BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004I05

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99712.1|  unnamed protein product                                256   8e-86   Coffea canephora [robusta coffee]
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic             253   4e-84   Gossypium arboreum [tree cotton]
gb|KJB57700.1|  hypothetical protein B456_009G176400                    252   9e-84   Gossypium raimondii
gb|KDP39066.1|  hypothetical protein JCGZ_00823                         245   1e-83   Jatropha curcas
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...    246   3e-83   
gb|KJB67127.1|  hypothetical protein B456_010G176000                    249   5e-83   Gossypium raimondii
gb|KJB57703.1|  hypothetical protein B456_009G176400                    250   5e-83   Gossypium raimondii
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                     246   5e-83   Eucalyptus grandis [rose gum]
ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...    247   6e-83   Sesamum indicum [beniseed]
gb|KJB13600.1|  hypothetical protein B456_002G083700                    244   7e-83   Gossypium raimondii
gb|ADG27845.1|  thiazole biosynthetic enzyme                            244   8e-83   Gossypium hirsutum [American cotton]
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...    249   8e-83   Vitis vinifera
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...    246   1e-82   Populus euphratica
ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...    246   1e-82   Sesamum indicum [beniseed]
emb|CBI23176.3|  unnamed protein product                                249   1e-82   Vitis vinifera
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic             244   2e-82   Gossypium arboreum [tree cotton]
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g             248   2e-82   Populus trichocarpa [western balsam poplar]
emb|CAN74175.1|  hypothetical protein VITISV_019223                     248   3e-82   Vitis vinifera
emb|CDY47441.1|  BnaC09g31160D                                          245   3e-82   Brassica napus [oilseed rape]
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...    244   4e-82   Populus euphratica
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic             246   5e-82   Gossypium arboreum [tree cotton]
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...    241   5e-82   Ricinus communis
gb|AFM35683.1|  thiamin biosynthetic protein                            248   7e-82   Vitis pseudoreticulata
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...    239   7e-82   Cicer arietinum [garbanzo]
gb|KEH43920.1|  thiazole biosynthetic enzyme                            247   7e-82   Medicago truncatula
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...    244   1e-81   Brassica rapa
gb|AFK49632.1|  unknown                                                 243   1e-81   Lotus japonicus
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...    245   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                       244   1e-81   
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg             245   1e-81   Eutrema salsugineum [saltwater cress]
emb|CDY28754.1|  BnaA02g09460D                                          243   2e-81   Brassica napus [oilseed rape]
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...    241   2e-81   Elaeis guineensis
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...    243   2e-81   Brassica rapa
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g             241   3e-81   Phaseolus vulgaris [French bean]
emb|CDY43024.1|  BnaA03g11710D                                          242   3e-81   Brassica napus [oilseed rape]
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g             244   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g             238   3e-81   Populus trichocarpa [western balsam poplar]
dbj|BAA88226.1|  thiamin biosynthetic enzyme                            237   4e-81   Glycine max [soybeans]
emb|CDY41008.1|  BnaA02g27980D                                          242   4e-81   Brassica napus [oilseed rape]
gb|AAW66657.1|  thiamine biosynthetic enzyme                            241   4e-81   Picrorhiza kurrooa
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...    238   6e-81   Cicer arietinum [garbanzo]
gb|AAV92531.1|  thiazole biosynthetic enzyme                            242   6e-81   Pseudotsuga menziesii var. menziesii
gb|AFK44470.1|  unknown                                                 244   6e-81   Medicago truncatula
gb|AAV92529.1|  thiazole biosynthetic enzyme                            242   6e-81   Pseudotsuga menziesii var. menziesii
gb|AAV92537.1|  thiazole biosynthetic enzyme                            242   6e-81   Pseudotsuga menziesii var. menziesii
gb|AAV92552.1|  thiazole biosynthetic enzyme                            242   7e-81   Pseudotsuga menziesii var. menziesii
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg                246   7e-81   Erythranthe guttata [common monkey flower]
gb|AAV92538.1|  thiazole biosynthetic enzyme                            241   8e-81   Pseudotsuga menziesii var. menziesii
ref|NP_001236824.1|  thiamin biosynthetic enzyme                        236   9e-81   
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...    241   9e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN47860.1|  Thiamine thiazole synthase 2, chloroplastic             236   1e-80   Glycine soja [wild soybean]
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...    240   1e-80   Glycine max [soybeans]
gb|ABK95834.1|  unknown                                                 242   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...    240   2e-80   Brassica rapa
gb|AAV92539.1|  thiazole biosynthetic enzyme                            242   2e-80   Pseudotsuga menziesii var. menziesii
emb|CDY52570.1|  BnaC03g71780D                                          239   2e-80   Brassica napus [oilseed rape]
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...    239   2e-80   Glycine max [soybeans]
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...    243   3e-80   Phoenix dactylifera
gb|AAV92535.1|  thiazole biosynthetic enzyme                            242   3e-80   Pseudotsuga menziesii var. menziesii
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg             255   5e-80   Citrus clementina [clementine]
gb|ABK23376.1|  unknown                                                 241   6e-80   Picea sitchensis
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...    238   6e-80   Tarenaya hassleriana [spider flower]
gb|EPS63253.1|  hypothetical protein M569_11533                         239   6e-80   Genlisea aurea
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                    239   6e-80   Arabis alpina [alpine rockcress]
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...    255   8e-80   Citrus sinensis [apfelsine]
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                       235   9e-80   Medicago truncatula
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...    239   1e-79   Cicer arietinum [garbanzo]
gb|AFK46185.1|  unknown                                                 235   1e-79   Medicago truncatula
emb|CDP05793.1|  unnamed protein product                                237   1e-79   Coffea canephora [robusta coffee]
gb|AFK48432.1|  unknown                                                 232   1e-79   Lotus japonicus
gb|ABK21260.1|  unknown                                                 239   2e-79   Picea sitchensis
gb|KHN15802.1|  Thiamine thiazole synthase 2, chloroplastic             237   2e-79   Glycine soja [wild soybean]
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...    235   4e-79   Oryza brachyantha
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614             239   4e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    237   6e-79   Populus euphratica
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg             239   9e-79   Capsella rubella
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...    236   9e-79   Phoenix dactylifera
ref|NP_001059841.1|  Os07g0529600                                       234   9e-79   
dbj|BAC45141.1|  putative thiamine biosynthesis protein                 234   1e-78   Oryza sativa Japonica Group [Japonica rice]
gb|AAV92554.1|  thiazole biosynthetic enzyme                            242   1e-78   Pseudotsuga menziesii var. menziesii
gb|EAZ04139.1|  hypothetical protein OsI_26282                          234   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...    238   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002             241   1e-78   Selaginella moellendorffii
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429             241   1e-78   
ref|NP_200288.1|  thiazole biosynthetic enzyme                          239   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...    235   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU27823.1|  hypothetical protein MIMGU_mgv1a009995mg                239   3e-78   Erythranthe guttata [common monkey flower]
emb|CAJ91138.1|  thiamin biosynthetic enzyme                            244   3e-78   Platanus x hispanica [London plane tree]
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...    237   3e-78   
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...    236   4e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...    231   4e-78   Nicotiana tomentosiformis
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...    231   5e-78   Nicotiana sylvestris
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...    231   5e-78   Solanum lycopersicum
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...    236   5e-78   Brachypodium distachyon [annual false brome]
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         235   8e-78   
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...    229   8e-78   Vitis vinifera
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...    230   9e-78   Setaria italica
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...    230   1e-77   Solanum tuberosum [potatoes]
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...    228   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290          231   1e-77   Amborella trichopoda
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         235   1e-77   Triticum urartu
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein      230   1e-77   Nicotiana tabacum [American tobacco]
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...    227   2e-77   
ref|NP_001236812.1|  thiamin biosynthetic enzyme                        225   3e-77   Glycine max [soybeans]
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...    233   3e-77   Setaria italica
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...    230   3e-77   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAA88225.1|  thiamin biosynthetic enzyme                            225   3e-77   Glycine max [soybeans]
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...    229   5e-77   Fragaria vesca subsp. vesca
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...    229   5e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010105570.1|  Thiamine thiazole synthase 2                       246   6e-77   
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...    227   1e-76   Fragaria vesca subsp. vesca
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family                227   2e-76   Saccharum hybrid cultivar R570
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family                227   2e-76   Saccharum hybrid cultivar R570
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family                227   2e-76   Saccharum hybrid cultivar R570
gb|KHN46540.1|  Thiamine thiazole synthase 2, chloroplastic             223   2e-76   Glycine soja [wild soybean]
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg                226   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...    244   3e-76   Theobroma cacao [chocolate]
gb|AGT17015.1|  thiazole biosynthetic enzyme                            227   4e-76   Saccharum hybrid cultivar R570
gb|AHA84206.1|  thiamin biosynthetic enzyme                             223   4e-76   Phaseolus vulgaris [French bean]
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic          242   7e-76   Citrus sinensis [apfelsine]
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...    242   7e-76   Alnus glutinosa
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g             222   9e-76   Phaseolus vulgaris [French bean]
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family                227   9e-76   Saccharum hybrid cultivar R570
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    221   1e-75   
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                   241   2e-75   Citrus sinensis [apfelsine]
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg             241   2e-75   Prunus persica
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg             241   2e-75   Citrus clementina [clementine]
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...    224   3e-75   Beta vulgaris subsp. vulgaris [field beet]
gb|AFO59577.1|  thiamine biosynthetic enzyme                            223   3e-75   Saccharum hybrid cultivar GT28
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    225   4e-75   
gb|ACN66755.1|  thiazole biosynthetic enzyme                            236   1e-74   Carica papaya [mamon]
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic             222   2e-74   Genlisea aurea
ref|XP_001767495.1|  predicted protein                                  229   3e-74   
ref|XP_001753819.1|  predicted protein                                  229   3e-74   
ref|XP_001767548.1|  predicted protein                                  229   3e-74   
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...    236   4e-74   Prunus mume [ume]
ref|XP_001755171.1|  predicted protein                                  226   1e-73   
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...    222   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001753698.1|  predicted protein                                  224   5e-73   
emb|CCJ09780.1|  putative thiazole biosynthetic enzyme                  232   2e-72   Hirudo medicinalis
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                   209   9e-71   Citrus sinensis [apfelsine]
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg             208   1e-70   
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060          226   3e-70   Sorghum bicolor [broomcorn]
gb|ACF87708.1|  unknown                                                 226   3e-70   Zea mays [maize]
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8           226   3e-70   Oryza sativa Indica Group [Indian rice]
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...    226   4e-70   
gb|ACF85034.1|  unknown                                                 228   4e-70   Zea mays [maize]
gb|ACF85447.1|  unknown                                                 223   4e-70   Zea mays [maize]
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...    228   5e-70   Zea mays [maize]
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...    222   8e-70   Cucumis sativus [cucumbers]
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...    221   1e-69   Cucumis melo [Oriental melon]
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520          226   2e-69   Sorghum bicolor [broomcorn]
gb|AHN11672.1|  thiamin biosynthetic enzyme                             199   3e-68   Phaseolus vulgaris [French bean]
gb|AGZ80417.1|  thiamin biosynthetic enzyme                             196   6e-68   Phaseolus vulgaris [French bean]
gb|AHN11665.1|  thiamin biosynthetic enzyme                             198   7e-68   Phaseolus vulgaris [French bean]
gb|AGZ80414.1|  thiamin biosynthetic enzyme                             195   1e-67   Phaseolus vulgaris [French bean]
gb|AHN11691.1|  thiamin biosynthetic enzyme                             196   3e-67   Phaseolus vulgaris [French bean]
gb|AGZ80422.1|  thiamin biosynthetic enzyme                             193   6e-67   Phaseolus vulgaris [French bean]
gb|AHN11708.1|  thiamin biosynthetic enzyme                             194   1e-66   Phaseolus vulgaris [French bean]
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                    211   6e-65   
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                   197   2e-62   Citrus sinensis [apfelsine]
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic             186   3e-62   Mortierella verticillata NRRL 6337
emb|CBI23938.3|  unnamed protein product                                201   6e-61   Vitis vinifera
emb|CAB64776.1|  thiazole biosynthetic enzyme                           197   2e-60   Brassica juncea [brown mustard]
dbj|BAC79982.1|  putative thiamine biosynthesis protein                 162   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004496859.1|  PREDICTED: thiamine thiazole synthase, chlor...    169   1e-56   Cicer arietinum [garbanzo]
ref|XP_008877253.1|  thiazole biosynthetic enzyme, chloroplastic,...    178   1e-56   Aphanomyces invadans
ref|XP_008616182.1|  thiamine biosynthetic enzyme                       176   2e-56   Saprolegnia diclina VS20
gb|KDO30626.1|  hypothetical protein SPRG_04526                         176   3e-56   Saprolegnia parasitica CBS 223.65
ref|XP_009844132.1|  thiazole biosynthesis enzyme                       177   7e-56   Aphanomyces astaci
ref|XP_009844134.1|  thiazole biosynthesis enzyme, variant 2            177   7e-56   Aphanomyces astaci
gb|ABK22862.1|  unknown                                                 159   2e-55   Picea sitchensis
gb|ABR01228.1|  thiazole biosynthetic enzyme                            176   3e-55   Chlorella vulgaris
ref|XP_002784437.1|  conserved hypothetical protein                     162   4e-55   Perkinsus marinus ATCC 50983
emb|CEP18429.1|  hypothetical protein                                   166   5e-55   Parasitella parasitica
gb|EPB86412.1|  thiazole biosynthetic enzyme, chloroplastic             166   6e-55   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN03507.1|  thiamin biosynthetic enzyme                            166   6e-55   Mucor ambiguus
gb|EPB91714.1|  thiazole biosynthetic enzyme, chloroplastic             164   6e-55   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005648929.1|  thiazole biosynthetic enzyme                       179   1e-54   Coccomyxa subellipsoidea C-169
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...    150   3e-54   
gb|EIE83081.1|  thiazole biosynthetic enzyme, chloroplastic             165   6e-54   Rhizopus delemar RA 99-880
emb|CEG62855.1|  Putative Thiamine thiazole synthase                    164   7e-54   Rhizopus microsporus
emb|CDM85402.1|  unnamed protein product                                165   9e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005847930.1|  hypothetical protein CHLNCDRAFT_22703              169   1e-52   Chlorella variabilis
gb|KIY99977.1|  thiamine biosynthetic enzyme                            169   2e-52   Monoraphidium neglectum
gb|KIY92671.1|  thiamine biosynthetic enzyme                            169   3e-52   Monoraphidium neglectum
ref|XP_003522069.1|  PREDICTED: thiamine thiazole synthase, chlor...    162   4e-51   Glycine max [soybeans]
gb|ADI88268.1|  HCF106 protein                                          141   5e-50   Silene latifolia
ref|XP_011397717.1|  Thiamine thiazole synthase, chloroplastic          159   8e-50   Auxenochlorella protothecoides
gb|ADI88272.1|  HCF106 protein                                          140   1e-49   Silene latifolia
gb|AGB85035.1|  thiamine biosynthesis thi4 protein                      157   2e-49   Auxenochlorella protothecoides
gb|ADI88468.1|  HCF106 protein                                          139   2e-49   Silene vulgaris [maiden's-tears]
gb|ADI88284.1|  HCF106 protein                                          138   3e-49   Silene latifolia
ref|XP_006388786.1|  hypothetical protein POPTR_0101s00250g             167   1e-48   
gb|ABW74129.1|  thiamin biosynthetic enzyme                             166   4e-48   Mucor racemosus
ref|XP_001698672.1|  full-length thiazole biosynthetic enzyme           160   5e-47   Chlamydomonas reinhardtii
ref|XP_002951140.1|  hypothetical protein VOLCADRAFT_74900              157   3e-46   Volvox carteri f. nagariensis
ref|XP_002951138.1|  hypothetical protein VOLCADRAFT_74899              156   3e-46   Volvox carteri f. nagariensis
gb|KJB57702.1|  hypothetical protein B456_009G176400                    124   2e-45   Gossypium raimondii
emb|CAH25337.1|  thiazole biosynthetic enzyme                           151   4e-45   Guillardia theta
ref|XP_005834399.1|  putative THI4, thiamine                            151   4e-45   Guillardia theta CCMP2712
ref|XP_007586590.1|  putative thiazole biosynthetic enzyme protein      148   2e-44   
ref|XP_001549602.1|  thiazole biosynthetic enzyme                       146   2e-44   
ref|XP_001589094.1|  thiazole biosynthetic enzyme                       146   2e-44   Sclerotinia sclerotiorum 1980 UF-70
gb|ESZ95478.1|  thiazole biosynthetic enzyme                            146   2e-44   Sclerotinia borealis F-4128
gb|KFY50717.1|  hypothetical protein V496_09214                         149   3e-44   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
emb|CEI86769.1|  Putative Thiamine thiazole synthase                    132   3e-44   Rhizopus microsporus
gb|KIN04678.1|  hypothetical protein OIDMADRAFT_17638                   144   5e-44   Oidiodendron maius Zn
gb|EHL02685.1|  putative Thiazole biosynthetic enzyme, mitochondrial    146   5e-44   Glarea lozoyensis 74030
ref|XP_008087498.1|  FAD/NAD(P)-binding protein                         146   6e-44   Glarea lozoyensis ATCC 20868
gb|KFZ11494.1|  hypothetical protein V502_07520                         149   7e-44   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY84898.1|  hypothetical protein V500_08902                         148   1e-43   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_007289177.1|  thiazole biosynthetic enzyme                       146   1e-43   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_009228164.1|  thiazole biosynthetic enzyme                       139   1e-43   Gaeumannomyces tritici R3-111a-1
gb|KFY94986.1|  hypothetical protein V498_03597                         148   1e-43   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|KFZ09843.1|  hypothetical protein V501_05470                         148   1e-43   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY70117.1|  hypothetical protein V499_09439                         148   2e-43   Pseudogymnoascus sp. VKM F-103
ref|XP_003842741.1|  similar to thiazole biosynthetic enzyme            146   2e-43   Leptosphaeria maculans JN3
gb|EME42084.1|  hypothetical protein DOTSEDRAFT_73000                   142   3e-43   Dothistroma septosporum NZE10
gb|EKG16915.1|  Thiamine biosynthesis Thi4 protein                      145   3e-43   Macrophomina phaseolina MS6
ref|XP_007672530.1|  hypothetical protein BAUCODRAFT_62660              143   3e-43   Baudoinia panamericana UAMH 10762
gb|KFX95262.1|  hypothetical protein V490_03958                         146   4e-43   Pseudogymnoascus sp. VKM F-3557
gb|KFY20175.1|  hypothetical protein V491_03934                         145   5e-43   Pseudogymnoascus sp. VKM F-3775
gb|KFY37341.1|  hypothetical protein V495_07232                         146   5e-43   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY24905.1|  hypothetical protein V493_04960                         145   5e-43   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|AGT99181.1|  thiazole biosynthetic enzyme                            142   7e-43   Acremonium chrysogenum
gb|KFX98431.1|  hypothetical protein O988_04337                         146   8e-43   Pseudogymnoascus sp. VKM F-3808
ref|XP_007928692.1|  hypothetical protein MYCFIDRAFT_211863             144   8e-43   Pseudocercospora fijiensis CIRAD86
gb|KFY43107.1|  hypothetical protein V494_02101                         145   9e-43   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY08103.1|  hypothetical protein V492_06538                         145   9e-43   Pseudogymnoascus sp. VKM F-4246
ref|NP_596642.1|  thiazole biosynthetic enzyme                          137   1e-42   Schizosaccharomyces pombe
