbjct  523  TLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPF  578



>gb|KHN45042.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine 
soja]
Length=323

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTIK+D    PV+  I+SYLGRPWKE+SRT++MES I DFI P+GW  W  +FALK
Sbjct  204  VLQKCTIKSDDSLVPVKDTIRSYLGRPWKEFSRTVVMESEIGDFIHPDGWTAWAGNFALK  263

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVP  369
            TL+Y+E+ N GPGAS   R+KW G + +      +FT   F+ G + I+++GVP
Sbjct  264  TLYYAEYANTGPGASTNARIKWPGYRVINKDEATQFTVGSFMKG-TLIQNTGVP  316



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  DP Y PV+   K+YLGRPWK++SRTIIM + I D I P+GWL W  +FAL 
Sbjct  465  VLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALD  524

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL Y+EF N+GPG+++  RVKW GIK+        FT  KF+ G +WI  + VPY
Sbjct  525  TLEYAEFENKGPGSNQATRVKWPGIKKFTPRQAGEFTAGKFLQGGTWIPQTQVPY  579



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L NC I  DP Y  V+   K+YLGRPWKE+SRTIIM++ I D I P GWLPWK DFALK
Sbjct  451  VLHNCHIMGDPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALK  510

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYN  363
            TL+Y+E  N GPG+++  RVKW GIK+L       +T  +F+ G +WI  + VPY+
Sbjct  511  TLYYAEHLNAGPGSNEALRVKWPGIKKLSPEEALLYTGGRFLVGDTWIPQTQVPYS  566



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++Q C I A  D  PVR    +YLGRPWKEYSRT++M+S I D IQP GW  W   FALK
Sbjct  463  VIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALK  522

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPY  366
            TLFY+E+ N G GAS + RVKW G K + +    + FTP +FI G SW+  +G P+
Sbjct  523  TLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPF  578



>ref|XP_007154534.1| hypothetical protein PHAVU_003G126700g [Phaseolus vulgaris]
 gb|ESW26528.1| hypothetical protein PHAVU_003G126700g [Phaseolus vulgaris]
Length=605

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ CTIKAD +   V+ K++SYLGRPWK YSRT++MES I D I P+GW  W  DFALK
Sbjct  486  VLQKCTIKADDELLTVKDKVRSYLGRPWKLYSRTVVMESEISDIIHPDGWTAWIGDFALK  545

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E+ N G G+S   R+KW G + +       FTP  F+ G SW++ +GVP    F
Sbjct  546  TLYYAEYGNTGAGSSTNARIKWPGYRVINKEEATMFTPGSFLRG-SWVQGTGVPSTQGF  603



>ref|XP_003591484.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591505.1| Pectinesterase [Medicago truncatula]
 gb|AES61735.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|KEH15892.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=315

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QN TIKA  D  P    +++YLGRPWKEYSRT+ M+SF+  FI P GW  W  DFAL T
Sbjct  197  IQNATIKAADDLAPKVGTVQTYLGRPWKEYSRTVFMQSFMDSFINPAGWHEWNGDFALNT  256

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E++NRG G+S   RV W G   +       FT + F++G  WI  +GVPY+   I
Sbjct  257  LYYAEYSNRGAGSSTVNRVTWPGYHVIGATDAANFTVSNFLSGDDWIPQTGVPYSSGLI  315



>emb|CAC09455.2| H0423H10.1 [Oryza sativa Indica Group]
Length=717

 Score =   134 bits (336),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ+C I  +    PVR +I SYLGRPWKEY+RT++MES I DFI+PEGW  W  D  LK
Sbjct  597  VLQDCRIVPEQALFPVRLQIASYLGRPWKEYARTVVMESVIGDFIKPEGWSEWMGDVGLK  656

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+E+ N GPGA  +KRV W G + +      +FT   FI G +W+K++  P    F+
Sbjct  657  TLYYAEYANTGPGAGTSKRVTWPGYRVIGQAEATQFTAGVFIDGLTWLKNTATPNVMGFV  716



>gb|AAL66865.1| pectin methylesterase [Orobanche cernua var. cumana]
Length=159

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 70/118 (59%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
             Q CTIKA  D     F + +YLGRPWKEYSRT+ M+SF+   + P GW  W  DFAL T
Sbjct  39   FQKCTIKAADDLASSNFTVLTYLGRPWKEYSRTVYMQSFMGSLVHPAGWSVWSGDFALNT  98

