BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004I13

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABN11121.1|  MYB transcription factor                              63.9    8e-09   Capsicum annuum
gb|ABV02032.1|  sucrose responsive element binding factor 2           61.6    2e-08   Nicotiana langsdorffii x Nicotiana sanderae
gb|AAR83899.1|  tuber-specific protein                                62.8    2e-08   Capsicum annuum
ref|XP_010315996.1|  PREDICTED: transcription factor MYB44-like       62.8    2e-08   Solanum lycopersicum
ref|XP_006339846.1|  PREDICTED: transcription factor MYB44-like       62.8    2e-08   
gb|AAG08959.1|AF122051_1  tuber-specific and sucrose-responsive e...  62.4    2e-08   Solanum tuberosum [potatoes]
ref|XP_009588514.1|  PREDICTED: transcription factor MYB44            62.0    4e-08   Nicotiana tomentosiformis
ref|XP_009798591.1|  PREDICTED: transcription factor MYB44            60.8    9e-08   Nicotiana sylvestris
ref|XP_011099313.1|  PREDICTED: transcription factor MYB44-like       59.7    2e-07   Sesamum indicum [beniseed]
gb|EYU44445.1|  hypothetical protein MIMGU_mgv1a013426mg              56.6    1e-06   Erythranthe guttata [common monkey flower]
emb|CDP02540.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
emb|CBI33769.3|  unnamed protein product                              51.2    2e-05   Vitis vinifera
ref|XP_011097391.1|  PREDICTED: transcription factor MYB44            50.8    3e-04   
ref|NP_001268121.1|  sucrose responsive element binding protein       50.4    3e-04   Vitis vinifera
ref|XP_010095320.1|  Transcription factor                             50.1    4e-04   



>gb|ABN11121.1| MYB transcription factor [Capsicum annuum]
Length=345

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            QQD++F+PFSQELL VMQ+MIKTEVRNYMMG+E
Sbjct  258  QQDKIFVPFSQELLRVMQEMIKTEVRNYMMGIE  290



>gb|ABV02032.1| sucrose responsive element binding factor 2 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=232

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 62/103 (60%), Gaps = 16/103 (16%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVEqqqqppsppqqqryhqhhqqqqqqfqf  262
            QQD+VF+PFSQELL VMQ+MIK EVRNYM+G+E         Q Q+  Q    QQQQ   
Sbjct  143  QQDKVFVPFSQELLGVMQEMIKAEVRNYMVGIE-------QQQFQQQQQQRYHQQQQQFQ  195

Query  261  qqqqqlQNGIGRGMCMQPATSNHGLRYaaaaaaaATVNRVGVN  133
            QQ  Q+ +GIG G+CMQ AT   G R           NR+GV+
Sbjct  196  QQNHQMPSGIGLGLCMQQAT--DGFRNTG-------ANRMGVS  229



>gb|AAR83899.1| tuber-specific protein [Capsicum annuum]
Length=344

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            Q D+VF+PFSQELL VMQ+MIKTEVRNYMMGVE
Sbjct  255  QPDKVFVPFSQELLGVMQEMIKTEVRNYMMGVE  287



>ref|XP_010315996.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=372

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            Q D+VF+PFSQELL VMQ+MIKTEVRNYMMGVE
Sbjct  284  QPDKVFVPFSQELLGVMQEMIKTEVRNYMMGVE  316



>ref|XP_006339846.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=371

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            Q D+VF+PFSQELL VMQ+MIKTEVRNYMMGVE
Sbjct  282  QPDKVFVPFSQELLGVMQEMIKTEVRNYMMGVE  314



>gb|AAG08959.1|AF122051_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=364

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            Q D+VF+PFSQELL VMQ+MIKTEVRNYMMGVE
Sbjct  275  QPDKVFVPFSQELLGVMQEMIKTEVRNYMMGVE  307



>ref|XP_009588514.1| PREDICTED: transcription factor MYB44 [Nicotiana tomentosiformis]
Length=361

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 7/80 (9%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVEqqqqppsppqqqryhqhhqqqqqqfqf  262
            QQD+VF+PFSQELL VMQ+MIK EVRNYM+G+E         Q Q+  Q  + QQQQ   
Sbjct  272  QQDKVFVPFSQELLGVMQEMIKAEVRNYMVGIE-------QQQFQQQQQQQRYQQQQQFQ  324

Query  261  qqqqqlQNGIGRGMCMQPAT  202
            QQ  Q+ +GIG G+CMQ AT
Sbjct  325  QQNHQMPSGIGLGLCMQQAT  344



>ref|XP_009798591.1| PREDICTED: transcription factor MYB44 [Nicotiana sylvestris]
Length=357

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 7/80 (9%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVEqqqqppsppqqqryhqhhqqqqqqfqf  262
            +QD+VF+PFSQELL VMQ+MIK EVRNYM+GVE         Q Q+  Q    Q+QQ   
Sbjct  268  EQDKVFVPFSQELLGVMQEMIKAEVRNYMVGVE-------QQQFQQQQQQQCYQRQQQFQ  320

Query  261  qqqqqlQNGIGRGMCMQPAT  202
            QQ  Q+ +GIG G+CMQ AT
Sbjct  321  QQNHQMPSGIGLGLCMQQAT  340



>ref|XP_011099313.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=360

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  450  VPAQQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            +P +QD++F+PFS EL+AVMQDMI+ EVRNYM G E
Sbjct  288  LPQEQDKIFMPFSAELMAVMQDMIRAEVRNYMAGFE  323



>gb|EYU44445.1| hypothetical protein MIMGU_mgv1a013426mg [Erythranthe guttata]
Length=220

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  441  QQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            Q D VF+PF  EL+AVMQ+MIK+EVRNYMMG+E
Sbjct  136  QPDNVFVPFGAELMAVMQEMIKSEVRNYMMGLE  168



>emb|CDP02540.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  438  QDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            QD+VF+PF+ ELLAVMQ+MI+ EVRNYMMG+E
Sbjct  278  QDKVFVPFTGELLAVMQEMIRNEVRNYMMGME  309



>emb|CBI33769.3| unnamed protein product [Vitis vinifera]
Length=118

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -2

Query  444  AQQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            +Q ++ F+PFS ELLAVMQ+MI+ EVRNYM G+E
Sbjct  60   SQGEKPFIPFSAELLAVMQEMIRKEVRNYMAGLE  93



>ref|XP_011097391.1| PREDICTED: transcription factor MYB44 [Sesamum indicum]
Length=385

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 5/35 (14%)
 Frame = -2

Query  447  PAQQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            PAQ     +PFS EL+AVMQDMI+ EVRNYMMG+E
Sbjct  263  PAQ-----MPFSAELMAVMQDMIRAEVRNYMMGLE  292



>ref|NP_001268121.1| sucrose responsive element binding protein [Vitis vinifera]
 gb|AAY28930.1| sucrose responsive element binding protein [Vitis vinifera]
Length=312

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  444  AQQDRVFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
            +Q ++ F+PFS ELLAVMQ+MI+ EVRNY  G+E
Sbjct  254  SQGEKPFIPFSAELLAVMQEMIRKEVRNYTAGLE  287



>ref|XP_010095320.1| Transcription factor [Morus notabilis]
 gb|EXB59531.1| Transcription factor [Morus notabilis]
Length=304

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  429  VFLPFSQELLAVMQDMIKTEVRNYMMGVE  343
             F+PFSQELLAVMQ+MI+ EVR+YM G+E
Sbjct  248  AFVPFSQELLAVMQEMIRKEVRSYMAGLE  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800