gb|KDB14289.1|  thiazole biosynthetic enzyme variant 1                  140   1e-42   Ustilaginoidea virens
emb|CEJ80028.1|  Putative Thiamine thiazole synthase                    139   1e-42   Torrubiella hemipterigena
emb|CEJ80029.1|  Putative Thiamine thiazole synthase                    139   2e-42   Torrubiella hemipterigena
gb|ELR08851.1|  thiazole biosynthetic enzyme, mitochondrial             145   2e-42   Pseudogymnoascus destructans 20631-21
gb|KGQ06713.1|  Thiamine thiazole synthase                              139   2e-42   Beauveria bassiana D1-5
gb|ABG46357.1|  mitochondrial thiazole biosynthetic enzyme              141   2e-42   Trichoderma harzianum
ref|XP_008598283.1|  mitochondrial thiazole biosynthetic enzyme         139   3e-42   Beauveria bassiana ARSEF 2860
gb|EHK27008.1|  hypothetical protein TRIVIDRAFT_215037                  141   3e-42   Trichoderma virens Gv29-8
gb|ABN45968.1|  thiazole biosynthetic enzyme variant 1                  142   3e-42   Epichloe typhina
ref|XP_008026201.1|  hypothetical protein SETTUDRAFT_177413             142   3e-42   Exserohilum turcica Et28A
ref|XP_499918.1|  YALI0A09768p                                          139   3e-42   Yarrowia lipolytica CLIB122
ref|XP_007807526.1|  thiazole biosynthetic enzyme variant 1             139   4e-42   Metarhizium acridum CQMa 102
ref|XP_007794010.1|  putative thiazole biosynthetic enzyme protein      139   4e-42   
emb|CCE33143.1|  probable CyPBP37 protein (protein binding to CyP41)    138   4e-42   Claviceps purpurea 20.1
gb|KHN95056.1|  thiazole biosynthetic enzyme variant 1                  139   5e-42   Metarhizium album ARSEF 1941
ref|XP_001935439.1|  thiazole biosynthesis enzyme                       141   5e-42   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007913237.1|  putative thiazole biosynthetic enzyme protein      140   5e-42   Phaeoacremonium minimum UCRPA7
ref|XP_003297921.1|  hypothetical protein PTT_08482                     141   5e-42   
gb|KID90425.1|  thiazole biosynthetic enzyme variant 1                  139   6e-42   Metarhizium guizhouense ARSEF 977
ref|XP_007821738.1|  thiazole biosynthetic enzyme variant 1             139   6e-42   Metarhizium robertsii ARSEF 23
ref|XP_006692218.1|  hypothetical protein CTHT_0017160                  141   7e-42   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_003044703.1|  predicted protein                                  139   7e-42   [Nectria] haematococca mpVI 77-13-4
emb|CCF45087.1|  thiazole biosynthetic enzyme                           139   7e-42   Colletotrichum higginsianum
gb|KID99833.1|  thiazole biosynthetic enzyme variant 1                  139   8e-42   Metarhizium majus ARSEF 297
emb|CDP29968.1|  Putative mitochondrial thiazole biosynthetic enz...    138   9e-42   Podospora anserina S mat+
gb|ACB70465.1|  thiazole biosynthetic enzyme                            138   9e-42   Trichoderma aureoviride
gb|EHK44880.1|  hypothetical protein TRIATDRAFT_299703                  138   9e-42   Trichoderma atroviride IMI 206040
ref|XP_002172093.1|  thiazole biosynthetic enzyme                       137   1e-41   Schizosaccharomyces japonicus yFS275
ref|XP_006968797.1|  thiazole biosynthetic enzyme                       139   1e-41   Trichoderma reesei QM6a
gb|EMD85953.1|  hypothetical protein COCHEDRAFT_1160889                 142   1e-41   Bipolaris maydis C5
gb|KEQ70131.1|  putative thiazole synthase THI4_ASPOR thiazole bi...    140   1e-41   Aureobasidium namibiae CBS 147.97
gb|ACN39013.1|  thiazole synthase                                       142   1e-41   Epichloe festucae
sp|P23617.1|THI4_FUSSH  RecName: Full=Thiamine thiazole synthase;...    140   1e-41   Fusarium phaseoli
ref|XP_001796354.1|  hypothetical protein SNOG_05965                    139   1e-41   Parastagonospora nodorum SN15
ref|XP_007271222.1|  thiazole biosynthetic enzyme                       136   1e-41   Fomitiporia mediterranea MF3/22
gb|ENH83973.1|  thiazole biosynthetic enzyme                            139   1e-41   
ref|XP_007835960.1|  Thiamine thiazole synthase                         137   1e-41   Pestalotiopsis fici W106-1
ref|XP_011395239.1|  thiazole biosynthetic enzyme, variant 2            141   2e-41   Neurospora crassa OR74A
gb|ELQ63963.1|  hypothetical protein OOW_P131scaffold00904g6            139   2e-41   Magnaporthe oryzae P131
gb|KHE80990.1|  hypothetical protein GE21DRAFT_10110                    141   2e-41   Neurospora crassa
ref|XP_009853231.1|  hypothetical protein NEUTE1DRAFT_95662             141   2e-41   Neurospora tetrasperma FGSC 2508
ref|XP_009253330.1|  hypothetical protein FPSE_01936                    137   2e-41   Fusarium pseudograminearum CS3096
ref|XP_006666857.1|  thiazole biosynthetic enzyme                       139   2e-41   Cordyceps militaris CM01
gb|EUN24789.1|  hypothetical protein COCVIDRAFT_17857                   140   2e-41   Bipolaris victoriae FI3
gb|EUC66166.1|  thiamine thiazole synthase                              134   2e-41   Rhizoctonia solani AG-3 Rhs1AP
sp|P23618.2|THI4_FUSOX  RecName: Full=Thiamine thiazole synthase;...    137   2e-41   Fusarium oxysporum
gb|EWG49587.1|  thiamine biosynthetic enzyme                            137   2e-41   Fusarium verticillioides 7600
ref|XP_011318395.1|  hypothetical protein FGSG_02469                    137   2e-41   Fusarium graminearum PH-1
gb|EWG49586.1|  thiamine biosynthetic enzyme                            136   2e-41   
gb|EXK40264.1|  thiamine biosynthetic enzyme                            137   2e-41   
gb|ELQ36693.1|  hypothetical protein OOU_Y34scaffold00646g4             139   2e-41   
ref|XP_007701574.1|  hypothetical protein COCSADRAFT_38262              140   2e-41   
gb|EMT70803.1|  Thiazole biosynthetic enzyme, mitochondrial             137   2e-41   
ref|XP_007713209.1|  hypothetical protein COCCADRAFT_27023              140   3e-41   
gb|KEY67925.1|  hypothetical protein S7711_02133                        138   3e-41   
gb|KEQ59396.1|  Thi4-domain-containing protein                          139   3e-41   
ref|XP_007692325.1|  hypothetical protein COCMIDRAFT_30031              140   3e-41   
gb|KEQ99790.1|  hypothetical protein AUEXF2481DRAFT_35726               139   3e-41   
gb|EAQ71495.1|  hypothetical protein MGCH7_ch7g902                      139   3e-41   
ref|XP_003720575.1|  thiazole biosynthetic enzyme                       139   3e-41   
gb|ACN36998.1|  unknown                                                 150   4e-41   
ref|XP_001227644.1|  thiazole biosynthetic enzyme, mitochondrial ...    139   4e-41   
gb|ADI87873.1|  HCF106 protein                                          111   4e-41   
gb|EFW98890.1|  thiazole biosynthetic enzyme                            139   5e-41   
gb|EFQ30532.1|  Thi4 family protein                                     138   5e-41   
gb|ADI87863.1|  HCF106 protein                                          111   5e-41   
gb|KIL95952.1|  hypothetical protein FAVG1_00690                        137   5e-41   
gb|KEZ45124.1|  Thiamine thiazole synthase                              134   6e-41   
gb|KHK14205.1|  ribulose-1,5-biphosphate synthetase                     119   6e-41   
gb|KFA66874.1|  hypothetical protein S40285_02303                       138   6e-41   
ref|XP_007591792.1|  thiazole biosynthetic enzyme                       139   6e-41   
ref|XP_001819323.1|  thiazole biosynthetic enzyme                       137   7e-41   
gb|AAF25444.1|AF217503_1  putative thiazole synthase                    137   7e-41   
ref|XP_002375225.1|  thiazole biosynthesis enzyme Sti35                 137   8e-41   
ref|XP_007757037.1|  thiazole biosynthetic enzyme, mitochondrial        136   8e-41   
ref|XP_007277744.1|  thiazole biosynthetic enzyme                       135   9e-41   
gb|KDN34978.1|  hypothetical protein RSAG8_11984                        132   1e-40   
ref|XP_003851349.1|  hypothetical protein MYCGRDRAFT_44262              141   1e-40   
gb|KIV86533.1|  thiamine thiazole synthase                              137   1e-40   
gb|KIV86535.1|  thiamine thiazole synthase, variant 2                   137   1e-40   
gb|EQB43457.1|  hypothetical protein CGLO_17887                         135   1e-40   
gb|ADI87875.1|  HCF106 protein                                          110   1e-40   
gb|ADI87865.1|  HCF106 protein                                          110   1e-40   
ref|XP_006957782.1|  Thi4-domain-containing protein                     131   1e-40   
gb|KEQ82031.1|  Thi4-domain-containing protein                          137   1e-40   
ref|XP_003665159.1|  hypothetical protein MYCTH_2315910                 140   1e-40   
emb|CCO32846.1|  Thiamine thiazole synthase AltName: Full=Stress-...    132   2e-40   
gb|KIV92747.1|  thiamine thiazole synthase                              136   2e-40   
ref|XP_003654402.1|  hypothetical protein THITE_2117402                 140   2e-40   
ref|XP_002146762.1|  thiazole biosynthesis enzyme                       134   2e-40   
ref|XP_002479053.1|  thiazole biosynthesis enzyme                       134   2e-40   
ref|XP_461084.2|  DEHA2F16654p                                          132   2e-40   
gb|ABQ23424.1|  thiazole biosynthetic enzyme                            140   2e-40   
gb|EDK40113.2|  conserved hypothetical protein                          132   2e-40   
gb|KIW21130.1|  thiamine thiazole synthase                              135   2e-40   
ref|XP_001835983.2|  thiazole biosynthetic enzyme                       134   2e-40   
gb|KEF63437.1|  thiazole biosynthetic enzyme, mitochondrial             136   3e-40   
ref|XP_009269436.1|  Thiamine thiazole synthase                         131   3e-40   
pdb|3JSK|A  Chain A, Thiazole Synthase From Neurospora Crassa           137   3e-40   
gb|EPX71211.1|  thiazole biosynthetic enzyme                            132   3e-40   
gb|EPY53594.1|  thiazole biosynthetic enzyme                            132   4e-40   
ref|XP_007399642.1|  hypothetical protein PHACADRAFT_177254             134   6e-40   
ref|XP_004199741.1|  Piso0_002284                                       129   7e-40   
dbj|GAM35876.1|  thiazole biosynthetic enzyme                           132   7e-40   
ref|XP_003320392.1|  thiazole biosynthetic enzyme, mitochondrial        130   7e-40   
dbj|GAD93648.1|  thiazole biosynthetic enzyme                           135   7e-40   
emb|CDK26023.1|  unnamed protein product                                135   7e-40   
dbj|GAA84055.1|  thiazole biosynthesis enzyme                           134   9e-40   
ref|XP_003344754.1|  hypothetical protein SMAC_06409                    141   1e-39   
ref|XP_007866883.1|  Thi4-domain-containing protein                     132   1e-39   
gb|EMF12655.1|  thiazole biosynthetic enzyme, mitochondrial             136   1e-39   
ref|XP_001394167.1|  thiazole biosynthetic enzyme                       134   1e-39   
gb|ABL63512.1|  mitochondrial thiazole biosynthetic enzyme              135   1e-39   
dbj|GAM85562.1|  hypothetical protein ANO11243_035690                   134   1e-39   
emb|CCM00650.1|  predicted protein                                      133   2e-39   
ref|XP_004198891.1|  Piso0_002284                                       127   2e-39   
gb|EPE04284.1|  thiazole biosynthetic enzyme                            136   2e-39   
ref|XP_750725.1|  thiazole biosynthesis enzyme                          134   2e-39   
gb|KIJ62636.1|  hypothetical protein HYDPIDRAFT_94083                   130   2e-39   
gb|KEY78369.1|  thiazole biosynthesis enzyme                            134   2e-39   
ref|XP_001257952.1|  thiazole biosynthesis enzyme                       134   3e-39   
ref|XP_001483482.1|  conserved hypothetical protein                     128   3e-39   
ref|XP_001214996.1|  hypothetical protein ATEG_05818                    134   3e-39   
ref|XP_001267966.1|  thiazole biosynthesis enzyme                       134   3e-39   
gb|KDN61355.1|  putative Thi4 family protein                            139   4e-39   
ref|XP_001526313.1|  hypothetical protein LELG_02871                    129   4e-39   
ref|XP_007380545.1|  thiazole biosynthetic enzyme                       130   4e-39   
gb|EPT05287.1|  hypothetical protein FOMPIDRAFT_1112158                 131   4e-39   
gb|KIP06210.1|  hypothetical protein PHLGIDRAFT_468135                  130   6e-39   
gb|KIH92073.1|  thiamine biosynthetic enzyme                            135   6e-39   
gb|KIJ24322.1|  hypothetical protein M422DRAFT_274931                   131   6e-39   
gb|KII90613.1|  hypothetical protein PLICRDRAFT_538929                  132   6e-39   
gb|KIO02829.1|  hypothetical protein M404DRAFT_27718                    130   7e-39   
ref|XP_661532.1|  THI4_ASPOR Thiazole biosynthetic enzyme, mitoch...    133   7e-39   
gb|ERT00649.1|  thiazole biosynthetic enzyme, mitochondrial             135   7e-39   
ref|XP_009648318.1|  STI35 protein                                      134   8e-39   
gb|EYE95075.1|  Thi4 family thiamine biosynthetic enzyme                132   9e-39   
ref|XP_007364009.1|  Thi4-domain-containing protein                     132   9e-39   
ref|XP_002615665.1|  hypothetical protein CLUG_04547                    126   1e-38   
sp|Q9UVF8.1|THI4_UROFA  RecName: Full=Thiamine thiazole synthase;...    126   1e-38   
gb|EMD39842.1|  hypothetical protein CERSUDRAFT_112109                  131   1e-38   
gb|KDQ62341.1|  hypothetical protein JAAARDRAFT_170661                  131   1e-38   
ref|XP_008037799.1|  Thi4-domain-containing protein                     131   1e-38   
ref|XP_007376158.1|  hypothetical protein SPAPADRAFT_51398              126   1e-38   
gb|EMG50374.1|  hypothetical protein G210_4595                          136   1e-38   
ref|XP_007416429.1|  hypothetical protein MELLADRAFT_53832              126   1e-38   
gb|KIY62047.1|  thiazole biosynthetic enzyme                            127   2e-38   
gb|KIM63333.1|  hypothetical protein SCLCIDRAFT_752494                  129   2e-38   
gb|KIM43217.1|  hypothetical protein M413DRAFT_444027                   129   2e-38   
emb|CCX30406.1|  Similar to Thiamine thiazole synthase; acc. no. ...    129   2e-38   
ref|XP_006462581.1|  hypothetical protein AGABI2DRAFT_72787             125   2e-38   
gb|EKV04849.1|  Thiazole biosynthesis enzyme                            131   3e-38   
gb|KIK99865.1|  hypothetical protein PAXRUDRAFT_822318                  129   3e-38   
ref|XP_002492875.1|  Thiazole synthase, catalyzes formation of th...    129   4e-38   
ref|XP_007319542.1|  hypothetical protein SERLADRAFT_470126             129   4e-38   
gb|EJT96874.1|  thiazole biosynthetic enzyme                            126   4e-38   
gb|KDN47179.1|  putative Thiamin biosynthetic enzyme                    125   4e-38   
ref|XP_003868755.1|  Thi4 thiamine biosynthetic enzyme precursor        125   4e-38   
ref|XP_002541542.1|  thiazole biosynthesis enzyme                       129   5e-38   
gb|KIW54196.1|  thiamine thiazole synthase                              138   5e-38   
gb|KIX08964.1|  thiamine thiazole synthase                              137   6e-38   
ref|XP_007351669.1|  thiazole biosynthetic enzyme                       126   6e-38   
emb|CCE44732.1|  hypothetical protein CPAR2_405360                      124   7e-38   
gb|KGO71577.1|  Thiazole biosynthetic enzyme Thi4 family                129   7e-38   
gb|KIX99472.1|  thiamine thiazole synthase                              137   7e-38   
dbj|GAK64104.1|  thi4-domain-containing protein                         127   8e-38   
ref|XP_001386426.1|  hypothetical protein PICST_50942                   124   8e-38   
gb|EPS32049.1|  hypothetical protein PDE_07008                          130   8e-38   
gb|KDR82811.1|  hypothetical protein GALMADRAFT_238371                  124   8e-38   
gb|KIL63207.1|  hypothetical protein M378DRAFT_79929                    124   1e-37   
emb|CDI56388.1|  probable Thiamin biosynthetic enzyme                   125   1e-37   
ref|XP_007745751.1|  thiazole biosynthetic enzyme, mitochondrial        137   1e-37   
ref|XP_007882083.1|  hypothetical protein PFL1_06351                    124   1e-37   
gb|KGO43516.1|  Thiazole biosynthetic enzyme Thi4 family                129   1e-37   
ref|XP_002548228.1|  hypothetical protein CTRG_02525                    134   1e-37   
gb|KIW39396.1|  thiamine thiazole synthase, variant 1                   136   1e-37   
gb|EEH38204.2|  thiazole biosynthesis enzyme                            130   1e-37   
ref|XP_006370641.1|  hypothetical protein POPTR_0001s44460g             141   2e-37   
ref|XP_010759569.1|  thiazole biosynthetic enzyme, mitochondrial        130   2e-37   
ref|XP_002797266.1|  thiazole biosynthesis enzyme                       130   2e-37   
gb|KIW68442.1|  thiamine thiazole synthase                              136   2e-37   
gb|KIW39395.1|  thiamine thiazole synthase                              135   2e-37   
gb|KIW92677.1|  thiamine thiazole synthase                              136   2e-37   
gb|EEH05819.1|  thiazole biosynthetic enzyme                            129   2e-37   
gb|EIF46156.1|  thiazole biosynthetic enzyme                            122   2e-37   
gb|EER41684.1|  thiazole biosynthetic enzyme                            129   2e-37   
ref|XP_001538310.1|  hypothetical protein HCAG_05915                    129   2e-37   
sp|C0NSF3.2|THI4_AJECG  RecName: Full=Thiamine thiazole synthase;...    129   2e-37   
ref|XP_007721137.1|  thiazole biosynthetic enzyme, mitochondrial        136   2e-37   
gb|EGD98433.1|  Thi4 family protein                                     131   2e-37   
ref|XP_007304939.1|  Thi4-domain-containing protein                     127   2e-37   
ref|XP_009154920.1|  thiazole biosynthetic enzyme, mitochondrial        136   2e-37   
gb|KIW29175.1|  thiamine thiazole synthase                              136   3e-37   
gb|KJA21255.1|  hypothetical protein HYPSUDRAFT_42403                   124   3e-37   
ref|XP_007728533.1|  thiazole biosynthetic enzyme, mitochondrial        135   3e-37   
emb|CDM36407.1|  Thiazole biosynthetic enzyme, mitochondrial            129   3e-37   
gb|KDQ25745.1|  hypothetical protein PLEOSDRAFT_1057999                 129   3e-37   
gb|KIW79545.1|  thiamine thiazole synthase                              135   3e-37   
gb|KGK37032.1|  hypothetical protein JL09_g3847                         125   3e-37   
ref|XP_002564812.1|  Pc22g07960                                         129   3e-37   
ref|XP_008726400.1|  thiazole biosynthetic enzyme, mitochondrial        135   4e-37   
gb|EEH19379.2|  thiazole biosynthetic enzyme, mitochondrial             130   4e-37   
gb|KDB24510.1|  thiazole biosynthetic enzyme, mitochondrial             131   4e-37   
emb|CEG76808.1|  Putative Thiamine thiazole synthase                    108   5e-37   
dbj|GAC72397.1|  hypothetical protein PANT_7d00078                      125   5e-37   
gb|EFW21941.1|  thiazole biosynthetic enzyme                            127   6e-37   
dbj|GAC98786.1|  flavin-binding monooxygenase-like                      124   6e-37   
ref|XP_002842761.1|  thiazole biosynthetic enzyme                       130   6e-37   
gb|ETS60793.1|  hypothetical protein PaG_04705                          125   6e-37   
ref|XP_003066032.1|  thiazole biosynthetic enzyme, mitochondrial ...    127   6e-37   
ref|XP_001247344.1|  thiazole biosynthetic enzyme, mitochondrial ...    127   7e-37   
ref|XP_003013828.1|  hypothetical protein ARB_07940                     130   7e-37   
gb|ESW99744.1|  Thiamine thiazole synthase                              123   7e-37   
gb|EEQ92538.1|  thiazole biosynthesis enzyme                            128   8e-37   
ref|XP_002626178.1|  thiazole biosynthesis enzyme                       128   8e-37   
gb|EZF72777.1|  thiazole biosynthetic enzyme, mitochondrial             130   8e-37   
ref|XP_003169195.1|  thiazole biosynthesis enzyme                       130   8e-37   
ref|WP_043641419.1|  hypothetical protein                               122   1e-36   
emb|CCF51739.1|  probable Thiamin biosynthetic enzyme                   123   1e-36   
emb|CBQ71006.1|  probable Thiamin biosynthetic enzyme                   124   2e-36   
gb|KIY43384.1|  Thi4-domain-containing protein                          123   2e-36   
ref|XP_007853538.1|  thiazole biosynthetic enzyme                       125   2e-36   
gb|EST05805.1|  flavin-binding monooxygenase-like                       123   2e-36   
ref|XP_011388856.1|  putative Thiamin biosynthetic enzyme               123   2e-36   
ref|XP_003235740.1|  Thi4 family protein                                128   2e-36   
gb|KIM86133.1|  hypothetical protein PILCRDRAFT_816673                  125   2e-36   
emb|CAA57779.1|  nmt2                                                   116   3e-36   
gb|ACU23028.1|  unknown                                                 134   5e-36   
ref|XP_003034505.1|  hypothetical protein SCHCODRAFT_84820              122   5e-36   
gb|ACZ34282.1|  thiazole synthase                                       132   5e-36   
gb|EQL00755.1|  thiazole biosynthetic enzyme variant 1                  135   6e-36   
ref|XP_008714161.1|  thiazole biosynthetic enzyme, mitochondrial        134   6e-36   
gb|KIK52064.1|  hypothetical protein GYMLUDRAFT_50135                   123   7e-36   
gb|ADI87867.1|  HCF106 protein                                          110   1e-35   
ref|XP_007768494.1|  Thi4-domain-containing protein                     121   1e-35   
emb|CDG58549.1|  Thi4-2 protein                                         123   2e-35   
emb|CDG58548.1|  Thi4-1 protein                                         123   2e-35   
emb|CDG58546.1|  Thi4 protein                                           123   2e-35   
emb|CDG58547.1|  Thi4 protein                                           120   7e-35   
emb|CCV00434.1|  unnamed protein product                                120   7e-35   
ref|XP_002419419.1|  thiamine biosynthesis enzyme, putative; thia...    124   7e-35   
emb|CDY42479.1|  BnaA10g08550D                                        87.4    1e-34   
gb|KHC63824.1|  thiazole biosynthesis enzyme                            124   1e-34   
ref|XP_723197.1|  likely thiamine biosynthesis enzyme                   124   1e-34   
gb|ABN45974.1|  thiazole biosynthetic enzyme variant 1                  116   1e-34   
gb|KGQ88127.1|  thiazole biosynthesis enzyme                            124   1e-34   
gb|AAL86771.2|  THI4 enzyme                                             124   1e-34   
gb|KGR10168.1|  thiazole biosynthesis enzyme                            124   1e-34   
gb|KHC37210.1|  thiazole biosynthesis enzyme                            124   1e-34   
ref|XP_009546328.1|  hypothetical protein HETIRDRAFT_440039             125   2e-34   
gb|EMS18749.1|  thiamine biosynthetic enzyme                            127   4e-34   
gb|KCW75370.1|  hypothetical protein EUGRSUZ_E04118                     121   7e-34   
sp|C4YNP4.1|THI4_CANAW  RecName: Full=Thiamine thiazole synthase;...    120   7e-34   
gb|KFX46359.1|  Thiamine thiazole synthase                              134   1e-33   
gb|EGU11956.1|  Thiazole biosynthetic enzyme                            130   1e-33   
ref|XP_001731131.1|  hypothetical protein MGL_1314                      110   7e-33   
sp|Q4PC85.1|THI4_USTMA  RecName: Full=Thiamine thiazole synthase;...    111   8e-33   
emb|CDO93401.1|  unnamed protein product                                106   2e-31   
ref|XP_451008.1|  hypothetical protein                                  107   1e-30   
ref|XP_011273842.1|  Thiazole biosynthetic enzyme                       101   2e-30   
ref|XP_003683988.1|  hypothetical protein TPHA_0A04790                  100   4e-30   
ref|XP_003676118.1|  hypothetical protein NCAS_0D01750                  100   6e-30   
ref|XP_001647032.1|  hypothetical protein Kpol_1050p31                  104   6e-30   
ref|XP_449395.1|  hypothetical protein                                  102   1e-29   
dbj|BAO40649.1|  thiazole biosynthetic enzyme                           106   2e-29   
ref|NP_982405.1|  AAL137Wp                                            98.2    7e-29   
gb|KIJ17836.1|  hypothetical protein PAXINDRAFT_9774                    120   1e-28   
emb|CDH15474.1|  probable Thiamine thiazole synthase                    100   1e-28   
emb|CDF87469.1|  BN860_07074g1_1                                        100   1e-28   