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
             +Y+EFNN GPG+S + RV W G   +       FT + F++G  WI  +GVPY    
Sbjct  99   SYYAEFNNSGPGSSTSGRVTWPGFHVINAAEAANFTVSAFLSGDVWIPQTGVPYTSGL  156



>ref|XP_007222797.1| hypothetical protein PRUPE_ppa003578mg [Prunus persica]
 gb|EMJ23996.1| hypothetical protein PRUPE_ppa003578mg [Prunus persica]
Length=564

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NCTIK   D     F +K+YLGRPWKEYSRT+ M++F+  FI P GW  W  DFAL T
Sbjct  446  IHNCTIKPAADLASSNFTVKTYLGRPWKEYSRTVYMQTFMDSFIDPAGWHDWSGDFALST  505

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+NN GPG+S   RV W G   + +     FT + F+ G +W+  +GVPY    I
Sbjct  506  LYYAEYNNTGPGSSTANRVTWSGYHVINSTDAANFTVSNFLLGDNWLPQTGVPYTGGLI  564



>ref|XP_004299718.2| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=575

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNCTI A  D     F +K+YLGRPWKEYSRT+ +++F+   I P GWL W  DFAL T
Sbjct  457  IQNCTITAAADLASSNFTVKTYLGRPWKEYSRTVYLQNFMDSLIDPVGWLEWDGDFALST  516

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E++NRGPG++ + RV W G   +       FT + F+ G +W+  +GVPY    +
Sbjct  517  LYYAEYDNRGPGSNTSSRVTWPGYHIIGATDAANFTVSNFLVGDNWLPQTGVPYTGGLV  575



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 11/121 (9%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P RFK KSYLGRPWK YSR +IMES + DFIQP GWL W  +FAL 
Sbjct  447  VIQNCRIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIK------RFTPAKFITGKSWIKHSGVP  369
            TL+++E+ NRGPGA    RV+W G      H+I+      +FT   F+ G  W++++GVP
Sbjct  507  TLYFAEYGNRGPGAVTNGRVRWKGF-----HVIRNRNEALQFTAGPFLLGDQWLRNTGVP  561

Query  368  Y  366
            Y
Sbjct  562  Y  562



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++    I  DP Y PV+ K ++YLGRPWKEYSRT+IM S I D I PEGW+ W   FAL 
Sbjct  468  VIHKSRIMGDPTYLPVKTKNRAYLGRPWKEYSRTVIMNSLIDDIIDPEGWMKWNETFALD  527

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ N GPG+ +  RV+W+GI+ L      ++TP  F+ G +WI  + VPY
Sbjct  528  TLYYAEYQNTGPGSDQAGRVRWNGIQHLSDSAATQYTPDNFLRGNTWIPKTRVPY  582



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I+A+ ++   +  IK+YLGRPWKE+SRTIIM+S I  FI P+GW  W  DFAL 
Sbjct  432  VMQNCEIRAEHEFISTQPTIKAYLGRPWKEFSRTIIMQSLIDGFIDPQGWSVWAGDFALH  491

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKE-LPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TLFY+E+ NRG GA+   RV W G K+ +   I   F P  FI    W++ SGVPY    
Sbjct  492  TLFYAEYENRGIGANSNNRVNWRGYKKNIGKEIAAGFAPGVFILADEWVRLSGVPYESGL  551

Query  353  I  351
            +
Sbjct  552  M  552



>ref|XP_007222606.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
 gb|EMJ23805.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
Length=568

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 11/121 (9%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P RFK KSYLGRPWK YSR +IMES + DFIQP GWL W  +FAL 
Sbjct  447  VIQNCRIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALD  506

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIK------RFTPAKFITGKSWIKHSGVP  369
            TL+++E+ NRGPGA    RV+W G      H+I+      +FT   F+ G  W++++GVP
Sbjct  507  TLYFAEYGNRGPGAVTNGRVRWKGF-----HVIRNRNEALQFTTGPFLLGDQWLRNTGVP  561

Query  368  Y  366
            Y
Sbjct  562  Y  562



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            IL+NC I A+P +   +  IK+YLGRPWKEYSRTIIM+S I  FI PEGW PW  +FAL 
Sbjct  433  ILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRTIIMQSQIDAFIDPEGWAPWNGNFALN  492

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKE-LPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E+ NRGPGA+  +RVKW G K+ +     +++ P  FI   SWIK +G+ Y
Sbjct  493  TLYYAEYQNRGPGANTDRRVKWAGYKKSISPQEAEKYAPNIFIDQDSWIKKTGISY  548