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   256 bits (655),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  216  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--  189
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNALDG+ SEV  
Sbjct  276  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNALDGTLSEVNT  335

Query  188  AAPELILASAENEEIADA  135
            A P+LILA+AE EE+ DA
Sbjct  336  AQPDLILAAAETEEVVDA  353


 Score = 88.2 bits (217),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDT  215



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score =   253 bits (646),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  218  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--  189
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE   
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAER  337

Query  188  AAPELILASAENEEIADA  135
              PE +LASAE EEI DA
Sbjct  338  VQPEFVLASAETEEIVDA  355


 Score = 86.3 bits (212),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  174  MSKLLARPNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDT  217



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score =   252 bits (643),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  218  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--  189
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE   
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAER  337

Query  188  AAPELILASAENEEIADA  135
              PE +LA+AE EEI DA
Sbjct  338  VQPEFVLAAAETEEIVDA  355


 Score = 86.3 bits (212),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  174  MSKLLARPNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDT  217



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score =   245 bits (625),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 129/136 (95%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+SVPGMKALDMNTAEDAIVRLT
Sbjct  221  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIESVPGMKALDMNTAEDAIVRLT  280

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG+ +    
Sbjct  281  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGTFT--IH  338

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE+ +IADA
Sbjct  339  PELMLAAAESADIADA  354


 Score = 92.8 bits (229),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT
Sbjct  177  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  220



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score =   246 bits (629),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      
Sbjct  282  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGSIQ  341

Query  182  PELILASAENEEIADA  135
            PELILA+A++ EIA+A
Sbjct  342  PELILAAADSAEIAEA  357


 Score = 90.1 bits (222),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKN RVGGVVTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKNDRVGGVVTNWALVSMNHDT  221



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score =   249 bits (637),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  219  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--  189
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE   
Sbjct  279  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAVDGTFSEAER  338

Query  188  AAPELILASAENEEIADA  135
              PE +LA+AE EE  DA
Sbjct  339  VQPEFVLAAAETEETVDA  356


 Score = 85.9 bits (211),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  175  MSKLLARPNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDT  218



>gb|KJB57703.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=219

 Score =   250 bits (638),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  82   QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  141

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--  189
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE   
Sbjct  142  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAER  201

Query  188  AAPELILASAENEEIADA  135
              PE +LA+AE EEI DA
Sbjct  202  VQPEFVLAAAETEEIVDA  219


 Score = 85.5 bits (210),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  38   MSKLLARPNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDT  81



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score =   246 bits (627),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  352  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLT  411

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      
Sbjct  412  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGSIQ  471

Query  182  PELILASAENEEIADA  135
            PELILA+A++ EIA+A
Sbjct  472  PELILAAADSAEIAEA  487


 Score = 89.7 bits (221),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKN RVGGVVTNWALVSMNHDT
Sbjct  308  MSKLLARPNVKLFNAVAAEDLIVKNDRVGGVVTNWALVSMNHDT  351



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score =   247 bits (631),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNAL+GS  EV  
Sbjct  277  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNALEGSYREVKT  336

Query  182  --PELILASAENEEIADA  135
               E +LASAE++E  DA
Sbjct  337  GVEEFMLASAESDETVDA  354


 Score = 88.2 bits (217),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDT  216



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score =   244 bits (624),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      
Sbjct  282  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTYVGSIQ  341

Query  182  PELILASAENEEIADA  135
            PELILA+A++ E ADA
Sbjct  342  PELILAAADSAETADA  357


 Score = 90.5 bits (223),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDT  221



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score =   244 bits (624),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      
Sbjct  282  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTYVGSIH  341

Query  182  PELILASAENEEIADA  135
            PELILA+A++ E ADA
Sbjct  342  PELILAAADSAETADA  357


 Score = 90.5 bits (223),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDT  221



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score =   249 bits (636),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +E   
Sbjct  278  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAET  337

Query  182  --PELILASAENEEIADA  135
              PELILA+AE  EI DA
Sbjct  338  MQPELILAAAETGEIVDA  355


 Score = 85.5 bits (210),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  174  MSKLLARPNVKLFNAVAAEDLIVKEERVAGVVTNWALVSMNHDT  217



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   246 bits (628),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    
Sbjct  277  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQ  334

Query  182  PELILASAENEEIADA  135
            PEL+LA++E  EI DA
Sbjct  335  PELVLAASEAGEIVDA  350


 Score = 88.2 bits (217),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHDT  216



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score =   246 bits (629),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  216  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG+P+ALDG  +EV  
Sbjct  276  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGQPSALDGGRNEVKT  335

Query  182  --PELILASAENEEIADA  135
              PE ILASAE +E  DA
Sbjct  336  DQPEFILASAEPDETVDA  353


 Score = 87.8 bits (216),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDT  215



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   249 bits (636),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  200  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  259

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS--EV  189
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +  E 
Sbjct  260  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAET  319

Query  188  AAPELILASAENEEIADA  135
              PELILA+AE  EI DA
Sbjct  320  MQPELILAAAETGEIVDA  337


 Score = 85.1 bits (209),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  156  MSKLLARPNVKLFNAVAAEDLIVKEERVAGVVTNWALVSMNHDT  199



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score =   244 bits (622),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      
Sbjct  282  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTHVGTIH  341

Query  182  PELILASAENEEIADA  135
            PELILA A++ E ADA
Sbjct  342  PELILAVADSAETADA  357


 Score = 90.1 bits (222),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGG+VTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKEGRVGGIVTNWALVSMNHDT  221



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score =   248 bits (632),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  217  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    
Sbjct  277  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQ  334

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE  EI DA
Sbjct  335  PELVLAAAEAGEIVDA  350


 Score = 85.9 bits (211),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNH+T
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHNT  216



>emb|CAN74175.1| hypothetical protein VITISV_019223 [Vitis vinifera]
Length=219

 Score =   248 bits (632),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  82   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  141

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +E   
Sbjct  142  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAET  201

Query  182  --PELILASAENEEIADA  135
              PELILA+AE  EI DA
Sbjct  202  MQPELILAAAETGEIVDA  219


 Score = 85.1 bits (209),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  38   MSKLLARPNVKLFNAVAAEDLIVKEERVAGVVTNWALVSMNHDT  81



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score =   245 bits (626),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN LDGS     +
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLS  336

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  337  PELVLAAADSAETVDA  352


 Score = 87.8 bits (216),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  216



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   244 bits (623),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ S    
Sbjct  277  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTLS--LQ  334

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE  +I DA
Sbjct  335  PELVLAAAEAGDIVDA  350


 Score = 88.2 bits (217),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHDT  216



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score =   246 bits (629),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 127/138 (92%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  219  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD--GSASEV  189
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+D   S +E 
Sbjct  279  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDVTFSKAER  338

Query  188  AAPELILASAENEEIADA  135
              PE +LA+AE EE  DA
Sbjct  339  VQPEFVLAAAETEETVDA  356


 Score = 85.9 bits (211),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  175  MSKLLARPNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDT  218



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score =   241 bits (616),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 128/136 (94%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  226  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  285

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG P+ALDG+ +    
Sbjct  286  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPSALDGTFT--LH  343

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE+ E ADA
Sbjct  344  PELVLAAAESGETADA  359


 Score = 90.5 bits (223),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  182  MSKLLARPNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDT  225



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score =   248 bits (634),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKS+GMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSVGMIDSVPGMKALDMNTAEDAIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +E   
Sbjct  278  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAET  337

Query  182  --PELILASAENEEIADA  135
              PELILA+AE  EI DA
Sbjct  338  MQPELILAAAETGEIVDA  355


 Score = 83.2 bits (204),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKL NAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  174  MSKLLARPNVKLLNAVAAEDLIVKEERVAGVVTNWALVSMNHDT  217



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score =   239 bits (611),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 128/136 (94%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLT
Sbjct  216  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+D + +    
Sbjct  276  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGLPNAVDYATN--IH  333

Query  182  PELILASAENEEIADA  135
            PEL+LA+A+++E ADA
Sbjct  334  PELVLAAADSDETADA  349


 Score = 92.4 bits (228),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  215



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score =   247 bits (630),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  214  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+    + 
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCESASE  333

Query  182  PELILASAENEEIADA  135
            PELILASAE+++  DA
Sbjct  334  PELILASAESQDTVDA  349


 Score = 84.7 bits (208),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLA+PNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  170  MSKLLAKPNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDT  213



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score =   244 bits (622),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN LDGS     +
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLS  336

Query  182  PELILASAENEEIAD  138
            PEL+LA+A++ E  D
Sbjct  337  PELVLAAADSAETVD  351


 Score = 87.4 bits (215),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  216



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score =   243 bits (620),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR T
Sbjct  219  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRFT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+ NA+DG+   V  
Sbjct  279  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGKNNAIDGTCEAVRE  338

Query  185  APELILASAENEEIADA  135
             PEL+LAS + EE  DA
Sbjct  339  EPELVLASVDAEETVDA  355


 Score = 87.8 bits (216),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLA+PNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  175  MSKLLAKPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  218



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score =   245 bits (625),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIG+I+SVPGMKALDMN AEDAIVRLT
Sbjct  219  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGLIESVPGMKALDMNVAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+ SE  +
Sbjct  279  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTYSEKGS  338

Query  182  --PELILASAENEEIADA  135
              PELILASA++ EIADA
Sbjct  339  IHPELILASADSTEIADA  356


 Score = 85.9 bits (211),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVA EDLIVK G+V GVVTNWALVSMNHDT
Sbjct  175  MSKLLARPNVKLFNAVAVEDLIVKEGKVAGVVTNWALVSMNHDT  218



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score =   244 bits (623),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  250  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  309

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE--V  189
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+  E   
Sbjct  310  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFIEGGR  369

Query  188  AAPELILASAENEEIADA  135
              PE +LA+AE E   DA
Sbjct  370  VQPEFVLAAAETEGTVDA  387


 Score = 86.3 bits (212),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK+ RV GVVTNWALVSMNHDT
Sbjct  206  MSKLLARPNVKLFNAVAAEDLIVKDNRVAGVVTNWALVSMNHDT  249



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score =   245 bits (626),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  215  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN LDGS     +
Sbjct  275  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLS  334

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  335  PELVLAAADSAETVDA  350


 Score = 85.5 bits (210),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  171  MSKLLARPNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDT  214



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score =   243 bits (620),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  214  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN +DGS     +
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLS  333

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  334  PELVLAAADSAETVDA  349


 Score = 87.0 bits (214),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  170  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  213



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score =   241 bits (614),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLT
Sbjct  224  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVA  186
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG+  +E  
Sbjct  284  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNALDGTIGTEQV  343

Query  185  APELILASAENEEIADA  135
             PE++LAS++  ++ DA
Sbjct  344  HPEMVLASSDGGDVVDA  360


 Score = 89.4 bits (220),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  180  MSRLLARPNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDT  223



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score =   243 bits (620),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  214  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN +DGS     +
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLS  333

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  334  PELVLAAADSAETVDA  349


 Score = 87.0 bits (214),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  170  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  213



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score =   241 bits (615),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  219  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VA  186
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+      
Sbjct  279  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGRE  338

Query  185  APELILASAENEEIADA  135
             PEL+LASA  E+I DA
Sbjct  339  EPELVLASANTEDIVDA  355


 Score = 88.2 bits (217),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  175  MSKLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  218



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score =   242 bits (618),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  216  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA HLALKALG+PNALDG+     +
Sbjct  276  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLS  335

Query  182  PELILASAENEEIADA  135
            PEL+LA A++ E  DA
Sbjct  336  PELVLAVADSAETVDA  351


 Score = 87.4 bits (215),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  215



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score =   244 bits (622),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    
Sbjct  277  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQ  334

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE  +  DA
Sbjct  335  PELVLAAAEAGDTVDA  350


 Score = 85.9 bits (211),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNH+T
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHNT  216



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score =   238 bits (608),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIV+LT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVKLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      
Sbjct  282  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGMPNALDGTFVGGIH  341

Query  182  PELILASAENEEIAD  138
            PELILA+ E+ EIA+
Sbjct  342  PELILAAVESAEIAE  356


 Score = 90.9 bits (224),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDT  221



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   237 bits (604),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIV+LT
Sbjct  216  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVKLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    
Sbjct  276  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VH  333

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE+ EIADA
Sbjct  334  PELVLAAAESAEIADA  349


 Score = 92.4 bits (228),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  215



>emb|CDY41008.1| BnaA02g27980D [Brassica napus]
Length=280

 Score =   242 bits (618),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  145  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  204

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN +DGS     +
Sbjct  205  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLS  264

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  265  PELVLAAADSAETVDA  280


 Score = 86.7 bits (213),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  101  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  144



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score =   241 bits (614),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+KIVVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRL 
Sbjct  219  QSCMDPNVMESKIVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLA  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG+PNALD S   + A
Sbjct  279  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGQPNALDDSYDGLKA  338

Query  182  PELILASAENEEIADA  135
             E +LA+A+  +I DA
Sbjct  339  EEFVLAAADAGDIVDA  354


 Score = 88.2 bits (217),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  175  MSKLLARPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDT  218



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score =   238 bits (608),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  214  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDFVPGMKALDMNTAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVA  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+  S   
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCDSARE  333

Query  185  APELILASAENEEIADA  135
             PEL+LAS E E+  DA
Sbjct  334  EPELVLASVELEDTVDA  350


 Score = 90.1 bits (222),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  170  MSKLLARPNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDT  213



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (618),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  209  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  326

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  327  PELVLASAENE  337


 Score = 86.7 bits (213),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDT  208



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score =   244 bits (622),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  214  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+    + 
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCEFASE  333

Query  182  PELILASAENEEIADA  135
            PELILA AE+++  DA
Sbjct  334  PELILAFAESQDTVDA  349


 Score = 84.7 bits (208),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLA+PNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  170  MSKLLAKPNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDT  213



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  209  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  326

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  327  PELVLASAENE  337


 Score = 86.7 bits (213),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDT  208



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  209  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  326

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  327  PELVLASAENE  337


 Score = 86.7 bits (213),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDT  208



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  209  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  326

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  327  PELVLASAENE  337


 Score = 86.3 bits (212),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDT  208



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score =   246 bits (629),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 130/136 (96%), Gaps = 1/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMI+SVPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG P+ALDGS SE A 
Sbjct  277  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPHALDGSYSE-AQ  335

Query  182  PELILASAENEEIADA  135
            PEL+LASAE +++ +A
Sbjct  336  PELVLASAEADDVVEA  351


 Score = 81.6 bits (200),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALV+ NH T
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVAQNHHT  216



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   241 bits (616),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  209  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  326

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  327  PELLLASAENE  337


 Score = 86.7 bits (213),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDT  208



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   236 bits (601),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIV LT
Sbjct  216  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVELT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    
Sbjct  276  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VH  333

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE+ EIADA
Sbjct  334  PELVLAAAESAEIADA  349


 Score = 92.4 bits (228),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  215



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   241 bits (615),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEA++VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  222  QSCMDPNVMEARVVVSSCGHDGPFGATGVKRLKGIGMIDSVPGMKALDMNAAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVA  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +E  
Sbjct  282  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIGAEAV  341

Query  185  APELILASAENEEIADA  135
             PEL+LAS++  EI DA
Sbjct  342  QPELVLASSDAGEIVDA  358


 Score = 87.0 bits (214),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  178  MSRLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  221



>gb|KHN47860.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=178

 Score =   236 bits (601),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIV+LT
Sbjct  45   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVKLT  104

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    
Sbjct  105  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VH  162

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE+ EIADA
Sbjct  163  PELVLAAAESAEIADA  178


 Score = 92.0 bits (227),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT
Sbjct  1    MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  44



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   240 bits (612),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  215  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VA  186
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG  NA+DG+      
Sbjct  275  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGRE  334

Query  185  APELILASAENEEIADA  135
             P+LILASA+ EEI DA
Sbjct  335  EPQLILASADTEEIVDA  351


 Score = 87.0 bits (214),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  171  MSRLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  214



>gb|ABK95834.1| unknown [Populus trichocarpa]
Length=278

 Score =   242 bits (618),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  145  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  204

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    
Sbjct  205  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQ  262

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE  +  DA
Sbjct  263  PELVLAAAEAGDTVDA  278


 Score = 85.1 bits (209),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNH+T
Sbjct  101  MSKLLARPNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHNT  144



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score =   240 bits (612),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  216  QSCMDPNVMEAKIVVSSCGHDGPFGDTGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA HLALKALG+PNALDG+     +
Sbjct  276  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLS  335

Query  182  PELILASAENEEIADA  135
            PEL+LA A++ E  DA
Sbjct  336  PELVLAVADSAETVDA  351


 Score = 87.4 bits (215),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  215



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  209  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  326

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  327  PELVLASAENE  337


 Score = 85.1 bits (209),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GR+ GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEGRMSGVVTNWALVSMNHDT  208



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score =   239 bits (610),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKI-VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRL  366
            QSCMDPNVMEAKI VVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRL
Sbjct  216  QSCMDPNVMEAKIIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRL  275

Query  365  TREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA  186
            TRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA HLALKALG+PNALDG+     
Sbjct  276  TREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDL  335

Query  185  APELILASAENEEIADA  135
            +PEL+LA+A++ E  DA
Sbjct  336  SPELVLAAADSAETVDA  352


 Score = 87.4 bits (215),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  215



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   239 bits (610),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  215  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VA  186
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG  NA+DG+      
Sbjct  275  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGRE  334

Query  185  APELILASAENEEIADA  135
             P+LI ASA+ EEI DA
Sbjct  335  EPQLIFASADTEEIVDA  351


 Score = 87.4 bits (215),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  171  MSRLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  214



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score =   243 bits (620),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLT
Sbjct  219  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG-SASEVA  186
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG S +E  
Sbjct  279  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNALDGISWAEKV  338

Query  185  APELILASAENEEIADA  135
             PE++LAS+E  ++ DA
Sbjct  339  HPEMVLASSEGGDVVDA  355


 Score = 83.6 bits (205),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAE LIVK GRV GVVTNWALVSMNHDT
Sbjct  175  MSRLLARPNVKLFNAVAAEGLIVKEGRVAGVVTNWALVSMNHDT  218



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (618),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  209  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  326

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  327  PELVLASAENE  337


 Score = 84.0 bits (206),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K  RV GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEDRVSGVVTNWALVSMNHDT  208



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  222  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SEV  
Sbjct  282  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEVTE  341

Query  185  -APELILASAENEEIADA  135
              PE ILA+ EN EI DA
Sbjct  342  VQPEFILAATENSEIVDA  359


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  221



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score =   241 bits (615),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  234  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  293

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+ +    
Sbjct  294  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLT--VH  351

Query  182  PELILASAENE  150
            PEL+LASAE+E
Sbjct  352  PELVLASAEDE  362


 Score = 84.3 bits (207),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNH+T
Sbjct  190  MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHNT  233



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score =   238 bits (606),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 126/137 (92%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN+AEDAIVRLT
Sbjct  223  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNSAEDAIVRLT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNAL-DGSASEVA  186
            RE+VPGMIVTGMEVAEIDGA RMGPTFGAMMISGQKAAHLALKALG PNAL DGS     
Sbjct  283  REVVPGMIVTGMEVAEIDGAARMGPTFGAMMISGQKAAHLALKALGMPNALDDGSYLGKL  342

Query  185  APELILASAENEEIADA  135
             PEL+LA+AE+ E ADA
Sbjct  343  HPELVLAAAESAETADA  359


 Score = 87.4 bits (215),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  179  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDT  222



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score =   239 bits (609),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLT
Sbjct  209  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDAVPGMKALDMNAAEDAIVRLT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG PNALDG    V  
Sbjct  269  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGLPNALDGGDLPVKE  328

Query  182  PELILASAENEEIADA  135
             E +LA+AE +EI +A
Sbjct  329  AEFVLAAAETDEIVEA  344


 Score = 86.7 bits (213),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  165  MSRLLARPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDT  208



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score =   239 bits (611),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  210  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLT  269

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +
Sbjct  270  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGELS  329

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  330  PELVLAAADSAETVDA  345


 Score = 85.5 bits (210),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  166  MSKLLARPNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDT  209



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  222  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SEV  
Sbjct  282  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEVTE  341

Query  185  -APELILASAENEEIADA  135
              PE +LA+ EN EI DA
Sbjct  342  VQPEFVLAATENSEIVDA  359


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  221



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score =   235 bits (599),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNA+D + +    
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNAVDHAGN--IH  334

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ +IA+A
Sbjct  335  PELVLAAADSADIAEA  350


 Score = 89.7 bits (221),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKN RVGGVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKNERVGGVVTNWALVSMNHDT  216



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score =   239 bits (611),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHL L++LG PNA+D +      
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLVLRSLGLPNAVDHAGDINTQ  336

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ EIADA
Sbjct  337  PELVLAAADSVEIADA  352


 Score = 84.7 bits (208),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            M K+LARPNVKLFNAVAAEDLIVKN RV GVVTNWALVSMNHDT
Sbjct  173  MGKILARPNVKLFNAVAAEDLIVKNDRVAGVVTNWALVSMNHDT  216



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score =   235 bits (599),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNA+D + +    
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNAVDHAGN--IH  334

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ +IA+A
Sbjct  335  PELVLAAADSADIAEA  350


 Score = 89.4 bits (220),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKN RVGGVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKNERVGGVVTNWALVSMNHDT  216



>emb|CDP05793.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   237 bits (604),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVSSCGHDGPFGATGVKRLKSIGMI++VPGMKALDMN AEDAIVRLT
Sbjct  145  QSCMDPNVVEAKVVVSSCGHDGPFGATGVKRLKSIGMIENVPGMKALDMNAAEDAIVRLT  204

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALDG+ +    
Sbjct  205  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDGTYAGSIH  264

Query  182  PELILASAENEEIADA  135
            PELILA+A+  E  DA
Sbjct  265  PELILAAADASETVDA  280


 Score = 87.4 bits (215),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALVSMNHDT
Sbjct  101  MSKLLARPNVKLFNAVAAEDLIVKGSRVGGVVTNWALVSMNHDT  144



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score =   232 bits (591),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLT
Sbjct  226  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDRVPGMKALDMNTAEDAIVRLT  285

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD-GSASEVA  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL +LG PNA+D  +A+   
Sbjct  286  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALGSLGLPNAVDKNNAAGKI  345

Query  185  APELILASA-ENEEIADA  135
             PEL+LA+A E+ EIADA
Sbjct  346  HPELVLAAATESAEIADA  363


 Score = 92.0 bits (227),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT
Sbjct  182  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  225



>gb|ABK21260.1| unknown [Picea sitchensis]
Length=179

 Score =   239 bits (611),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  45   QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  104

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+ +    
Sbjct  105  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLT--VH  162

Query  182  PELILASAENE  150
            PEL+LASAE+E
Sbjct  163  PELVLASAEDE  173


 Score = 84.0 bits (206),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNH+T
Sbjct  1    MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHNT  44



>gb|KHN15802.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=181

 Score =   237 bits (605),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  45   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  104

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VA  186
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG  NA+DG+      
Sbjct  105  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGRE  164

Query  185  APELILASAENEEIADA  135
             P+LILASA+ EEI DA
Sbjct  165  EPQLILASADTEEIVDA  181


 Score = 86.3 bits (212),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  1    MSRLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  44



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score =   235 bits (599),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 3/139 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLT
Sbjct  213  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS---ASE  192
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+   A  
Sbjct  273  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAPS  332

Query  191  VAAPELILASAENEEIADA  135
               PELILAS ++ E  DA
Sbjct  333  ATHPELILASKDDGETVDA  351


 Score = 87.8 bits (216),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  169  MSRLLARPNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDT  212



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   239 bits (609),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGNLS  336

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  337  PELVLAAADSAETVDA  352


 Score = 84.0 bits (206),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDT  216



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score =   237 bits (604),  Expect(2) = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIV+LT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVKLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      
Sbjct  282  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGMPNALDGTFVGGIH  341

Query  182  PELILASAENEEIAD  138
            PELILA+ E+ +IA+
Sbjct  342  PELILAAVESADIAE  356


 Score = 84.7 bits (208),  Expect(2) = 6e-79, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGG+VTN ALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKEGRVGGLVTNXALVSMNHDT  221



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score =   239 bits (609),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  215  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +
Sbjct  275  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGNLS  334

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  335  PELVLAAADSAETVDA  350


 Score = 82.4 bits (202),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NHD+
Sbjct  171  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDS  214



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score =   236 bits (602),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLT
Sbjct  223  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVA  186
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLALK+LG PNALDG+  +E  
Sbjct  283  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMVSGQKAAHLALKSLGRPNALDGTIGAEKV  342

Query  185  APELILASAENEEIADA  135
             PE++LAS++  ++ +A
Sbjct  343  HPEMVLASSDGGDVVEA  359


 Score = 85.1 bits (209),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRV GVVTNWALVSMNHDT
Sbjct  179  MSRLLARPNVKLFNAVAVEDLIVKEGRVAGVVTNWALVSMNHDT  222



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   234 bits (597),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 4/140 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLT
Sbjct  216  QSCMDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA
Sbjct  276  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAA  335

Query  182  ----PELILASAENEEIADA  135
                PELILAS ++ EI DA
Sbjct  336  AAAHPELILASKDDGEIVDA  355


 Score = 87.0 bits (214),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  172  MSRLLARPNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDT  215



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score =   234 bits (596),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 4/140 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLT
Sbjct  213  QSCMDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA
Sbjct  273  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAA  332

Query  182  ----PELILASAENEEIADA  135
                PELILAS ++ EI DA
Sbjct  333  AAAHPELILASKDDGEIVDA  352


 Score = 87.4 bits (215),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  169  MSRLLARPNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDT  212



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score =   242 bits (617),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 2/131 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  217  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  
Sbjct  277  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--  334

Query  182  PELILASAENE  150
            PEL+LASAENE
Sbjct  335  PELVLASAENE  345


 Score = 79.0 bits (193),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 8/52 (15%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGR--------VGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GR        V GVVTNWALVSMNHDT
Sbjct  165  MSKVLARPNVKLFNAVAAEDLIIKEGRMLSYCEGLVSGVVTNWALVSMNHDT  216



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score =   234 bits (596),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 5/141 (4%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLT
Sbjct  213  QSCMDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA
Sbjct  273  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAA  332

Query  182  -----PELILASAENEEIADA  135
                 PELILAS ++ EI DA
Sbjct  333  AAAAHPELILASKDDGEIVDA  353


 Score = 87.4 bits (215),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  169  MSRLLARPNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDT  212



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score =   238 bits (607),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  216  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +
Sbjct  276  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLS  335

Query  182  PELILASAENEEIADA  135
            PEL+LA+AE+ E  DA
Sbjct  336  PELVLAAAESAETVDA  351


 Score = 82.8 bits (203),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NHD+
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDS  215



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score =   241 bits (616),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGA GVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  220  QSCMDPNVMEAKVVVSSCGHDGPFGAAGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  279

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      
Sbjct  280  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGMPNAIDGTLKAGYL  339

Query  182  PELILASAENEE  147
            PEL+LASAE++E
Sbjct  340  PELVLASAEDDE  351


 Score = 79.7 bits (195),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K  +V GVVTNWALVSMNH T
Sbjct  176  MSKVLARPNVKLFNAVAAEDLIIKEDKVAGVVTNWALVSMNHHT  219



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score =   241 bits (615),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGA GVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  220  QSCMDPNVMEAKVVVSSCGHDGPFGAAGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  279

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      
Sbjct  280  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGMPNAIDGTLKAGYL  339

Query  182  PELILASAENEE  147
            PEL+LASAE++E
Sbjct  340  PELVLASAEDDE  351


 Score = 79.7 bits (195),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K  +V GVVTNWALVSMNH T
Sbjct  176  MSKVLARPNVKLFNAVAAEDLIIKEDKVAGVVTNWALVSMNHHT  219



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score =   239 bits (609),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  214  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLS  333

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  334  PELVLAAADSAETVDA  349


 Score = 81.3 bits (199),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NH T
Sbjct  170  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHT  213



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   235 bits (599),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 1/130 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  223  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKGIGMIDSVPGMKALDMNAAEDAIVRLT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVA  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHL LKALG PNALDG+  +E  
Sbjct  283  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLTLKALGRPNALDGTTRAEPL  342

Query  185  APELILASAE  156
             PEL+LASA+
Sbjct  343  HPELVLASAD  352


 Score = 84.7 bits (208),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +S+L+ARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  179  LSRLIARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  222



>gb|EYU27823.1| hypothetical protein MIMGU_mgv1a009995mg [Erythranthe guttata]
Length=325

 Score =   239 bits (610),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 127/139 (91%), Gaps = 3/139 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMI+SVPGMKALDMNTAEDAIVRLT
Sbjct  187  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVRLT  246

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS---E  192
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG PNALD S +   E
Sbjct  247  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGLPNALDVSYAGGVE  306

Query  191  VAAPELILASAENEEIADA  135
             A PE ILASA+++   DA
Sbjct  307  TAQPEFILASADSDVSVDA  325


 Score = 80.5 bits (197),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLA+PNVKLFNAVAAEDLIVK GRV GVVTNWALV+ NH T
Sbjct  143  MSKLLAKPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVAQNHHT  186



>emb|CAJ91138.1| thiamin biosynthetic enzyme [Platanus x acerifolia]
Length=171

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 132/138 (96%), Gaps = 2/138 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  34   QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  93

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S++ +
Sbjct  94   REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNAMDGNYSDMGS  153

Query  182  --PELILASAENEEIADA  135
              PELILA+AE+ +IADA
Sbjct  154  IHPELILAAAESGDIADA  171


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  636  NAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            NAVAAEDLIVK GRV GVVTNWALVSMNH T
Sbjct  3    NAVAAEDLIVKEGRVAGVVTNWALVSMNHGT  33



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score =   237 bits (604),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  413  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLT  472

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +
Sbjct  473  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLS  532

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  533  PELVLAAADSAETVDA  548


 Score = 82.4 bits (202),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NHD+
Sbjct  369  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDS  412


 Score = 82.4 bits (202),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NHD+
Sbjct  171  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDS  214


 Score = 39.3 bits (90),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 8/70 (11%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIV--R  369
            QSCMDPNVMEAKIVV S G     G+  V R  + G       + A   +  +++IV   
Sbjct  215  QSCMDPNVMEAKIVVISIGLKPRSGSVSV-RASTAGY-----DLNAFTFDPIKESIVSRE  268

Query  368  LTREIVPGMI  339
            +TR  +  MI
Sbjct  269  MTRRYMTDMI  278



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score =   236 bits (603),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  216  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +
Sbjct  276  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLS  335

Query  182  PELILASAENEEIADA  135
            PEL+LA+A++ E  DA
Sbjct  336  PELVLAAADSAETVDA  351


 Score = 82.4 bits (202),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NHD+
Sbjct  172  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDS  215



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score =   231 bits (590),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGP GATGVKRLKSIGMI+ VPGMKALDMN AEDAIVRLT
Sbjct  224  QSCMDPNVMEAKIVVSSCGHDGPMGATGVKRLKSIGMINHVPGMKALDMNAAEDAIVRLT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     
Sbjct  284  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIH  343

Query  182  PELIL  168
            PELIL
Sbjct  344  PELIL  348


 Score = 87.4 bits (215),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVA EDLIVKNGRVGGVVTNW+LVS NHDT
Sbjct  180  MSKLLARPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDT  223



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score =   231 bits (590),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGP GATGVKRLKSIGMI+ VPGMKALDMN AEDAIVRLT
Sbjct  223  QSCMDPNVMEAKIVVSSCGHDGPMGATGVKRLKSIGMINHVPGMKALDMNAAEDAIVRLT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     
Sbjct  283  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIH  342

Query  182  PELIL  168
            PELIL
Sbjct  343  PELIL  347


 Score = 87.4 bits (215),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVA EDLIVKNGRVGGVVTNW+LVS NHDT
Sbjct  179  MSKLLARPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDT  222



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score =   231 bits (590),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMN AEDAIVRLT
Sbjct  219  QSCMDPNVMEAKIVVSSCGHDGPMGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     
Sbjct  279  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAETSVL  338

Query  182  PELIL  168
            PEL+L
Sbjct  339  PELML  343


 Score = 87.4 bits (215),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVA EDLIVKNGRVGGVVTNW+LVS NHDT
Sbjct  175  MSKLLARPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDT  218



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score =   236 bits (603),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 125/139 (90%), Gaps = 3/139 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMID+VPGMKALDMN AEDAIVRLT
Sbjct  214  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIDTVPGMKALDMNMAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS---ASE  192
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PN +DG+   A+ 
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNATP  333

Query  191  VAAPELILASAENEEIADA  135
               PE++LASA N ++ DA
Sbjct  334  ALHPEMVLASANNGDVVDA  352


 Score = 82.4 bits (202),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK  RV GVVTNWALVSMNHDT
Sbjct  170  MSRLLARPNVKLFNAVAVEDLIVKEDRVAGVVTNWALVSMNHDT  213



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score =   235 bits (600),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 3/139 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLT
Sbjct  210  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIQAVPGMKALDMNTAEDAIVRLT  269

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PN +DG+   V  
Sbjct  270  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNVTP  329

Query  185  --APELILASAENEEIADA  135
               PE+ILA+  N +I DA
Sbjct  330  ALHPEMILAATNNGDIVDA  348


 Score = 82.8 bits (203),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK  RV GVVTNWALVSMNHDT
Sbjct  166  MSRLLARPNVKLFNAVAVEDLIVKENRVAGVVTNWALVSMNHDT  209



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score =   229 bits (585),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+S+GMIDSVPGMKALDMNTAED IVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSVGMIDSVPGMKALDMNTAEDEIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      
Sbjct  277  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGTYIGNLH  336

Query  182  PELIL  168
            PEL+L
Sbjct  337  PELVL  341


 Score = 88.6 bits (218),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI+K G+VGGVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIIKEGKVGGVVTNWALVSMNHDT  216



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score =   230 bits (587),  Expect(2) = 9e-78, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  214  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS---E  192
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+A    +
Sbjct  274  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTAQTVPQ  333

Query  191  VAAPELILASAENEEIADA  135
            V   E ++AS +++E+ DA
Sbjct  334  VWREEFVIAS-KDDEVVDA  351


 Score = 87.8 bits (216),  Expect(2) = 9e-78, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  170  MSRLLARPNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDT  213



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score =   230 bits (587),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMN AEDAIVRLT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     
Sbjct  282  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAETSIL  341

Query  182  PELIL  168
            PEL+L
Sbjct  342  PELML  346


 Score = 87.4 bits (215),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVA EDLIVKNGRVGGVVTNW+LVS NHDT
Sbjct  178  MSKLLARPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDT  221



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   228 bits (581),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMNTAEDAIV+LT
Sbjct  224  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNTAEDAIVKLT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      
Sbjct  284  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQ  343

Query  182  PELIL  168
            PELIL
Sbjct  344  PELIL  348


 Score = 89.7 bits (221),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI+K GRVGGVVTNWALVSMNHDT
Sbjct  180  MSKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDT  223



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score =   231 bits (589),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL++IGMI+SVPGMKALDMN AEDAIVRLT
Sbjct  219  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRNIGMIESVPGMKALDMNVAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S    
Sbjct  279  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNAVDGTYSLGGV  338

Query  182  -PELILASAENEEIADA  135
             PEL+LAS+   E A A
Sbjct  339  HPELVLASSAEGETASA  355


 Score = 86.7 bits (213),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  175  MSRLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDT  218



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score =   235 bits (599),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 3/139 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLT
Sbjct  210  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIQAVPGMKALDMNTAEDAIVRLT  269

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PN +DG+   V  
Sbjct  270  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNVTP  329

Query  185  --APELILASAENEEIADA  135
               PE+ILA+  N +I DA
Sbjct  330  ALHPEMILAATNNGDIVDA  348


 Score = 82.4 bits (202),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK  RV GVVTNWALVSMNHDT
Sbjct  166  MSRLLARPNVKLFNAVAVEDLIVKEDRVAGVVTNWALVSMNHDT  209



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score =   230 bits (586),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGP GATGVKRLKSIGMI+ VPGMKAL+MN AEDAIVRLT
Sbjct  223  QSCMDPNVMEAKIVVSSCGHDGPMGATGVKRLKSIGMINHVPGMKALNMNAAEDAIVRLT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     
Sbjct  283  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIH  342

Query  182  PELIL  168
            PELIL
Sbjct  343  PELIL  347


 Score = 87.4 bits (215),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVA EDLIVKNGRVGGVVTNW+LVS NHDT
Sbjct  179  MSKLLARPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDT  222



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   227 bits (578),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LT
Sbjct  224  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      
Sbjct  284  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQ  343

Query  182  PELIL  168
            PELIL
Sbjct  344  PELIL  348


 Score = 89.7 bits (221),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI+K GRVGGVVTNWALVSMNHDT
Sbjct  180  MSKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDT  223



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   225 bits (574),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLT
Sbjct  212  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLT  271

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    
Sbjct  272  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VH  329

Query  182  PELIL  168
            PEL+L
Sbjct  330  PELVL  334


 Score = 90.9 bits (224),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVS+NHDT
Sbjct  168  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSLNHDT  211



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score =   233 bits (595),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLT
Sbjct  213  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDAIVRLT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG---SASE  192
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG   +AS+
Sbjct  273  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTTQTASQ  332

Query  191  VAAPELILASAENEEIADA  135
                EL++AS +++E+ DA
Sbjct  333  AWREELVMAS-KDDEVVDA  350


 Score = 82.8 bits (203),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVAAEDLIVK GRV GVVTNWALV+MNH T
Sbjct  169  MSRLLARPNVKLFNAVAAEDLIVKQGRVAGVVTNWALVAMNHGT  212



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   230 bits (586),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLT
Sbjct  219  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLAL++LG  NALDG  S+   
Sbjct  279  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMLSGQKAAHLALRSLGLDNALDG--SDNLQ  336

Query  182  PELILASAENEEIADA  135
            PEL LASAE+ E+ DA
Sbjct  337  PELQLASAESSEVVDA  352


 Score = 86.3 bits (212),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNH+T
Sbjct  175  MSKLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHNT  218



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   225 bits (574),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLT
Sbjct  212  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLT  271

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    
Sbjct  272  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VH  329

Query  182  PELIL  168
            PEL+L
Sbjct  330  PELVL  334


 Score = 90.9 bits (224),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVS+NHDT
Sbjct  168  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSLNHDT  211



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   229 bits (584),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMIDSVPGMKALDMN AEDAIV+LT
Sbjct  225  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIDSVPGMKALDMNAAEDAIVKLT  284

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      
Sbjct  285  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQ  344

Query  182  PELIL  168
            PELIL
Sbjct  345  PELIL  349


 Score = 86.3 bits (212),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI+K GRVGGVVTNW+LVS NHDT
Sbjct  181  MSKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWSLVSQNHDT  224



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   229 bits (584),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLT
Sbjct  219  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLAL++LG  NALDG  S+   
Sbjct  279  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMLSGQKAAHLALRSLGLDNALDG--SDNLQ  336