>gb|AGR44472.1| pectin methylesterase 3 [Pyrus x bretschneideri]
Length=564

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NCTI   PD     + +++YLGRPWKEYSRT+ M++F+   I P GWL W  DFAL T
Sbjct  446  IHNCTITPTPDLASSNYTVQTYLGRPWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALST  505

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+NN GPG++ T RV W G   +   +   FT + F+ G +W+  +GVPY    +
Sbjct  506  LYYAEYNNTGPGSNTTNRVTWPGYHVINATVAANFTVSNFLLGDNWLPDTGVPYTGGLV  564



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC +    D  PV+  IK+YLGRPWKEYSRT++M+S I + I PEGW  W  DFALKT
Sbjct  430  IQNCDVIPSSDLAPVKGSIKTYLGRPWKEYSRTVVMQSNIDNHIVPEGWSVWSGDFALKT  489

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHI-IKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ NRGPGA  + RVKW G   + +     +FT A+ I G  W+K++GV Y    
Sbjct  490  LYYGEYQNRGPGAGTSGRVKWPGYHVITSAAEASKFTVAQLIQGGEWLKNTGVAYTEGL  548



>ref|XP_002275000.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=570

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P RFK  SYLGRPWK YSRT++MES + DFI P GWLPW  +FAL 
Sbjct  448  VIQNCRIVPEEKLFPTRFKTPSYLGRPWKAYSRTVVMESTMGDFIHPAGWLPWMGNFALD  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E+ N+GPGA+  +RVKW G K +   +   +FT   FI G  W++ +G PY   F
Sbjct  508  TLYYAEYANKGPGANTAQRVKWKGYKVITNRNEALQFTAGPFIQGNEWLRLTGAPYFLGF  567



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L  C I  DP Y P++   K+YLGRPWKE+SRTIIM++ I D I P GWLPW  DFALK
Sbjct  444  VLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALK  503

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E  N GPG+++ +RVKW GIK+L       +T  +F+ G +WI  + VPY
Sbjct  504  TLYYAEHMNTGPGSNQAQRVKWPGIKKLTPQDALLYTGDRFLRGDTWIPQTQVPY  558



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L  C I  DP Y P++   K+YLGRPWKE+SRTIIM++ I D I P GWLPW  DFALK
Sbjct  450  VLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALK  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E  N GPG+++ +RVKW GIK+L       +T  +F+ G +WI  + VPY
Sbjct  510  TLYYAEHMNTGPGSNQAQRVKWPGIKKLTPQDALLYTGDRFLRGDTWIPQTQVPY  564



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +L  C I  DP Y P++   K+YLGRPWKE+SRTIIM++ I D I P GWLPW  DFALK
Sbjct  450  VLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALK  509

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            TL+Y+E  N GPG+++ +RVKW GIK+L       +T  +F+ G +WI  + VPY
Sbjct  510  TLYYAEHMNTGPGSNQAQRVKWPGIKKLTPQDALLYTGDRFLRGDTWIPQTQVPY  564



>ref|XP_009771261.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=547

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC I A  D  P++  +K+YLGRPWK YSRT+ M+S I D I PEGW  W  DFALKT
Sbjct  430  IQNCDIIATSDLAPLKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKT  489

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            L+Y E+ N+GPGA  +KRVKW G   L      +FT  + I G  W+K +GV Y    
Sbjct  490  LYYGEYMNKGPGAGISKRVKWPGYHILSASEATKFTVGQLIQGGVWLKSTGVAYTEGL  547



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQNCTI   PDY PV+   K+YLGRPWK+++R+IIM+S I D IQPEG+ P      + 
Sbjct  439  VLQNCTISGAPDYIPVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGID  498

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            T F +EF NRGPGA   +RV W GIK++  +   ++TP  ++  ++WI  S VPY+P  +
Sbjct  499  TSFIAEFGNRGPGADTNRRVAWKGIKKIDINEANKWTPRVYLESETWISSSDVPYSPDMV  558



>emb|CBI26012.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            ++QNC I  +    P RFK  SYLGRPWK YSRT++MES + DFI P GWLPW  +FAL 
Sbjct  448  VIQNCRIVPEEKLFPTRFKTPSYLGRPWKAYSRTVVMESTMGDFIHPAGWLPWMGNFALD  507

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPT-HIIKRFTPAKFITGKSWIKHSGVPYNPAF  354
            TL+Y+E+ N+GPGA+  +RVKW G K +   +   +FT   FI G  W++ +G PY   F
Sbjct  508  TLYYAEYANKGPGANTAQRVKWKGYKVITNRNEALQFTAGPFIQGNEWLRLTGAPYFLGF  567