Query  182  PELILASAENEEIADA  135
            PEL LASAE+ E+ DA
Sbjct  337  PELQLASAESSEVVDA  352


 Score = 86.3 bits (212),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNH+T
Sbjct  175  MSKLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHNT  218



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score =   246 bits (627),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 128/137 (93%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  217  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNAAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVA  186
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDGS+     
Sbjct  277  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGSSVGSNI  336

Query  185  APELILASAENEEIADA  135
             PELILA+AEN EIADA
Sbjct  337  HPELILAAAENAEIADA  353


 Score = 69.3 bits (168),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  216



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   227 bits (578),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LT
Sbjct  224  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      
Sbjct  284  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQ  343

Query  182  PELIL  168
            PELIL
Sbjct  344  PELIL  348


 Score = 87.8 bits (216),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNHDT
Sbjct  180  MSKLLARPNVKLFNAVAAEDLIIKGGRVAGVVTNWALVSMNHDT  223



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   227 bits (578),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+ 
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSP  337

Query  182  P---ELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  338  ALREEFVIAS-KDDEVVDA  355


 Score = 86.7 bits (213),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  174  MSALLARPNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDT  217



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   227 bits (578),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+ 
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSP  337

Query  182  P---ELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  338  ALREEFVIAS-KDDEVVDA  355


 Score = 86.7 bits (213),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  174  MSALLARPNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDT  217



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   227 bits (578),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+ 
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSP  337

Query  182  P---ELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  338  ALREEFVIAS-KDDEVVDA  355


 Score = 86.7 bits (213),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  174  MSALLARPNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDT  217



>gb|KHN46540.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=178

 Score =   223 bits (569),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLT
Sbjct  45   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLT  104

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    
Sbjct  105  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VH  162

Query  182  PELIL  168
            PEL+L
Sbjct  163  PELVL  167


 Score = 90.1 bits (222),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVS+NHDT
Sbjct  1    MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSLNHDT  44



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score =   226 bits (575),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 5/136 (4%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH+AL++LG  N + GS      
Sbjct  282  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHIALQSLGLANNV-GSIH----  336

Query  182  PELILASAENEEIADA  135
            PE++LA+ ++ EI DA
Sbjct  337  PEMVLAAVDDAEILDA  352


 Score = 87.8 bits (216),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNHDT
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDT  221



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score =   244 bits (622),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT
Sbjct  223  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL++LG PNALDG+      
Sbjct  283  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALQSLGLPNALDGTYVGNIH  342

Query  182  PELILASAENEEIADA  135
            PELILA+A++ E ADA
Sbjct  343  PELILAAADSAETADA  358


 Score = 69.3 bits (168),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  179  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  222



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score =   227 bits (578),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+ 
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSP  337

Query  185  --APELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  338  ALREEFVIAS-KDDEVVDA  355


 Score = 85.5 bits (210),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIV+ GRVGGVVTNWALVSMNHDT
Sbjct  174  MSALLARPNVKLFNAVAVEDLIVRQGRVGGVVTNWALVSMNHDT  217



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score =   223 bits (568),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLT
Sbjct  214  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNAL+   +    
Sbjct  274  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALESVGN--VH  331

Query  182  PELIL  168
            PEL+L
Sbjct  332  PELVL  336


 Score = 89.4 bits (220),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  170  MSKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  213



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score =   242 bits (618),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLT
Sbjct  221  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLT  280

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNALDG+      
Sbjct  281  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVH  340

Query  182  PELILASAENEEIADA  135
            PELILA+A++ E ADA
Sbjct  341  PELILAAADSAETADA  356


 Score = 69.3 bits (168),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  177  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  220



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score =   242 bits (618),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVK L+SIGMID+VPGMKALDMN AEDAIVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDGS      
Sbjct  277  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIH  336

Query  182  PELILASAENEEIADA  135
            PELILA+A++ EIADA
Sbjct  337  PELILAAADSAEIADA  352


 Score = 69.3 bits (168),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  173  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  216



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score =   222 bits (565),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLT
Sbjct  214  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNAL+   +    
Sbjct  274  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALESVGN--VH  331

Query  182  PELIL  168
            PEL+L
Sbjct  332  PELVL  336


 Score = 89.4 bits (220),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  170  MSKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  213



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   227 bits (578),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+ 
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSP  337

Query  185  --APELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  338  ALREEFVIAS-KDDEVVDA  355


 Score = 84.3 bits (207),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            M  LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  174  MRALLARPNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDT  217



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score =   221 bits (563),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LT
Sbjct  224  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALD S      
Sbjct  284  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGXPNALDESYVGGXX  343

Query  182  PELILASAENEEIA  141
               I  +  + EIA
Sbjct  344  XXXIJXAXXSAEIA  357


 Score = 89.7 bits (221),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI+K GRVGGVVTNWALVSMNHDT
Sbjct  180  MSKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDT  223



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score =   241 bits (614),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLT
Sbjct  221  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLT  280

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNALDG+      
Sbjct  281  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVH  340

Query  182  PELILASAENEEIAD  138
            PELILA+A++ E AD
Sbjct  341  PELILAAADSAETAD  355


 Score = 69.3 bits (168),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  177  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  220



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score =   241 bits (614),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMNTAEDAIV+LT
Sbjct  225  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVKLT  284

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDGS      
Sbjct  285  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGSYVGSIQ  344

Query  182  PELILASAENEEIADA  135
            PELILA+A++ EIA+A
Sbjct  345  PELILAAADSAEIAEA  360


 Score = 69.3 bits (168),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  181  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  224



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score =   241 bits (614),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLT
Sbjct  221  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLT  280

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL +LG+PNALDG+      
Sbjct  281  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALNSLGQPNALDGTYVGGVH  340

Query  182  PELILASAENEEIADA  135
            PELILA+A++ E ADA
Sbjct  341  PELILAAADSAETADA  356


 Score = 69.3 bits (168),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  177  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  220



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   224 bits (570),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLT
Sbjct  219  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLT  278

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLAL++ G  NALD   S+   
Sbjct  279  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMLSGQKAAHLALRSFGLDNALD--RSDNLQ  336

Query  182  PELILASAENEEIADA  135
            PEL LAS E+ E+ DA
Sbjct  337  PELQLASVEDAEVVDA  352


 Score = 85.9 bits (211),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRV GVVTNWALVSMNH+T
Sbjct  175  MSKLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHNT  218



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score =   223 bits (568),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 124/139 (89%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVR T
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRHT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNA+DG+  +V+ 
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALQALGRPNAVDGTIPKVSP  337

Query  185  --APELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  338  ALREEFVIAS-KDDEVVDA  355


 Score = 86.7 bits (213),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  174  MSALLARPNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDT  217



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score =   225 bits (574),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVSS GHDGPFGATGVKRLK IGMIDSVPGMKA+DMN AEDAIVRLT
Sbjct  221  QSCMDPNVVEAKVVVSSYGHDGPFGATGVKRLKDIGMIDSVPGMKAVDMNAAEDAIVRLT  280

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVA  186
            +EIVPGMI+TGME AEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG+  +E  
Sbjct  281  KEIVPGMIITGMEDAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNALDGTIGTEKV  340

Query  185  APELILASAEN  153
             PE++LAS+++
Sbjct  341  QPEMVLASSDD  351


 Score = 84.0 bits (206),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLA PNVKLFNA+AAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  177  MSRLLAWPNVKLFNAMAAEDLIVKEGRVGGVVTNWALVSMNHDT  220



>gb|ACN66755.1| thiazole biosynthetic enzyme [Carica papaya]
Length=192

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRL 
Sbjct  57   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNVAEDAIVRLA  116

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+ +    
Sbjct  117  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGLPNAVDGTYAGGLH  176

Query  182  PELILASAENEEIADA  135
            PEL+LA+ E+ E A+A
Sbjct  177  PELVLAAGESAETAEA  192


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  13   MSKILARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  56



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score =   222 bits (565),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI +VPGMKALDMN AEDAIVRLT
Sbjct  166  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIQNVPGMKALDMNQAEDAIVRLT  225

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAM+ISGQKAAHLALK+L  PNA+D + S +  
Sbjct  226  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMIISGQKAAHLALKSLNLPNAIDQNHSPLPF  285

Query  182  PELILA  165
            PEL+ A
Sbjct  286  PELVPA  291


 Score = 84.7 bits (208),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  122  MSKLLARPNVKLFNAVAAEDLIVKGDRVAGVVTNWALVSMNHDT  165



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   229 bits (583),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ T
Sbjct  209  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN LDG+      
Sbjct  269  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKLNVH  328

Query  182  PELILASAENE  150
            PEL+LAS ++E
Sbjct  329  PELVLASTDDE  339


 Score = 77.4 bits (189),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI++  RV GVVTNWALV+ NH+T
Sbjct  165  MSKLLARPNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNT  208



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   229 bits (583),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ T
Sbjct  223  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN LDG+      
Sbjct  283  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKPNVH  342

Query  182  PELILASAENE  150
            PEL+LAS ++E
Sbjct  343  PELVLASTDDE  353


 Score = 77.4 bits (189),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI++  RV GVVTNWALV+ NH+T
Sbjct  179  MSKLLARPNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNT  222



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   229 bits (583),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ T
Sbjct  222  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN LDG+      
Sbjct  282  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKPNVH  341

Query  182  PELILASAENE  150
            PEL+LAS ++E
Sbjct  342  PELVLASTDDE  352


 Score = 77.4 bits (189),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI++  RV GVVTNWALV+ NH+T
Sbjct  178  MSKLLARPNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNT  221



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score =   236 bits (603),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMN AEDAIV LT
Sbjct  225  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSIGMIESVPGMKALDMNAAEDAIVELT  284

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDGS      
Sbjct  285  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGSYVGSIQ  344

Query  182  PELILASAENEEIADA  135
            PELILA+A++ EIA+A
Sbjct  345  PELILAAADSAEIAEA  360


 Score = 69.3 bits (168),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  181  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  224



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   226 bits (577),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ T
Sbjct  224  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN +DG+      
Sbjct  284  REIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNEVDGNYKPNVH  343

Query  182  PELILASAEN  153
            PEL+LAS ++
Sbjct  344  PELVLASTDD  353


 Score = 77.4 bits (189),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI++  RV GVVTNWALV+ NH+T
Sbjct  180  MSKLLARPNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNT  223



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score =   222 bits (565),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLT
Sbjct  170  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLT  229

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS  201
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+
Sbjct  230  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGT  283


 Score = 80.5 bits (197),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGGVVTNWALV+ NH T
Sbjct  126  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHT  169



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   224 bits (572),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ T
Sbjct  223  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG PN +DG+      
Sbjct  283  REVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGLPNEVDGNYKPNVH  342

Query  182  PELILASAEN  153
            PEL+LAS ++
Sbjct  343  PELVLASTDD  352


 Score = 77.4 bits (189),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI++  RV GVVTNWALV+ NH+T
Sbjct  179  MSKLLARPNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNT  222



>emb|CCJ09780.1| putative thiazole biosynthetic enzyme, partial [Hirudo medicinalis]
Length=242

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMNTAEDAIVRLT
Sbjct  106  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNTAEDAIVRLT  165

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ LG PN LDG+      
Sbjct  166  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRTLGLPNELDGTNVGNVQ  225

Query  182  PELILASAEN-EEIADA  135
            P+L LA+A++  EI +A
Sbjct  226  PKLTLAAADDGNEIVEA  242


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFN VAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  62   MSRLLARPNVKLFNTVAAEDLIVKGGRVGGVVTNWALVSMNHDT  105



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score =   209 bits (531),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 114/136 (84%), Gaps = 12/136 (9%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGV+            GMKALDMNTAEDAIV+LT
Sbjct  229  QSCMDPNVMEAKVVVSSCGHDGPFGATGVR------------GMKALDMNTAEDAIVKLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIV GMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DG+      
Sbjct  277  REIVPGMIVAGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNAMDGTYVGSIH  336

Query  182  PELILASAENEEIADA  135
            PEL+LA++   EIADA
Sbjct  337  PELVLAASSPAEIADA  352


 Score = 85.9 bits (211),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGG+VTNWALVSMNHD+
Sbjct  185  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGIVTNWALVSMNHDS  228



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score =   208 bits (529),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 114/136 (84%), Gaps = 11/136 (8%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATG           SVPGMKALDMNTAEDAIV+LT
Sbjct  229  QSCMDPNVMEAKVVVSSCGHDGPFGATG-----------SVPGMKALDMNTAEDAIVKLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIV GMEVAEIDGA RMGPTFGAMMISGQKAAHLALK+LG+PNA+DG+      
Sbjct  278  REIVPGMIVAGMEVAEIDGALRMGPTFGAMMISGQKAAHLALKSLGQPNAMDGTYVGSIH  337

Query  182  PELILASAENEEIADA  135
            PEL+LA++   EIADA
Sbjct  338  PELVLAASSPAEIADA  353


 Score = 85.9 bits (211),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RVGG+VTNWALVSMNHD+
Sbjct  185  MSKLLARPNVKLFNAVAAEDLIVKGNRVGGIVTNWALVSMNHDS  228



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score =   226 bits (577),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 6/140 (4%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMNTAED IVRLT
Sbjct  215  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISDVPGMKALDMNTAEDEIVRLT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V +
Sbjct  275  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTI-KVVS  333

Query  182  P----ELILASAENEEIADA  135
            P    E ++AS +++E+ DA
Sbjct  334  PALRQEFVIAS-KDDEVVDA  352


 Score = 66.6 bits (161),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  171  MSRLLARPNVKLFNAVAVEDLIVKGGRVGGVVTNWALVSMNHDT  214



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score =   226 bits (576),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AED IVRLT
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  EV+ 
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSP  337

Query  185  --APELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  338  ALREEFVIAS-KDDEVVDA  355


 Score = 66.6 bits (161),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIV+ GRVGGVVTNWALVSMNHDT
Sbjct  174  MSRLLARPNVKLFNAVAVEDLIVRRGRVGGVVTNWALVSMNHDT  217



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score =   226 bits (577),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 4/140 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            Q  MDPNVME K+VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLT
Sbjct  213  QPGMDPNVMEFKVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA
Sbjct  273  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAA  332

Query  182  ----PELILASAENEEIADA  135
                PELILAS ++ EI DA
Sbjct  333  AAAHPELILASKDDGEIVDA  352


 Score = 66.2 bits (160),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVG VVTN      +HDT
Sbjct  169  MSRLLARPNVKLFNAVAVEDLIVKKGRVGRVVTNLGACVNDHDT  212



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score =   226 bits (576),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AED IVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  EV+ 
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSP  336

Query  185  --APELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  337  ALREEFVIAS-KDDEVVDA  354


 Score = 66.6 bits (161),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIV+ GRVGGVVTNWALVSMNHDT
Sbjct  173  MSRLLARPNVKLFNAVAVEDLIVRRGRVGGVVTNWALVSMNHDT  216



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score =   228 bits (581),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  173  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  232

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S    
Sbjct  233  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLR  292

Query  182  PELILASAENEEIADA  135
             EL++A  +++E+ DA
Sbjct  293  EELMIAY-KDDEVVDA  307


 Score = 64.3 bits (155),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIV+ GRVGGVVTNWALVSMNHDT
Sbjct  129  MSLLLARPNVKLFNAVAVEDLIVRGGRVGGVVTNWALVSMNHDT  172



>gb|ACF85447.1| unknown [Zea mays]
Length=143

 Score =   223 bits (567),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AED IVRLT
Sbjct  6    QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLT  65

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  EV+ 
Sbjct  66   REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSP  125

Query  185  --APELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  126  ALREEFVIAS-KDDEVVDA  143



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score =   228 bits (580),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  220  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  279

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S    
Sbjct  280  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLR  339

Query  182  PELILASAENEEIADA  135
             EL++A  +++E+ DA
Sbjct  340  EELMIAY-KDDEVVDA  354


 Score = 64.7 bits (156),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIV+ GRVGGVVTNWALVSMNHDT
Sbjct  176  MSLLLARPNVKLFNAVAVEDLIVRGGRVGGVVTNWALVSMNHDT  219



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score =   222 bits (565),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 109/111 (98%), Gaps = 0/111 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR T
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRFT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNAL  210
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LGE N++
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGEANSI  328


 Score = 69.3 bits (168),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  174  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  217



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score =   221 bits (564),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMNTAEDAIVR T
Sbjct  218  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNTAEDAIVRFT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG  204
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LGE N++ G
Sbjct  278  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGEANSIGG  330


 Score = 69.3 bits (168),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  174  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  217



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score =   226 bits (577),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AEDAIVRLT
Sbjct  217  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIAAVPGMKALDMNAAEDAIVRLT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-  186
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+ 
Sbjct  277  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSP  336

Query  185  --APELILASAENEEIADA  135
                E ++AS +++E+ DA
Sbjct  337  ALREEFVIAS-KDDEVVDA  354


 Score = 64.3 bits (155),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS +LARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  173  MSAVLARPNVKLFNAVAVEDLIVKGGRVGGVVTNWALVSMNHDT  216



>gb|AHN11672.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11673.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11675.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11676.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11682.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11683.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11684.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11686.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11687.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11694.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11695.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11698.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11699.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11706.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11707.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11710.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11712.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11717.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11718.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11719.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11720.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11721.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11722.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11730.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11731.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11732.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11734.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11740.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11742.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11743.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11744.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11749.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11751.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11752.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11756.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   199 bits (507),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLT
Sbjct  44   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLT  103

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  246
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH
Sbjct  104  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  142


 Score = 86.7 bits (213),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  672  SKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            SKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  1    SKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  43



>gb|AGZ80417.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80423.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80424.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80426.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80427.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80429.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80430.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   196 bits (498),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 95/98 (97%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLT
Sbjct  48   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLT  107

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  249
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA
Sbjct  108  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  145


 Score = 89.0 bits (219),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  4    MSKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  47



>gb|AHN11665.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11666.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11667.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11668.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11669.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11670.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11671.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11674.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11677.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11678.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11679.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11680.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11681.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11685.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11688.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11689.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11690.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11692.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11693.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11696.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11697.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11700.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11701.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11702.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11703.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11704.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11705.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11709.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11711.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11713.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11714.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11715.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11716.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11723.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11724.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11725.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11726.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11727.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11728.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11729.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11733.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11735.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11736.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11737.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11738.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11739.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11741.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11745.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11746.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11747.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11748.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11750.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11753.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11754.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11755.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11757.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   198 bits (504),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 95/99 (96%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLT
Sbjct  44   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLT  103

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  246
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH
Sbjct  104  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  142


 Score = 86.7 bits (213),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  672  SKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            SKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  1    SKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  43



>gb|AGZ80414.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80415.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80416.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80418.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80419.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80420.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80421.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80425.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80428.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80431.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80432.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80433.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80434.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80435.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   195 bits (496),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLT
Sbjct  48   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLT  107

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  249
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA
Sbjct  108  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  145


 Score = 89.0 bits (219),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  4    MSKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  47



>gb|AHN11691.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   196 bits (499),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLT
Sbjct  44   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLT  103

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  246
            REIVPGMIVTGMEVAEIDG PRMGPTFGAMMISGQKAAH
Sbjct  104  REIVPGMIVTGMEVAEIDGGPRMGPTFGAMMISGQKAAH  142


 Score = 86.7 bits (213),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  672  SKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            SKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  1    SKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  43



>gb|AGZ80422.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   193 bits (490),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLT
Sbjct  48   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLT  107

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  249
            REIVPGMIVTGMEVAEIDG PRMGPTFGAMMISGQKAA
Sbjct  108  REIVPGMIVTGMEVAEIDGGPRMGPTFGAMMISGQKAA  145


 Score = 88.6 bits (218),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  4    MSKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  47



>gb|AHN11708.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   194 bits (493),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VP MKALDMN AEDAIVRLT
Sbjct  44   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPRMKALDMNKAEDAIVRLT  103

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  246
            REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMIS QKAAH
Sbjct  104  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISXQKAAH  142


 Score = 86.7 bits (213),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  672  SKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            SKLLARPNVKLFNAVAAEDLIVK+G+VGGVVTNWALVSMNHDT
Sbjct  1    SKLLARPNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDT  43



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score =   211 bits (536),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 123/166 (74%), Gaps = 31/166 (19%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLT
Sbjct  220  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLT  279

Query  362  REIVPGMIVTGMEVAEIDGAPRM------------------------------GPTFGAM  273
            RE+VPGMIVTGMEVAEIDGAPRM                              GPTFGAM
Sbjct  280  REVVPGMIVTGMEVAEIDGAPRMVSSEEDNTHVIAILTESMRNMSKIVCWLLQGPTFGAM  339

Query  272  MISGQKAAHLALKALGEPNALDGSASEVAAPELILASAENEEIADA  135
            MISGQKAAHLALKALG PNA+DG+ S     EL++A  +++E+ DA
Sbjct  340  MISGQKAAHLALKALGRPNAVDGTMSPPLREELMIAY-KDDEVVDA  384


 Score = 64.3 bits (155),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS LLARPNVKLFNAVA EDLIV+ GRVGGVVTNWALVSMNHDT
Sbjct  176  MSLLLARPNVKLFNAVAVEDLIVRGGRVGGVVTNWALVSMNHDT  219



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score =   197 bits (502),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/100 (93%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLT
Sbjct  221  QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLT  280

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHL  243
            RE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA +
Sbjct  281  REVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAARM  320


 Score = 69.3 bits (168),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  177  MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDT  220



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score =   186 bits (471),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVSS GHDGP GA+GVKRL+ IG+I +VPGM ALDMN AED IVR T
Sbjct  195  QSCMDPNVIEAKVVVSSTGHDGPMGASGVKRLQKIGLIKNVPGMIALDMNAAEDGIVRNT  254

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  207
            RE+VPGM++TGMEVAE+DG PRMGPTFGAMM+SGQKAAH ALK+LG  N LD
Sbjct  255  REVVPGMVITGMEVAELDGCPRMGPTFGAMMLSGQKAAHCALKSLGLANVLD  306


 Score = 80.5 bits (197),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SKLL RPNVKLFNA+AAEDLIVKNGRV GVVTNW LV++NHDT
Sbjct  151  LSKLLMRPNVKLFNALAAEDLIVKNGRVAGVVTNWTLVTLNHDT  194



>emb|CBI23938.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  515  EAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIV  336
            +  +VVSSCGHDGPFGATGVKRL+S+GMIDSVPGMKALDMNTAED IVRLTRE+VPGMIV
Sbjct  85   DNYVVVSSCGHDGPFGATGVKRLRSVGMIDSVPGMKALDMNTAEDEIVRLTREVVPGMIV  144

Query  335  TGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  168
            TGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      PEL+L
Sbjct  145  TGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGTYIGNLHPELVL  200



>emb|CAB64776.1| thiazole biosynthetic enzyme [Brassica juncea]
Length=134

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNT EDAIVRLT
Sbjct  5    QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTVEDAIVRLT  64

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE+   MIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL +PN +DGS     +
Sbjct  65   REVDLDMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALAQPNVIDGSYVGELS  124

Query  182  PELILASAEN  153
            PEL+LA+ ++
Sbjct  125  PELVLAAPDS  134



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score =   162 bits (410),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLT
Sbjct  213  QSCMDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRM  294
            RE+VPGMIVTGMEVAEIDGAPRM
Sbjct  273  REVVPGMIVTGMEVAEIDGAPRM  295


 Score = 87.4 bits (215),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK GRVGGVVTNWALVSMNHDT
Sbjct  169  MSRLLARPNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDT  212



>ref|XP_004496859.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=360

 Score =   169 bits (429),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCM+P+ MEAK+VVSSCGHDGPFGA G+K L+ +GMID V G+ +LDMNT+E A VRLT
Sbjct  249  QSCMNPHAMEAKVVVSSCGHDGPFGANGLKMLERVGMIDFVRGINSLDMNTSEHAFVRLT  308

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  207
            +EIVPGMI+TGMEVAE+ G PR+G  FGAMMISGQK AHLAL  L + NA++
Sbjct  309  KEIVPGMIITGMEVAEMYGTPRVGLIFGAMMISGQKTAHLALMTLEKNNAIN  360


 Score = 77.8 bits (190),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHD  547
            +SKLL R N+KLFNAVAAEDLIVK GRVGGVVTNWALVSM HD
Sbjct  205  LSKLLVRSNMKLFNAVAAEDLIVKEGRVGGVVTNWALVSMKHD  247



>ref|XP_008877253.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
 ref|XP_008877254.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94050.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94051.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
Length=333

 Score =   178 bits (452),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+++S+CGHDGP GA+GVKRL++IGM+D +PGM  LDM  AEDAIV+ T
Sbjct  208  QSCMDPNVMESKVLISACGHDGPMGASGVKRLQNIGMVDHIPGMGCLDMAAAEDAIVKGT  267

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  207
            +EIVPGMIV GMEVAE++GAPRMGPTFG MMISGQKAAHLAL++LG  + LD
Sbjct  268  QEIVPGMIVAGMEVAELEGAPRMGPTFGGMMISGQKAAHLALESLGIKSHLD  319


 Score = 68.9 bits (167),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+L   N+KLFNA A EDLI+K GRVGGVVTNW LV++NH T
Sbjct  164  MSKVLKASNIKLFNATAIEDLIIKKGRVGGVVTNWTLVTLNHGT  207



>ref|XP_008616182.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
 gb|EQC30329.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
Length=334

 Score =   176 bits (447),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME K+++S+CGHDGP GA+GVKRL++IGM++++PGM  LDM  AEDAIV  T
Sbjct  209  QSCMDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVENIPGMGPLDMGAAEDAIVAGT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            +EIVPGMIV GMEVAE+DGAPRMGPTFG MMISGQKAAHLAL+ALG  + ++ + S   +
Sbjct  269  KEIVPGMIVAGMEVAELDGAPRMGPTFGGMMISGQKAAHLALEALGIKSHINPNMSFAMS  328

Query  182  P  180
            P
Sbjct  329  P  329


 Score = 70.5 bits (171),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+L   N+KLFNA A EDLI+KNGRVGGVVTNW LV++NH T
Sbjct  165  MSKVLKADNIKLFNATAIEDLIIKNGRVGGVVTNWTLVTLNHGT  208



>gb|KDO30626.1| hypothetical protein SPRG_04526 [Saprolegnia parasitica CBS 223.65]
Length=334

 Score =   176 bits (447),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME K+++S+CGHDGP GA+GVKRL++IGM++++PGM  LDM  AEDAIV  T
Sbjct  209  QSCMDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVENIPGMGPLDMGAAEDAIVAGT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            +EIVPGMIV GMEVAE+DGAPRMGPTFG MMISGQKAAHLAL+ALG  + ++ + S   +
Sbjct  269  KEIVPGMIVAGMEVAELDGAPRMGPTFGGMMISGQKAAHLALEALGIKSHINPNMSFAMS  328

Query  182  P  180
            P
Sbjct  329  P  329


 Score = 69.3 bits (168),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            M+K+L   N+KLFNA A EDLI+KNGRVGGVVTNW LV++NH T
Sbjct  165  MAKVLKADNIKLFNATAIEDLIIKNGRVGGVVTNWTLVTLNHGT  208



>ref|XP_009844132.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 ref|XP_009844133.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
 gb|ETV66357.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 gb|ETV66358.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
Length=333

 Score =   177 bits (450),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME K+++S+CGHDGP GA+GVKRL++IGM+D +PGM  LDM  AEDAIV+ T
Sbjct  208  QSCMDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVDHIPGMGCLDMGAAEDAIVKGT  267

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  207
            +EIVPGMIV GMEVAE++GAPRMGPTFG MMISGQKAAHLAL++LG  + LD
Sbjct  268  QEIVPGMIVCGMEVAELEGAPRMGPTFGGMMISGQKAAHLALESLGIKSHLD  319


 Score = 67.4 bits (163),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+L   N+KLFNA A EDLI+K G+VGGVVTNW LV++NH T
Sbjct  164  MSKVLKADNIKLFNATAIEDLIIKKGKVGGVVTNWTLVTLNHGT  207



>ref|XP_009844134.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
 gb|ETV66359.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
Length=270

 Score =   177 bits (450),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME K+++S+CGHDGP GA+GVKRL++IGM+D +PGM  LDM  AEDAIV+ T
Sbjct  145  QSCMDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVDHIPGMGCLDMGAAEDAIVKGT  204

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  207
            +EIVPGMIV GMEVAE++GAPRMGPTFG MMISGQKAAHLAL++LG  + LD
Sbjct  205  QEIVPGMIVCGMEVAELEGAPRMGPTFGGMMISGQKAAHLALESLGIKSHLD  256


 Score = 67.4 bits (163),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+L   N+KLFNA A EDLI+K G+VGGVVTNW LV++NH T
Sbjct  101  MSKVLKADNIKLFNATAIEDLIIKKGKVGGVVTNWTLVTLNHGT  144



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score =   159 bits (401),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 92/131 (70%), Gaps = 35/131 (27%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLT
Sbjct  234  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLT  293

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            RE                                 KAAHLALKALG+PNALDG+ +    
Sbjct  294  RE---------------------------------KAAHLALKALGQPNALDGTLT--VH  318

Query  182  PELILASAENE  150
            PEL+LASAE+E
Sbjct  319  PELVLASAEDE  329


 Score = 84.3 bits (207),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNAVAAEDLI+K GRV GVVTNWALVSMNH+T
Sbjct  190  MSKVLARPNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHNT  233



>gb|ABR01228.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01230.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01236.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
Length=340

 Score =   176 bits (446),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            Q CMDPNV+EAK++VSSCGHDGP GA GVKRL  +GM+++ PGM ALDMN+AEDA+V  T
Sbjct  213  QMCMDPNVIEAKVMVSSCGHDGPMGAAGVKRLAKLGMVEATPGMGALDMNSAEDAVVDRT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE  192
            REIVPGM++ GMEVAE+DG PRMGPTFGAM +SGQKAAH+AL +L     L+ +A E
Sbjct  273  REIVPGMVICGMEVAELDGCPRMGPTFGAMFMSGQKAAHVALNSLRRQQELEAAAKE  329


 Score = 66.6 bits (161),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 4/48 (8%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGR----VGGVVTNWALVSMNHDT  544
            +SK+LA PN+KLFNA AAEDLIVK  +    V G VTNW LVS+NHDT
Sbjct  165  LSKVLAAPNIKLFNATAAEDLIVKQDKRGKYVAGAVTNWTLVSLNHDT  212



>ref|XP_002784437.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER16233.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=325

 Score =   162 bits (410),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+++V+S+ GHDGP GA+GVKRL+ +G++DS+ GM ALDMN+AEDAIV  T
Sbjct  191  QSCMDPNVMESRVVISATGHDGPMGASGVKRLEKLGLVDSLRGMGALDMNSAEDAIVEGT  250

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REI PGMIV GMEVAE+ GAPRMGPTFGAMMISG KAA +A + L
Sbjct  251  REIAPGMIVAGMEVAELSGAPRMGPTFGAMMISGVKAARVAQQIL  295


 Score = 80.1 bits (196),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVKLFNA A EDLIVK GRV GVVTNW LVS+NHDT
Sbjct  147  MSKVLARPNVKLFNATAVEDLIVKGGRVSGVVTNWTLVSLNHDT  190



>emb|CEP18429.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score =   166 bits (421),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVS  GHDGP GA+GVKRL+SIG+I    GM +LDMN AED IV+ T
Sbjct  192  QSCMDPNVMEAKVVVSGTGHDGPMGASGVKRLESIGLIKENKGMLSLDMNAAEDDIVKYT  251

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  252  REVVPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  296


 Score = 75.9 bits (185),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SKLL RPNVKLFNA A EDLIVKNG+V GVVTNW LV++NH+T
Sbjct  148  LSKLLMRPNVKLFNATAVEDLIVKNGKVAGVVTNWTLVTLNHNT  191



>gb|EPB86412.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   166 bits (420),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK++VS  GHDGP GA+GVKRL+SIG+I+   GM +LDMN AED IV+ T
Sbjct  193  QSCMDPNVMEAKVIVSGTGHDGPMGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYT  252

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  253  REVVPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  297


 Score = 75.9 bits (185),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SKLL RPNVKLFNA A EDLIVKNG+V GVVTNW LV++NH+T
Sbjct  149  LSKLLMRPNVKLFNATAVEDLIVKNGKVAGVVTNWTLVTLNHNT  192



>dbj|GAN03507.1| thiamin biosynthetic enzyme [Mucor ambiguus]
Length=313

 Score =   166 bits (420),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK++VS  GHDGP GA+GVKRL+SIG+I+   GM +LDMN AED IV+ T
Sbjct  195  QSCMDPNVMEAKVIVSGTGHDGPMGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYT  254

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  255  REVVPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  299


 Score = 75.9 bits (185),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SKLL RPNVKLFNA A EDLIVKNG+V GVVTNW LV++NH+T
Sbjct  151  LSKLLMRPNVKLFNATAVEDLIVKNGKVAGVVTNWTLVTLNHNT  194



>gb|EPB91714.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   164 bits (416),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVS  GHDGP GA+GVKRL++IG+ID   GM +LDMN AED IV+ T
Sbjct  193  QSCMDPNVVEAKVVVSGTGHDGPMGASGVKRLEAIGLIDEKKGMLSLDMNAAEDDIVKYT  252

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  246
            RE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+
Sbjct  253  REVVPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAY  291


 Score = 77.0 bits (188),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SKLL RPNVKLFNA AAEDLIVK+G+V GVVTNW LVS+NH+T
Sbjct  149  LSKLLMRPNVKLFNATAAEDLIVKDGKVAGVVTNWTLVSLNHNT  192



>ref|XP_005648929.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE24385.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   179 bits (455),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 102/129 (79%), Gaps = 3/129 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            Q CMDPNV+E K++VSS GHDGP GA+GVKRL+ +GM+  VPGM ALDMNTAEDA+VR T
Sbjct  189  QMCMDPNVLECKVMVSSTGHDGPMGASGVKRLQRLGMVTGVPGMAALDMNTAEDAVVRNT  248

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG---SASE  192
            RE+VPGM++ GMEVAE+DG PRMGPTFGAM +SGQKAAH AL +L   NALD    S   
Sbjct  249  REVVPGMVICGMEVAELDGCPRMGPTFGAMFMSGQKAAHCALNSLRRQNALDKDVPSRVA  308

Query  191  VAAPELILA  165
            V APEL  A
Sbjct  309  VPAPELTKA  317


 Score = 61.6 bits (148),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 5/49 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGR-----VGGVVTNWALVSMNHDT  544
            +SK+L  PN+KLFNA A EDL+V+        VGG VTNW LVS+NHDT
Sbjct  140  LSKVLQAPNIKLFNATAVEDLVVREDELRGKYVGGAVTNWTLVSLNHDT  188



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score =   150 bits (379),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPG KALDMNTA+D IV+LT
Sbjct  224  QSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGXKALDMNTAKDTIVKLT  283

Query  362  REIVPGMIVTGMEVAEIDGAPRM  294
            REI+PG IVTGME+ EI+G+PRM
Sbjct  284  REIMPGXIVTGMEITEINGSPRM  306


 Score = 89.0 bits (219),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLI+K GRVGGVVTNWALVSMNHDT
Sbjct  180  MSKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDT  223



>gb|EIE83081.1| thiazole biosynthetic enzyme, chloroplastic [Rhizopus delemar 
RA 99-880]
Length=305

 Score =   165 bits (417),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK++VS  GHDGP GA+GVKRL+SIG+ID   GM +LDMN AED IVR T
Sbjct  188  QSCMDPNVIEAKVIVSGTGHDGPMGASGVKRLESIGLIDQKKGMLSLDMNAAEDDIVRYT  247

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  249
            RE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA
Sbjct  248  REVVPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAA  285


 Score = 73.2 bits (178),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SK+L RPNVKLFNA A EDLIVK  +V GVVTNW LVS+NHDT
Sbjct  144  LSKILMRPNVKLFNATAVEDLIVKKNKVAGVVTNWTLVSLNHDT  187



>emb|CEG62855.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=307

 Score =   164 bits (414),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVS  GHDGP GA+GVKRL+SIG+I    GM +LDMN AED IV+ T
Sbjct  190  QSCMDPNVIEAKVVVSGTGHDGPMGASGVKRLESIGLIAQKKGMLSLDMNAAEDDIVKYT  249

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  250  REVVPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  294


 Score = 74.3 bits (181),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SKLL RPNVKLFNA A EDLIVK  +V GVVTNW LVS+NHDT
Sbjct  146  LSKLLMRPNVKLFNATAVEDLIVKKNKVAGVVTNWTLVSLNHDT  189



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score =   165 bits (417),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 95/116 (82%), Gaps = 4/116 (3%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATG--VKRLKSIGMIDSVP--GMKALDMNTAEDAI  375
            QS MD NVMEAKIVVSSCGH+G F A G  VKRL+ IGMI +VP  GM+ALD N +EDAI
Sbjct  217  QSHMDANVMEAKIVVSSCGHEGLFSANGKGVKRLEDIGMIKTVPRTGMEALDTNVSEDAI  276

Query  374  VRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  207
            V LTRE+VPGMIV G+EVAEIDG  RM PTFGA +ISGQKAAHLALKALG PN +D
Sbjct  277  VGLTREVVPGMIVAGIEVAEIDGPQRMCPTFGATIISGQKAAHLALKALGRPNGID  332


 Score = 73.2 bits (178),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +S+LLARPNVKLFN V  EDL+VK  RV GVVTNWALVSMN DT
Sbjct  169  LSRLLARPNVKLFNGVVVEDLVVKEHRVTGVVTNWALVSMNQDT  212



>ref|XP_005847930.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
 gb|EFN55828.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
Length=300

 Score =   169 bits (427),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            Q CMDPNV+EAK++VSSCGHDGP GA GVKRL  +GM++  PGM ALDMN+AEDA+V  T
Sbjct  171  QMCMDPNVIEAKVMVSSCGHDGPMGAAGVKRLARLGMVEKTPGMGALDMNSAEDAVVDRT  230

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPGM++ GMEVAE+DG PRMGPTFGAM +SGQKAAH+AL +L
Sbjct  231  REIVPGMVICGMEVAELDGCPRMGPTFGAMFMSGQKAAHVALNSL  275


 Score = 65.1 bits (157),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 5/49 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGR-----VGGVVTNWALVSMNHDT  544
            +SK+LA PN+KLFNA AAEDLIVK        V G VTNW LVS+NHDT
Sbjct  122  LSKVLAAPNIKLFNATAAEDLIVKQDETRGKYVAGAVTNWTLVSLNHDT  170



>gb|KIY99977.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=359

 Score =   169 bits (429),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVS+CGHDGP GA  VKRL  +GM+D +PGM ALDMN AED IV  T
Sbjct  232  QSCMDPNVLEAKVVVSTCGHDGPMGAHSVKRLAKLGMVDEIPGMAALDMNAAEDRIVANT  291

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPGM++ GME++EIDG+PRMGPTFGAM +SGQKAAH+AL  L
Sbjct  292  REVVPGMVLAGMELSEIDGSPRMGPTFGAMFVSGQKAAHVALGVL  336


 Score = 63.9 bits (154),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 5/49 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHDT  544
            +SK+L  PNVKLFNA A EDLIV++      R+GGVVTNW LV+++HDT
Sbjct  183  LSKVLQAPNVKLFNATAVEDLIVRDDAVSGRRIGGVVTNWTLVTLHHDT  231



>gb|KIY92671.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=351

 Score =   169 bits (428),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVS+CGHDGP GA  VKRL  +GM+D +PGM ALDMN AED IV  T
Sbjct  223  QSCMDPNVLEAKVVVSTCGHDGPMGAHSVKRLAKLGMVDEIPGMAALDMNAAEDRIVANT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPGM++ GME++EIDG+PRMGPTFGAM +SGQKAAH+AL  L
Sbjct  283  REVVPGMVLAGMELSEIDGSPRMGPTFGAMFVSGQKAAHVALGVL  327


 Score = 63.9 bits (154),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 5/49 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHDT  544
            +SK+L  PNVKLFNA A EDLIV++      R+GGVVTNW LV+++HDT
Sbjct  174  LSKVLQAPNVKLFNATAVEDLIVRDDAVSGRRIGGVVTNWTLVTLHHDT  222



>ref|XP_003522069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Glycine 
max]
Length=284

 Score =   162 bits (411),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 96/130 (74%), Gaps = 2/130 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGP  ATGVKRLKSIGMID+VPGMKALD  +    +VRLT
Sbjct  138  QSCMDPNVMEAKVVVSSCGHDGPLSATGVKRLKSIGMIDNVPGMKALDTKSIGMVVVRLT  197

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMM-ISGQKAAHLALKALGEPNALDGSASE-V  189
            REIV GMIVTGMEVAEI G+PRMGP    M  ++ +    + LKALG  NA+DG+     
Sbjct  198  REIVLGMIVTGMEVAEIGGSPRMGPYLSMMFKLTFKLMERVELKALGRNNAIDGTCGVGT  257

Query  188  AAPELILASA  159
              P LI AS 
Sbjct  258  EEPHLIFAST  267


 Score = 66.2 bits (160),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 3/44 (7%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSK+LARPNVK FNAV A+DLI+K GR   VVTN ALVSMNHDT
Sbjct  97   MSKILARPNVKRFNAVVAKDLIMKEGR---VVTNLALVSMNHDT  137



>gb|ADI88268.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88269.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88270.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88271.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88276.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88277.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88282.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88283.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88286.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88287.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88288.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88289.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88291.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88292.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88293.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88294.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88295.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88296.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88297.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88298.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88299.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88300.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88301.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88302.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88303.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88304.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88305.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88306.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88307.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88308.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88309.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88310.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88311.1| HCF106 protein, partial [Silene latifolia]
Length=137

 Score =   141 bits (355),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMNTAEDAIVRLT
Sbjct  64   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNTAEDAIVRLT  123

Query  362  REIVPGMIVTGMEV  321
            RE+VPGMIVTGMEV
Sbjct  124  REVVPGMIVTGMEV  137


 Score = 84.3 bits (207),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK+GRV GVVTNWALVSMNHDT
Sbjct  20   MSRLLARPNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDT  63