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 11/124 (9%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +Q+C I A  D +PV+   KSYLGRPWKEYSRT++M+S I D I P GW  W  DFALKT
Sbjct  359  IQSCNIIASSDLEPVKGSFKSYLGRPWKEYSRTVVMQSHIGDHIDPSGWSVWTGDFALKT  418

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHII------KRFTPAKFITGKSWIKHSGVPY  366
            L+Y E+ N+GPGA  +KRVKW G      H+I      K+FT A  I G SW+K +GV +
Sbjct  419  LYYGEYMNKGPGAGTSKRVKWPGY-----HVITSADEAKKFTVAGLIQGGSWLKPTGVTF  473

Query  365  NPAF  354
                
Sbjct  474  TEGL  477



>dbj|BAF95866.1| pectin methylesterase isoform alpha [Vitis hybrid cultivar]
Length=234

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 77/123 (63%), Gaps = 3/123 (2%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QNC + A  D  PV    KSYLGRPWKEYSRT+ M+S I D I P GWL W  DFAL T
Sbjct  81   IQNCKVAAAADLIPVLSSFKSYLGRPWKEYSRTVYMQSNIGDLIDPAGWLEWDGDFALST  140

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKEL-PTHIIKRFTPAKFITGKSWIKHSGVPY--NPA  357
            L+Y E+ NRGPG++ + RV W G + +  + +  +FT   FI G  W+  +G+PY  N  
Sbjct  141  LYYGEYKNRGPGSNTSGRVTWPGYRVINSSSVASQFTVGAFIQGDEWLPATGIPYYSNLT  200

Query  356  FIY  348
             +Y
Sbjct  201  IVY  203



>emb|CDP19930.1| unnamed protein product [Coffea canephora]
Length=592

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ C I AD    PV+ + KSYLGRPWKEYSRTIIME+ I DFI  +G++PW+ +FAL 
Sbjct  471  VLQGCRILADASLSPVKSQFKSYLGRPWKEYSRTIIMETEIGDFIHGDGYMPWQGNFALN  530

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKR-----FTPAKFITGKSWIKHSGVP  369
            TL+Y+E+NN+GPGA  + RVKW G K L    IKR     +T   FI G+ W+K   VP
Sbjct  531  TLYYAEYNNKGPGAQTSARVKWPGYKGL----IKRDEALKYTVGPFIQGEGWLKVDNVP  585



>gb|EAY95754.1| hypothetical protein OsI_17629 [Oryza sativa Indica Group]
Length=971

 Score =   134 bits (336),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ+C I  +    PVR +I SYLGRPWKEY+RT++MES I DFI+PEGW  W  D  LK
Sbjct  851  VLQDCRIVPEQALFPVRLQIASYLGRPWKEYARTVVMESVIGDFIKPEGWSEWMGDVGLK  910

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+E+ N GPGA  +KRV W G + +      +FT   FI G +W+K++  P    F+
Sbjct  911  TLYYAEYANTGPGAGTSKRVTWPGYRVIGQAEATQFTAGVFIDGLTWLKNTATPNVMGFV  970



>emb|CAH68135.1| B0414F07.5 [Oryza sativa Indica Group]
Length=971

 Score =   134 bits (336),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ+C I  +    PVR +I SYLGRPWKEY+RT++MES I DFI+PEGW  W  D  LK
Sbjct  851  VLQDCRIVPEQALFPVRLQIASYLGRPWKEYARTVVMESVIGDFIKPEGWSEWMGDVGLK  910

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+E+ N GPGA  +KRV W G + +      +FT   FI G +W+K++  P    F+
Sbjct  911  TLYYAEYANTGPGAGTSKRVTWPGYRVIGQAEATQFTAGVFIDGLTWLKNTATPNVMGFV  970



>ref|NP_001054042.1| Os04g0641200 [Oryza sativa Japonica Group]
 emb|CAE05961.1| OSJNBa0063C18.2 [Oryza sativa Japonica Group]
 emb|CAE02974.2| OSJNBb0079B02.7 [Oryza sativa Japonica Group]
 dbj|BAF15956.1| Os04g0641200 [Oryza sativa Japonica Group]
 gb|EAZ32161.1| hypothetical protein OsJ_16366 [Oryza sativa Japonica Group]
Length=971