>ref|XP_011397717.1| Thiamine thiazole synthase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM24829.1| Thiamine thiazole synthase, chloroplastic [Auxenochlorella protothecoides]
Length=419

 Score =   159 bits (401),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            Q CMDPN + +K++VSS GHDGP GA+GVKRL  +GMI+  PGM ALDMNTAEDA+V  T
Sbjct  291  QMCMDPNTILSKVMVSSTGHDGPMGASGVKRLAKLGMIEKAPGMGALDMNTAEDAVVDRT  350

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPGM++ GMEVAE+DG PRMGPTFGAM ISG KAAH AL +L
Sbjct  351  REIVPGMVICGMEVAELDGCPRMGPTFGAMFISGLKAAHCALASL  395


 Score = 65.9 bits (159),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 6/50 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKN-----GR-VGGVVTNWALVSMNHDT  544
            +SK+LA PN+KLFNA AAEDLIVK+     GR V G VTNW LVS+NHDT
Sbjct  241  LSKVLAAPNIKLFNATAAEDLIVKDIPAKGGRHVAGAVTNWTLVSLNHDT  290


 Score = 65.9 bits (159),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 6/50 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKN-----GR-VGGVVTNWALVSMNHDT  544
            +SK+LA PN+KLFNA AAEDLIVK+     GR V G VTNW LVS+NHDT
Sbjct  102  LSKVLAAPNIKLFNATAAEDLIVKDIPAKGGRHVAGAVTNWTLVSLNHDT  151


 Score = 45.1 bits (105),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATG  459
            Q CMDPN + +K++VSS GHDGP GA+G
Sbjct  152  QMCMDPNTILSKVMVSSTGHDGPMGASG  179



>gb|ADI88272.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88273.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88274.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88275.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88278.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88279.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88280.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88281.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88290.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88312.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88313.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88314.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88315.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88467.1| HCF106 protein [Silene vulgaris]
Length=137

 Score =   140 bits (352),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMN+AEDAIVRLT
Sbjct  64   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRLT  123

Query  362  REIVPGMIVTGMEV  321
            RE+VPGMIVTGMEV
Sbjct  124  REVVPGMIVTGMEV  137


 Score = 84.3 bits (207),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK+GRV GVVTNWALVSMNHDT
Sbjct  20   MSRLLARPNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDT  63



>gb|AGB85035.1| thiamine biosynthesis thi4 protein, partial [Auxenochlorella 
protothecoides]
Length=327

 Score =   157 bits (397),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            Q CMDPN + +K++VSS GHDGP GA+GVKRL  +GMI+  PGM ALDMNTAEDA+V  T
Sbjct  161  QMCMDPNTILSKVMVSSTGHDGPMGASGVKRLAKLGMIEKAPGMGALDMNTAEDAVVDRT  220

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPGM++ GMEVAE+DG PRMGPTFGAM ISG KA H AL +L
Sbjct  221  REIVPGMVICGMEVAELDGCPRMGPTFGAMFISGLKAVHCALASL  265


 Score = 65.9 bits (159),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 6/50 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKN-----GR-VGGVVTNWALVSMNHDT  544
            +SK+LA PN+KLFNA AAEDLIVK+     GR V G VTNW LVS+NHDT
Sbjct  111  LSKVLAAPNIKLFNATAAEDLIVKDISAKGGRHVAGAVTNWTLVSLNHDT  160



>gb|ADI88468.1| HCF106 protein [Silene vulgaris]
Length=137

 Score =   139 bits (349),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMN+AEDAIVRLT
Sbjct  64   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRLT  123

Query  362  REIVPGMIVTGMEV  321
            RE+VPGMIVTG+EV
Sbjct  124  REVVPGMIVTGLEV  137


 Score = 84.3 bits (207),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK+GRV GVVTNWALVSMNHDT
Sbjct  20   MSRLLARPNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDT  63



>gb|ADI88284.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88285.1| HCF106 protein, partial [Silene latifolia]
Length=137

 Score =   138 bits (348),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMN+AEDAIVR+T
Sbjct  64   QSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRVT  123

Query  362  REIVPGMIVTGMEV  321
            RE+VPGMIVTGMEV
Sbjct  124  REVVPGMIVTGMEV  137


 Score = 84.3 bits (207),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MS+LLARPNVKLFNAVA EDLIVK+GRV GVVTNWALVSMNHDT
Sbjct  20   MSRLLARPNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDT  63



>ref|XP_006388786.1| hypothetical protein POPTR_0101s00250g [Populus trichocarpa]
 gb|ERP47700.1| hypothetical protein POPTR_0101s00250g [Populus trichocarpa]
Length=116

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 95/128 (74%), Gaps = 24/128 (19%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSC DPNVMEAK+VV SCGHDGPFGA GVKRLKSIGMIDSVPGMKALDMN AEDAIVRLT
Sbjct  6    QSCTDPNVMEAKVVVGSCGHDGPFGAAGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLT  65

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA  183
            REIVPGMIVTGME                      KAAHLALK LG+PNA DG+ S    
Sbjct  66   REIVPGMIVTGME----------------------KAAHLALKDLGQPNAQDGTFS--LQ  101

Query  182  PELILASA  159
            PEL+LA+A
Sbjct  102  PELVLAAA  109



>gb|ABW74129.1| thiamin biosynthetic enzyme, partial [Mucor racemosus]
Length=145

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVMEAK++VS  GHDGP GA+GVKRL+SIG+I+   GM +LDMN AED IV+ T
Sbjct  28   QSCMDPNVMEAKVIVSGTGHDGPMGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYT  87

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  88   REVVPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  132


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -3

Query  621  EDLIVKNGRVGGVVTNWALVSMNHDT  544
            EDLIVKNG+V GVVTNW LV++NH+T
Sbjct  2    EDLIVKNGKVAGVVTNWTLVTLNHNT  27



>ref|XP_001698672.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
 sp|A8J9T5.1|THI4_CHLRE RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|EDO99354.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
Length=357

 Score =   160 bits (404),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVR  369
            QSCMDPNV+EA +VVS+CGHDGPFGATGVKRL  +GM+    VPGM ALDM  AE +IV 
Sbjct  231  QSCMDPNVIEAGVVVSACGHDGPFGATGVKRLARLGMVPGGEVPGMGALDMEAAEGSIVN  290

Query  368  LTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
             TRE+VPGM++TGME+AE+DG+PRMGPTFGAM++SG +AAH+A+ AL
Sbjct  291  NTREVVPGMVLTGMELAEVDGSPRMGPTFGAMIVSGMRAAHMAVAAL  337


 Score = 55.5 bits (132),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 8/52 (15%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG--------RVGGVVTNWALVSMNHDT  544
            MS +L  PNVKLFNA A EDLIVK          RV GVVTNW+LV+  H T
Sbjct  179  MSHVLKNPNVKLFNATAVEDLIVKPDPALGPGGRRVAGVVTNWSLVAQAHGT  230



>ref|XP_002951140.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
 gb|EFJ47669.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
Length=359

 Score =   157 bits (396),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVR  369
            QSCMDPNV+EA +VVS+CGHDGPFGAT VKRL  +GM+    VPGM ALDM  AE AIV 
Sbjct  230  QSCMDPNVIEAGVVVSACGHDGPFGATSVKRLARLGMVPGGEVPGMGALDMEAAEGAIVG  289

Query  368  LTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
             TRE+VPGM++ GME+AE+DG+PRMGPTFGAM++SG++AAH+AL  L
Sbjct  290  GTREVVPGMVLAGMELAEVDGSPRMGPTFGAMIVSGRRAAHVALAVL  336


 Score = 56.2 bits (134),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 33/51 (65%), Gaps = 7/51 (14%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-------RVGGVVTNWALVSMNHDT  544
            MS +L  PNVKLFNA A EDLIVK         RV GVVTNW+LV+  H T
Sbjct  179  MSHVLKNPNVKLFNATAVEDLIVKPDPQLGGARRVAGVVTNWSLVAQAHGT  229



>ref|XP_002951138.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
 gb|EFJ47667.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
Length=355

 Score =   156 bits (395),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVR  369
            QSCMDPNV+EA +VVS+CGHDGPFGAT VKRL  +GM+    VPGM ALDM  AE AIV 
Sbjct  229  QSCMDPNVIEAGVVVSACGHDGPFGATSVKRLARLGMVPGGEVPGMGALDMEAAEGAIVG  288

Query  368  LTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
             TRE+VPGM++ GME+AE+DG+PRMGPTFGAM++SG++AAH+AL  L
Sbjct  289  GTREVVPGMVLAGMELAEVDGSPRMGPTFGAMIVSGRRAAHVALAVL  335


 Score = 56.2 bits (134),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 33/51 (65%), Gaps = 7/51 (14%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-------RVGGVVTNWALVSMNHDT  544
            MS +L  PNVKLFNA A EDLIVK         RV GVVTNW+LV+  H T
Sbjct  178  MSHVLKNPNVKLFNATAVEDLIVKPDPQLGGARRVAGVVTNWSLVAQAHGT  228



>gb|KJB57702.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=304

 Score =   124 bits (310),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 77/138 (56%), Gaps = 53/138 (38%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVP                  
Sbjct  218  QSCMDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVP------------------  259

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--  189
                                             G KAAHLALKALG+PNA+DG+ SE   
Sbjct  260  ---------------------------------GMKAAHLALKALGQPNAIDGTFSEAER  286

Query  188  AAPELILASAENEEIADA  135
              PE +LA+AE EEI DA
Sbjct  287  VQPEFVLAAAETEEIVDA  304


 Score = 86.3 bits (212),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            MSKLLARPNVKLFNAVAAEDLIVK  RV GVVTNWALVSMNHDT
Sbjct  174  MSKLLARPNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDT  217



>emb|CAH25337.1| thiazole biosynthetic enzyme [Guillardia theta]
Length=328

 Score =   151 bits (382),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 84/101 (83%), Gaps = 5/101 (5%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDS-----VPGMKALDMNTAEDA  378
            QSCMDPNV+E+K++VS CGHDGPFGA  VKRL  +GM+D      + GM ALDMN+AED 
Sbjct  209  QSCMDPNVIESKVIVSGCGHDGPFGAQCVKRLAKLGMLDEYAQNGIQGMGALDMNSAEDK  268

Query  377  IVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQK  255
            IV  TRE+VPGMI+TGME+AE+DG+PRMGPTFGAM +SGQ+
Sbjct  269  IVNNTREVVPGMILTGMELAEVDGSPRMGPTFGAMFVSGQR  309


 Score = 57.4 bits (137),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 5/49 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVG-----GVVTNWALVSMNHDT  544
            +SK+L   NVKLFNA A EDLIVK    G     GVVTNW LV++NHDT
Sbjct  160  LSKVLKNGNVKLFNATAVEDLIVKQDPQGLKYCAGVVTNWTLVALNHDT  208



>ref|XP_005834399.1| putative THI4, thiamine [Guillardia theta CCMP2712]
 gb|EKX47419.1| putative THI4, thiamine [Guillardia theta CCMP2712]
Length=325

 Score =   151 bits (382),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 84/101 (83%), Gaps = 5/101 (5%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDS-----VPGMKALDMNTAEDA  378
            QSCMDPNV+E+K++VS CGHDGPFGA  VKRL  +GM+D      + GM ALDMN+AED 
Sbjct  206  QSCMDPNVIESKVIVSGCGHDGPFGAQCVKRLAKLGMLDEYAQNGIQGMGALDMNSAEDK  265

Query  377  IVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQK  255
            IV  TRE+VPGMI+TGME+AE+DG+PRMGPTFGAM +SGQ+
Sbjct  266  IVNNTREVVPGMILTGMELAEVDGSPRMGPTFGAMFVSGQR  306


 Score = 57.4 bits (137),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 5/49 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVG-----GVVTNWALVSMNHDT  544
            +SK+L   NVKLFNA A EDLIVK    G     GVVTNW LV++NHDT
Sbjct  157  LSKVLKNGNVKLFNATAVEDLIVKQDPQGLKYCAGVVTNWTLVALNHDT  205



>ref|XP_007586590.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD45932.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
Length=329

 Score =   148 bits (373),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  +D + GM+ LDMN AEDAIV+ T
Sbjct  215  QSCMDPNTINAPVVISTTGHDGPFGAFSVKRLVSMQQLDKLGGMRGLDMNNAEDAIVKRT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  275  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFDERKA  324


 Score = 58.9 bits (141),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 6/49 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI +        R+ GVVTNW LVSM+HD
Sbjct  165  LSKVLQFPNVKLFNATAVEDLITRPAADGTGVRIAGVVTNWTLVSMHHD  213



>ref|XP_001549602.1| thiazole biosynthetic enzyme [Botrytis cinerea B05.10]
 emb|CCD55366.1| similar to thiazole biosynthetic enzyme [Botrytis cinerea T4]
 gb|EMR84691.1| putative thiazole biosynthetic enzyme protein [Botrytis cinerea 
BcDW1]
Length=328

 Score =   146 bits (369),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A IV+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMN AEDAIV+ T
Sbjct  215  QSCMDPNTINAPIVISTTGHDGPFGAFCVKRLVSMNQIEKLGGMRGLDMNVAEDAIVKRT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  AL+   E  A
Sbjct  275  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALRVFDERKA  324


 Score = 59.7 bits (143),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHD  547
            +SK+LA PN+KLFNA A EDLI +       R+ GVVTNW LV+M+HD
Sbjct  166  LSKVLAFPNIKLFNATAVEDLITRQTPDGSIRIAGVVTNWTLVTMHHD  213



>ref|XP_001589094.1| thiazole biosynthetic enzyme [Sclerotinia sclerotiorum 1980]
 sp|A7EWL8.1|THI4_SCLS1 RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Sclerotinia sclerotiorum 1980 UF-70]
 gb|EDN93860.1| thiazole biosynthetic enzyme [Sclerotinia sclerotiorum 1980 UF-70]
Length=326

 Score =   146 bits (369),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A IV+S+ GHDGPFGA  VKRL S+  I  + GM+ LDMN AEDAIV+ T
Sbjct  213  QSCMDPNTINAPIVISTTGHDGPFGAFCVKRLVSMNQIKELGGMRGLDMNVAEDAIVKKT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  273  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFDERKA  322


 Score = 60.1 bits (144),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVK-----NGRVGGVVTNWALVSMNHD  547
            +SK+LA PN+KLFNA + EDLI +     N R+ GVVTNW LV+M+HD
Sbjct  164  LSKVLAFPNIKLFNATSVEDLITRQTADGNIRIAGVVTNWTLVTMHHD  211



>gb|ESZ95478.1| thiazole biosynthetic enzyme [Sclerotinia borealis F-4157]
Length=328

 Score =   146 bits (368),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMN AEDAIV+ T
Sbjct  215  QSCMDPNTINAPVVISTTGHDGPFGAFCVKRLVSMNQIEQLGGMRGLDMNVAEDAIVKRT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  275  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKIFDERKA  324


 Score = 60.1 bits (144),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHD  547
            +SK+LA PN+KLFNA A EDLI +       R+ GVVTNW LV+M+HD
Sbjct  166  LSKVLAFPNIKLFNATAVEDLITRQTADGKVRIAGVVTNWTLVTMHHD  213



>gb|KFY50717.1| hypothetical protein V496_09214 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=1290

 Score =   149 bits (376),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  542   QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
             QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  1177  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  1236

Query  362   REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
             REIVPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  1237  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  1286


 Score = 56.6 bits (135),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675   MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
             +SK+L  PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  1124  LSKVLQFPNIKLFNATCVEDLITRNAGDAADPSAVQIAGVVTNWTLVTMHHD  1175



>emb|CEI86769.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=273

 Score =   132 bits (331),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPNV+EAK+VVS  GHDGP GA+GVKRL+SIG+I    GM +LDMN AED IV+ T
Sbjct  190  QSCMDPNVIEAKVVVSGTGHDGPMGASGVKRLESIGLIAQKKGMLSLDMNAAEDDIVKYT  249

Query  362  REIVPGMIVTGMEVAEIDGAPRM  294
            RE+VPGM+VTGME+AE+DGAPRM
Sbjct  250  REVVPGMVVTGMELAELDGAPRM  272


 Score = 73.9 bits (180),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDT  544
            +SKLL RPNVKLFNA A EDLIVK  +V GVVTNW LVS+NHDT
Sbjct  146  LSKLLMRPNVKLFNATAVEDLIVKKNKVAGVVTNWTLVSLNHDT  189



>gb|KIN04678.1| hypothetical protein OIDMADRAFT_17638 [Oidiodendron maius Zn]
Length=322

 Score =   144 bits (364),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A IV+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMN+AEDAIV  T
Sbjct  209  QSCMDPNTINAPIVISTTGHDGPFGAFSVKRLVSMQQIEKLGGMRGLDMNSAEDAIVTKT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            RE++PG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E
Sbjct  269  REVIPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFEE  315


 Score = 60.8 bits (146),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVK---NG--RVGGVVTNWALVSMNHD  547
            +SK+L+ PN+KLFNA A EDLI +   NG  RV GVVTNW LVSM+HD
Sbjct  160  LSKVLSFPNIKLFNATAVEDLITRPTANGGVRVAGVVTNWTLVSMHHD  207



>gb|EHL02685.1| putative Thiazole biosynthetic enzyme, mitochondrial [Glarea 
lozoyensis 74030]
Length=322

 Score =   146 bits (369),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A IVVS+ GHDGPFGA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  209  QSCMDPNTINAPIVVSTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            RE+VPG++V GME++E+DGA RMGPTFGAM +SG KAA   LK   E
Sbjct  269  REVVPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAEEVLKVFDE  315


 Score = 58.9 bits (141),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHD  547
            +SK+L+ PN+KLFNA A EDLI +       R+ GVVTNW LV+M+HD
Sbjct  160  LSKVLSFPNIKLFNATAVEDLITRQNSDGTLRIAGVVTNWTLVTMHHD  207



>ref|XP_008087498.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
 gb|EPE26179.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
Length=328

 Score =   146 bits (368),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A IVVS+ GHDGPFGA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIVVSTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            RE+VPG++V GME++E+DGA RMGPTFGAM +SG KAA   LK   E
Sbjct  275  REVVPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAEEVLKVFDE  321


 Score = 58.9 bits (141),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHD  547
            +SK+L+ PN+KLFNA A EDLI +       R+ GVVTNW LV+M+HD
Sbjct  166  LSKVLSFPNIKLFNATAVEDLITRQNSDGTLRIAGVVTNWTLVTMHHD  213



>gb|KFZ11494.1| hypothetical protein V502_07520 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=335

 Score =   149 bits (375),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  222  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  282  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  331


 Score = 56.2 bits (134),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  169  LSKVLQFPNIKLFNATCVEDLITRNAGDAADPSAVQIAGVVTNWTLVTMHHD  220



>gb|KFY84898.1| hypothetical protein V500_08902 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=330

 Score =   148 bits (374),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  217  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  277  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  326


 Score = 55.8 bits (133),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  164  LSKVLQFPNIKLFNATCVEDLITRNAGDAADPSAVQIAGVVTNWTLVTMHHD  215



>ref|XP_007289177.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD20606.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=327

 Score =   146 bits (369),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  214  QSCMDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRT  273

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E
Sbjct  274  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFEE  320


 Score = 57.8 bits (138),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHD  547
            +S++L+ PN+KLFNA A EDLI +       R+ GVVTNW LV+M+HD
Sbjct  165  LSRVLSFPNIKLFNATAVEDLITRASPDGTLRIAGVVTNWTLVTMHHD  212



>ref|XP_009228164.1| thiazole biosynthetic enzyme [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT70986.1| thiazole biosynthetic enzyme [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=331

 Score =   139 bits (351),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  +D + GM+ LDM +AEDAIV+ T
Sbjct  218  QSCMDPNTINAPLVISTTGHDGPFGAFSVKRLVSMKQLDQLGGMRGLDMQSAEDAIVKNT  277

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL  237
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+
Sbjct  278  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAM  319


 Score = 64.7 bits (156),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNHD  547
            +SK+LA PNVKLFNA A EDLI + G     RV GVVTNW LVSM+HD
Sbjct  169  LSKVLALPNVKLFNATAVEDLITRQGEGGRVRVAGVVTNWTLVSMHHD  216



>gb|KFY94986.1| hypothetical protein V498_03597 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=328

 Score =   148 bits (373),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  275  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  324


 Score = 55.8 bits (133),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  162  LSKVLQFPNIKLFNATCVEDLITRNAGDAADPSAVQIAGVVTNWTLVTMHHD  213



>gb|KFZ09843.1| hypothetical protein V501_05470 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=330

 Score =   148 bits (373),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  217  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  277  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  326


 Score = 55.8 bits (133),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  164  LSKVLQFPNIKLFNATCVEDLITRNAGDPADPTAVQIAGVVTNWTLVTMHHD  215



>gb|KFY70117.1| hypothetical protein V499_09439 [Pseudogymnoascus pannorum VKM 
F-103]
Length=328

 Score =   148 bits (373),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  275  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  324


 Score = 55.8 bits (133),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  162  LSKVLQFPNIKLFNATCVEDLITRNAGDPADPTAVQIAGVVTNWTLVTMHHD  213



>ref|XP_003842741.1| similar to thiazole biosynthetic enzyme [Leptosphaeria maculans 
JN3]
 emb|CBX99262.1| similar to thiazole biosynthetic enzyme [Leptosphaeria maculans 
JN3]
Length=334

 Score =   146 bits (369),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ T
Sbjct  221  QSCMDPNTINAPLIISTTGHDGPFGAFSVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRT  280

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG  204
            REIVPG+IV GME++E+DGA RMGPTFGAM++SG KAA  A+    E NA +G
Sbjct  281  REIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAAEEAVGVWDERNAQNG  333


 Score = 57.4 bits (137),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI +           R+ GVVTNW LVSM+HD
Sbjct  168  LSKVLQFPNVKLFNATAVEDLITRPAPTATDPNAVRIAGVVTNWTLVSMHHD  219



>gb|EME42084.1| hypothetical protein DOTSEDRAFT_73000 [Dothistroma septosporum 
NZE10]
Length=339

 Score =   142 bits (359),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGPFGA  VKRL S+G I ++ GM+ LDMN AEDAIV+ T
Sbjct  222  QSCMDPNTINAPVIISTTGHDGPFGAFSVKRLVSMGSIPALGGMRGLDMNVAEDAIVKCT  281

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REI PG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   +  A
Sbjct  282  REIAPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKIFEQRKA  331


 Score = 60.1 bits (144),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVK-----NGRVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI +     N R+ GVVTNW LVSM+HD
Sbjct  173  LSKVLQFPNVKLFNATAVEDLITRTDAHGNIRIAGVVTNWTLVSMHHD  220



>gb|EKG16915.1| Thiamine biosynthesis Thi4 protein [Macrophomina phaseolina MS6]
Length=236

 Score =   145 bits (367),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A IV+S+ GHDGPFGA  VKRL S+  ++ + GM+ LDMN AEDAIV+ T
Sbjct  122  QSCMDPNTINAPIVISTTGHDGPFGAFSVKRLVSMQQLEKLGGMRGLDMNNAEDAIVKRT  181

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E
Sbjct  182  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFDE  228


 Score = 57.0 bits (136),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 6/49 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA   EDLI +        R+ GVVTNW LVSM+HD
Sbjct  72   LSKVLQFPNVKLFNATTVEDLITRPAADGSGVRIAGVVTNWTLVSMHHD  120



>ref|XP_007672530.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMD00030.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia compniacensis 
UAMH 10762]
Length=315

 Score =   143 bits (360),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGPFGA   KRL S+  + ++ GM+ LDMNTAEDAIV+ T
Sbjct  195  QSCMDPNTINAPVIISTTGHDGPFGAFSAKRLVSMNALSALGGMRGLDMNTAEDAIVKGT  254

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+I+ GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  255  REIVPGLIIGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFEERRA  304


 Score = 59.7 bits (143),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIV-KNG----RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI  K+G    R+ GVVTNW LVSM+HD
Sbjct  146  LSKVLQFPNVKLFNATAVEDLITRKDGKGGIRIAGVVTNWTLVSMHHD  193



>gb|KFX95262.1| hypothetical protein V490_03958 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=1293

 Score =   146 bits (369),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  542   QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
             QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  1180  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  1239

Query  362   REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
             REIVPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  1240  REIVPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  1289


 Score = 55.5 bits (132),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675   MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
             +SK+L  PN+KLFNA   EDL+ +N          ++ GVVTNW LV+M+HD
Sbjct  1127  LSKVLQFPNIKLFNATCVEDLMTRNANDPADPKAVQIAGVVTNWTLVTMHHD  1178



>gb|KFY20175.1| hypothetical protein V491_03934 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=328

 Score =   145 bits (367),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  275  REIVPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  324


 Score = 56.2 bits (134),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  162  LSKVLQFPNVKLFNATCVEDLITRNAGDPSDPTAVQIAGVVTNWTLVTMHHD  213



>gb|KFY37341.1| hypothetical protein V495_07232 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY55933.1| hypothetical protein V497_06604 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=1286

 Score =   146 bits (369),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  542   QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
             QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  1173  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  1232

Query  362   REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
             REIVPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  1233  REIVPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  1282


 Score = 55.5 bits (132),  Expect(2) = 5e-43, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675   MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
             +SK+L  PN+KLFNA   EDL+ +N          ++ GVVTNW LV+M+HD
Sbjct  1120  LSKVLQFPNIKLFNATCVEDLMTRNANDPADPKAVQIAGVVTNWTLVTMHHD  1171



>gb|KFY24905.1| hypothetical protein V493_04960 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=329

 Score =   145 bits (366),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM+ SG  AA  ALK   +  A
Sbjct  275  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVYSGVVAAETALKVFDQRKA  324


 Score = 56.6 bits (135),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L+ PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  162  LSKVLSFPNIKLFNATCVEDLITRNAGDAADPTAVQIAGVVTNWTLVTMHHD  213



>gb|AGT99181.1| thiazole biosynthetic enzyme [Acremonium chrysogenum]
 gb|KFH43147.1| Thiamine thiazole synthase-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=328

 Score =   142 bits (357),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPVIISTTGHDGPMGAFSVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKNT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM++SG KAA  AL+  
Sbjct  275  REIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAAEEALRVF  319


 Score = 59.7 bits (143),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVK--NG---RVGGVVTNWALVSMNHD  547
            +SK+LA PNVKLFNA   EDLI +  NG   R+ GVVTNW LV+M+HD
Sbjct  166  LSKVLAMPNVKLFNATCVEDLITRPSNGQDVRIAGVVTNWTLVTMHHD  213



>gb|KFX98431.1| hypothetical protein O988_04337, partial [Pseudogymnoascus pannorum 
VKM F-3808]
Length=343

 Score =   146 bits (369),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  230  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  289

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  290  REIVPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  339


 Score = 54.7 bits (130),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PN+KLFNA   EDL+ +N          ++ GVVTNW LV+M+HD
Sbjct  177  LSKVLQFPNIKLFNATCVEDLMTRNANDPADPKAVQIAGVVTNWTLVTMHHD  228



>ref|XP_007928692.1| hypothetical protein MYCFIDRAFT_211863 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME81519.1| hypothetical protein MYCFIDRAFT_211863 [Pseudocercospora fijiensis 
CIRAD86]
Length=340

 Score =   144 bits (362),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A ++VS+ GHDGPFGA  VKRL S+G+I ++ GM+ LDMNTAEDAIV+ T
Sbjct  223  QSCMDPNTINAPVIVSTTGHDGPFGAFSVKRLVSMGVIPTLGGMRGLDMNTAEDAIVKGT  282

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REI PG++V GME++E+DGA RMGPTFGAM +SG KAA + L+   +  A
Sbjct  283  REIAPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAEVVLEIFDQRKA  332


 Score = 57.4 bits (137),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVK---NGRV--GGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI +   NG +   GVVTNW LVSM+HD
Sbjct  174  LSKVLHFPNVKLFNATAVEDLITRKNANGHIQLAGVVTNWTLVSMHHD  221



>gb|KFY43107.1| hypothetical protein V494_02101 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=328

 Score =   145 bits (365),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+      A
Sbjct  275  REIVPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDRRKA  324


 Score = 56.2 bits (134),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  162  LSKVLQFPNVKLFNATCVEDLITRNAGDASDPTAVQIAGVVTNWTLVTMHHD  213



>gb|KFY08103.1| hypothetical protein V492_06538 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=328

 Score =   145 bits (365),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+      A
Sbjct  275  REIVPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDRRKA  324


 Score = 56.2 bits (134),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  162  LSKVLQFPNVKLFNATCVEDLITRNAGDASDPTAVQIAGVVTNWTLVTMHHD  213



>ref|NP_596642.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 sp|P40998.2|THI4_SCHPO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 emb|CAA21093.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe]
Length=328

 Score =   137 bits (346),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +VVS+ GHDGPFGA  VKRL S  ++ ++  M+ LDMN AED IV+ T
Sbjct  213  QSCMDPNTINAHLVVSATGHDGPFGAFCVKRLASAQLVSNLHDMRPLDMNRAEDLIVKGT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  207
            RE+ PGMIV GME++E DGA RMGPTFG MM SG KAA  AL    E  A++
Sbjct  273  REVFPGMIVGGMELSEFDGANRMGPTFGGMMFSGIKAAQEALAIFDERKAVN  324


 Score = 63.5 bits (153),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 5/47 (11%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-----RVGGVVTNWALVSMNH  550
            M++ LA PNVKLFNA A EDLIVK G     R+ GVVTNW LVS+NH
Sbjct  164  MARTLALPNVKLFNATAVEDLIVKEGKDGKQRIAGVVTNWTLVSLNH  210



>gb|KDB14289.1| thiazole biosynthetic enzyme variant 1 [Ustilaginoidea virens]
Length=321

 Score =   140 bits (353),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGP GA  VKRL S+  I+ + GM+ LDMN+AEDAIV+ T
Sbjct  208  QSCMDPNTINAPLVISTTGHDGPMGAFSVKRLVSMQRIEKLGGMRGLDMNSAEDAIVKNT  267

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  268  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKVF  312


 Score = 60.5 bits (145),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            MSK+LA PNVK+FNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  160  MSKVLALPNVKMFNATCVEDLITRPSEQGVRISGVVTNWTLVSMHHD  206



>emb|CEJ80028.1| Putative Thiamine thiazole synthase [Torrubiella hemipterigena]
Length=381

 Score =   139 bits (351),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN +   ++VS+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  268  QSCMDPNTINCPLIVSTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGT  327

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            REIVPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK   +
Sbjct  328  REIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAAEEALKVFDQ  374


 Score = 60.8 bits (146),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 6/49 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG------RVGGVVTNWALVSMNHD  547
            MSK+L  PNVKLFNA   EDLI + G      R+ GVVTNW LVSM+HD
Sbjct  218  MSKVLQLPNVKLFNATCVEDLITRPGLDGEGVRIAGVVTNWTLVSMHHD  266



>emb|CEJ80029.1| Putative Thiamine thiazole synthase [Torrubiella hemipterigena]
Length=329

 Score =   139 bits (351),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN +   ++VS+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  216  QSCMDPNTINCPLIVSTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGT  275

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            REIVPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK   +
Sbjct  276  REIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAAEEALKVFDQ  322


 Score = 60.5 bits (145),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 6/49 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG------RVGGVVTNWALVSMNHD  547
            MSK+L  PNVKLFNA   EDLI + G      R+ GVVTNW LVSM+HD
Sbjct  166  MSKVLQLPNVKLFNATCVEDLITRPGLDGEGVRIAGVVTNWTLVSMHHD  214



>gb|ELR08851.1| thiazole biosynthetic enzyme, mitochondrial [Pseudogymnoascus 
destructans 20631-21]
Length=328

 Score =   145 bits (367),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ T
Sbjct  215  QSCMDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++EIDG+ RMGPTFGAM+ SG  AA  ALK   +  A
Sbjct  275  REIVPGLIVGGMELSEIDGSNRMGPTFGAMVYSGVAAAEAALKVFDQRKA  324


 Score = 54.3 bits (129),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +S++L  PN+KLFNA   EDLI +N          ++ GVVTNW LV+M+HD
Sbjct  162  LSRVLQFPNIKLFNATCVEDLITRNAGDAVDPSAVQIAGVVTNWTLVTMHHD  213



>gb|KGQ06713.1| Thiamine thiazole synthase [Beauveria bassiana D1-5]
Length=330

 Score =   139 bits (351),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  217  QSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  277  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKVF  321


 Score = 60.1 bits (144),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 7/50 (14%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-------RVGGVVTNWALVSMNHD  547
            MSK+L  PN+KLFNA   EDLI + G       R+ GVVTNW LVSM+HD
Sbjct  166  MSKVLQMPNIKLFNATCVEDLITRAGRDGDEGVRIAGVVTNWTLVSMHHD  215



>gb|ABG46357.1| mitochondrial thiazole biosynthetic enzyme [Trichoderma harzianum]
Length=322

 Score =   141 bits (356),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGP GA  VKRL S+G I+ + GM+ LDMN AEDAIV+ T
Sbjct  209  QSCMDPNTINAPLVISTTGHDGPMGAFCVKRLVSMGRIEKLGGMRGLDMNRAEDAIVKNT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            RE+VPG+IV GME++EIDGA RMGPTFGAM +SG KAA  ALK  
Sbjct  269  REVVPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAEEALKVF  313


 Score = 58.2 bits (139),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            M+K+L  PNVKLFNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  161  MAKVLQLPNVKLFNATCVEDLITRPSAEGVRIAGVVTNWTLVSMHHD  207



>ref|XP_008598283.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana 
ARSEF 2860]
 gb|EJP65993.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana 
ARSEF 2860]
Length=330

 Score =   139 bits (351),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  217  QSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGT  276

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  277  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKVF  321


 Score = 60.1 bits (144),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 7/50 (14%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-------RVGGVVTNWALVSMNHD  547
            MSK+L  PN+KLFNA   EDLI + G       R+ GVVTNW LVSM+HD
Sbjct  166  MSKVLQMPNIKLFNATCVEDLITRAGRDGDEGVRIAGVVTNWTLVSMHHD  215



>gb|EHK27008.1| hypothetical protein TRIVIDRAFT_215037 [Trichoderma virens Gv29-8]
Length=322

 Score =   141 bits (355),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGP GA  VKRL S+G I+ + GM+ LDMN AEDAIV+ T
Sbjct  209  QSCMDPNTINAPLVISTTGHDGPMGAFCVKRLVSMGRIEKLGGMRGLDMNRAEDAIVKNT  268

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK  234
            RE+VPG+IV GME++EIDGA RMGPTFGAM +SG KAA  ALK
Sbjct  269  REVVPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAEEALK  311


 Score = 58.2 bits (139),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            M+K+L  PNVKLFNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  161  MAKVLQLPNVKLFNATCVEDLITRPSAEGVRIAGVVTNWTLVSMHHD  207



>gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe typhina]
 gb|ABN45969.1| thiazole biosynthetic enzyme variant 2 [Epichloe typhina]
 gb|ABN45970.1| thiazole biosynthetic enzyme variant 3 [Epichloe typhina]
 gb|ABN45971.1| thiazole biosynthetic enzyme variant 4 [Epichloe typhina]
 gb|ABN45972.1| thiazole biosynthetic enzyme variant 5 [Epichloe typhina]
Length=320

 Score =   142 bits (357),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ T
Sbjct  207  QSCMDPNTINAPLVISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKNT  266

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK  
Sbjct  267  REIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALKVF  311


 Score = 57.8 bits (138),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            +SK+L+ PN+K+FNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  159  LSKVLSLPNIKMFNATCVEDLITRPSEEGVRISGVVTNWTLVSMHHD  205



>ref|XP_008026201.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
 gb|EOA86208.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
Length=335

 Score =   142 bits (357),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ T
Sbjct  220  QSCMDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRT  279

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+    E +A
Sbjct  280  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAMNVWEERHA  329


 Score = 57.4 bits (137),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI +           R+ GVVTNW LVSM+HD
Sbjct  167  LSKVLQFPNVKLFNATAVEDLITRPAPTANDPNAVRIAGVVTNWTLVSMHHD  218



>ref|XP_499918.1| YALI0A09768p [Yarrowia lipolytica]
 sp|Q3V7I4.1|THI4_YARLI RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Yarrowia lipolytica CLIB122]
 emb|CAG83845.1| YALI0A09768p [Yarrowia lipolytica CLIB122]
Length=317

 Score =   139 bits (349),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A I++S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM  AEDAIV+ T
Sbjct  204  QSCMDPNTINAPIIISTTGHDGPFGAFSVKRLVSMNAIEKLGGMRGLDMGLAEDAIVKRT  263

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG++V GME++E+DGA RMGPTFGAM +SG KAA   L+  
Sbjct  264  REIVPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAETVLEVF  308


 Score = 60.5 bits (145),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVK-----NGRVGGVVTNWALVSMNHD  547
            MS++L  PNVKLFNA A EDLI +     N R+ GVVTNW LVSM+HD
Sbjct  155  MSQVLKFPNVKLFNATAVEDLITRKDAQGNLRIAGVVTNWTLVSMHHD  202



>ref|XP_007807526.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
 gb|EFY92948.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
Length=350

 Score =   139 bits (351),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMN+AEDAIV+ T
Sbjct  237  QSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNSAEDAIVKNT  296

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  297  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKVF  341


 Score = 59.7 bits (143),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            MSK+L+ PNVK+FNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  189  MSKVLSLPNVKMFNATCVEDLITRPSEEGIRIAGVVTNWTLVSMHHD  235



>ref|XP_007794010.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
 gb|EMR66906.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
Length=326

 Score =   139 bits (350),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGPFGA   KRL S+G ++ + GM+ LDMN AEDAIV+ T
Sbjct  213  QSCMDPNTINAPVIISTTGHDGPFGAFSAKRLVSMGALERLGGMRGLDMNRAEDAIVKGT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  222
            RE+VPG+I  GME++EIDGA RMGPTFGAM +SG KAA  AL    E
Sbjct  273  REVVPGLICGGMELSEIDGANRMGPTFGAMALSGVKAAEEALAVFEE  319


 Score = 60.1 bits (144),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 6/49 (12%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG------RVGGVVTNWALVSMNHD  547
            +SK++A PNVKLFNA A EDLI +        RV GVVTNW LVSM+HD
Sbjct  163  LSKVIAFPNVKLFNATAVEDLITRRDEADGSIRVAGVVTNWTLVSMHHD  211



>emb|CCE33143.1| probable CyPBP37 protein (protein binding to CyP41) [Claviceps 
purpurea 20.1]
Length=326

 Score =   138 bits (348),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMN+AEDAIV+ T
Sbjct  213  QSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNSAEDAIVKNT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK  234
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK
Sbjct  273  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALK  315


 Score = 60.5 bits (145),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            MSK+LA PN+K+FNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  165  MSKVLAMPNIKMFNATCVEDLITRPSEEGVRIAGVVTNWTLVSMHHD  211



>gb|KHN95056.1| thiazole biosynthetic enzyme variant 1 [Metarhizium album ARSEF 
1941]
Length=321

 Score =   139 bits (351),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMN+AEDAIV+ T
Sbjct  208  QSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNSAEDAIVKNT  267

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  268  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKVF  312


 Score = 59.3 bits (142),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            MSK+L+ PNVK+FNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  160  MSKVLSLPNVKMFNATCVEDLITRPSDEGVRIAGVVTNWTLVSMHHD  206



>ref|XP_001935439.1| thiazole biosynthesis enzyme [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU48013.1| thiazole biosynthesis enzyme [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=329

 Score =   141 bits (355),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ T
Sbjct  215  QSCMDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            RE+VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+    E  A
Sbjct  275  REVVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAVSVWEERQA  324


 Score = 57.8 bits (138),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI +           R+ GVVTNW LVSM+HD
Sbjct  162  LSKVLQFPNVKLFNATAVEDLITRPAPTSSDPNAIRIAGVVTNWTLVSMHHD  213



>ref|XP_007913237.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
 gb|EOO01967.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
Length=326

 Score =   140 bits (353),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  ++ + GM+ LDM +AEDAIV+ T
Sbjct  213  QSCMDPNTINAPLVISTTGHDGPFGAFSVKRLVSMKQLEQLGGMRGLDMASAEDAIVKGT  272

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  273  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVF  317


 Score = 58.2 bits (139),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 7/50 (14%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG-------RVGGVVTNWALVSMNHD  547
            +SK+L  PN+KLFNA A EDLI +         R+ GVVTNW LVSM+HD
Sbjct  162  LSKVLQFPNIKLFNATAVEDLITRPSAGEEDGVRIAGVVTNWTLVSMHHD  211



>ref|XP_003297921.1| hypothetical protein PTT_08482 [Pyrenophora teres f. teres 0-1]
 gb|EFQ93956.1| hypothetical protein PTT_08482 [Pyrenophora teres f. teres 0-1]
Length=329

 Score =   141 bits (355),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ T
Sbjct  215  QSCMDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRT  274

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  213
            RE+VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+    E  A
Sbjct  275  REVVPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAVNVWEERKA  324


 Score = 57.8 bits (138),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 9/52 (17%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG---------RVGGVVTNWALVSMNHD  547
            +SK+L  PNVKLFNA A EDLI +           R+ GVVTNW LVSM+HD
Sbjct  162  LSKVLQFPNVKLFNATAVEDLITRPAPTSSDPNAIRIAGVVTNWTLVSMHHD  213



>gb|KID90425.1| thiazole biosynthetic enzyme variant 1 [Metarhizium guizhouense 
ARSEF 977]
Length=323

 Score =   139 bits (351),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -1

Query  542  QSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLT  363
            QSCMDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMN+AEDAIV+ T
Sbjct  210  QSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNSAEDAIVKNT  269

Query  362  REIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  228
            REIVPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  270  REIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKVF  314


 Score = 58.9 bits (141),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  675  MSKLLARPNVKLFNAVAAEDLIVKNG----RVGGVVTNWALVSMNHD  547
            MSK+L+ PN+K+FNA   EDLI +      R+ GVVTNW LVSM+HD
Sbjct  162  MSKVLSLPNIKMFNATCVEDLITRPSEEGVRIAGVVTNWTLVSMHHD  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420