 Score =   134 bits (336),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            +LQ+C I  +    PVR +I SYLGRPWKEY+RT++MES I DFI+PEGW  W  D  LK
Sbjct  851  VLQDCRIVPEQALFPVRLQIASYLGRPWKEYARTVVMESVIGDFIKPEGWSEWMGDVGLK  910

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            TL+Y+E+ N GPGA  +KRV W G + +      +FT   FI G +W+K++  P    F+
Sbjct  911  TLYYAEYANTGPGAGTSKRVTWPGYRVIGQAEATQFTAGVFIDGLTWLKNTATPNVMGFV  970



>gb|EMT19669.1| Putative pectinesterase/pectinesterase inhibitor 21 [Aegilops 
tauschii]
Length=1079

 Score =   134 bits (336),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = -1

Query  710   ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
             +LQ C I  +    PVR  + SYLGRPWKEYSRT+IMES I D I+PEGW  W  D  LK
Sbjct  959   VLQGCKIVPEDALFPVRQTVPSYLGRPWKEYSRTVIMESTIGDLIKPEGWSEWMGDLGLK  1018

Query  530   TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
             TL+Y+E+ N GPGA  +KRV W G + +      +FT   FI G SW+K++G P    FI
Sbjct  1019  TLYYAEYANTGPGAGTSKRVTWPGYRVIGQAEATQFTAGVFIDGMSWLKNTGTPNVMGFI  1078



>ref|XP_006828613.1| hypothetical protein AMTR_s00129p00074780 [Amborella trichopoda]
 gb|ERM96029.1| hypothetical protein AMTR_s00129p00074780 [Amborella trichopoda]
Length=671

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NC I A  D  PV+  I +YLGRPW+E+SRT+IM+SF+ D I+P GWL W  +FALK+
Sbjct  551  IHNCKITAASDLVPVKSSIPTYLGRPWQEFSRTVIMQSFLDDLIRPAGWLEWSGNFALKS  610

Query  527  LFYSEFNNRGPGASKTKRVKWHGIK-ELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y E+ N+GPGA  + RV+W G K EL      +FT A+FI+G SW+  +GV ++   I
Sbjct  611  LYYGEYMNKGPGAGLSDRVRWPGYKGELTVDDATKFTVAQFISGNSWLPATGVSFDSGLI  670



>ref|XP_010556727.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Tarenaya hassleriana]
Length=566

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            + NCTIK   D     F +K+YLGRPWKEYSRT+ M+S+I  F++P GW  W  DFAL T
Sbjct  447  IHNCTIKPADDLVASNFTVKTYLGRPWKEYSRTVYMQSYIDGFVEPVGWREWNGDFALST  506

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPY  366
            L+Y+E+NN GPG++ T RV W G   + +     FT + F+ G  WI  SGVPY
Sbjct  507  LYYAEYNNTGPGSNTTNRVNWPGYHVINSTDAANFTVSSFLLGDDWILQSGVPY  560



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -1

Query  710  ILQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALK  531
            IL NC I  DP Y PV+   K+YLGRPWKE+SRTIIM + I D I P+GWL W  +FAL 
Sbjct  453  ILHNCRIMGDPAYIPVKSTNKAYLGRPWKEFSRTIIMRTTIDDIIDPKGWLEWNGNFALD  512

Query  530  TLFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNP  360
            TL Y E+ N G G+ +  RVKW GIK+L      +FT  +F+ G +WI    VPY P
Sbjct  513  TLEYGEYENNGSGSGQEMRVKWPGIKKLSARQALQFTAGRFLRGNTWIPRRRVPYTP  569



>ref|XP_003591498.1| Pectinesterase [Medicago truncatula]
Length=335

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  707  LQNCTIKADPDYDPVRFKIKSYLGRPWKEYSRTIIMESFIPDFIQPEGWLPWKLDFALKT  528
            +QN TIKA  D  P    +++YLGRPWKEYSRT+ M+SF   FI P GW  W  DFAL T
Sbjct  217  IQNATIKAADDLAPKVGTVQTYLGRPWKEYSRTVFMQSFTDSFINPAGWHEWNGDFALNT  276

Query  527  LFYSEFNNRGPGASKTKRVKWHGIKELPTHIIKRFTPAKFITGKSWIKHSGVPYNPAFI  351
            L+Y+E+ NRG G+S   RV W G   +       FT + F++G  WI  +GVPY+   I
Sbjct  277  LYYAEYGNRGAGSSTVNRVTWPGYHVIGATDAANFTVSNFLSGDDWIPQTGVPYSSGLI  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365