BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004H23

Length=722
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS68531.1|  hypothetical protein M569_06230                         169   3e-75   Genlisea aurea
emb|CDP14324.1|  unnamed protein product                                167   3e-75   Coffea canephora [robusta coffee]
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    168   3e-75   Sesamum indicum [beniseed]
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    168   1e-74   
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    168   1e-74   Nicotiana sylvestris
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    168   1e-74   Nicotiana sylvestris
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    167   1e-74   Nicotiana tomentosiformis
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    167   2e-74   Nicotiana tomentosiformis
ref|XP_002525432.1|  casein kinase, putative                            168   3e-74   Ricinus communis
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    168   4e-74   Solanum lycopersicum
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    168   5e-74   Sesamum indicum [beniseed]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg             166   5e-74   Citrus clementina [clementine]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...    166   5e-74   Citrus sinensis [apfelsine]
ref|XP_002325416.1|  kinase family protein                              168   6e-74   
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                166   6e-74   Erythranthe guttata [common monkey flower]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    168   6e-74   Cucumis sativus [cucumbers]
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555    168   7e-74   Populus euphratica
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    168   7e-74   Cucumis melo [Oriental melon]
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    167   9e-74   Solanum tuberosum [potatoes]
ref|XP_010088042.1|  Casein kinase I isoform delta                      167   1e-73   
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                   166   2e-73   Citrus sinensis [apfelsine]
gb|KDP39706.1|  hypothetical protein JCGZ_02726                         165   2e-73   Jatropha curcas
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             167   3e-73   Prunus persica
ref|XP_007030718.1|  Kinase family protein                              166   5e-73   Theobroma cacao [chocolate]
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...    167   7e-73   Glycine max [soybeans]
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977    167   1e-72   Prunus mume [ume]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268    163   1e-72   Eucalyptus grandis [rose gum]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210    163   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...    167   2e-72   Cicer arietinum [garbanzo]
gb|KJB45108.1|  hypothetical protein B456_007G289500                    166   2e-72   Gossypium raimondii
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807    165   2e-72   Fragaria vesca subsp. vesca
ref|XP_003624626.1|  Casein kinase I isoform alpha                      168   2e-72   Medicago truncatula
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             165   3e-72   Phaseolus vulgaris [French bean]
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    165   3e-72   Vitis vinifera
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...    166   3e-72   
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...    166   3e-72   Tarenaya hassleriana [spider flower]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151    168   4e-72   
ref|NP_187044.1|  protein kinase family protein                         166   4e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29971.1|  BnaC01g40370D                                          169   5e-72   Brassica napus [oilseed rape]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg             166   5e-72   Capsella rubella
emb|CBI29940.3|  unnamed protein product                                164   5e-72   Vitis vinifera
gb|KHG27523.1|  hypothetical protein F383_15264                         163   6e-72   Gossypium arboreum [tree cotton]
ref|XP_002884421.1|  kinase family protein                              166   6e-72   Arabidopsis lyrata subsp. lyrata
gb|KHG04306.1|  Casein kinase I-like protein                            161   6e-72   Gossypium arboreum [tree cotton]
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg             167   7e-72   Eutrema salsugineum [saltwater cress]
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...    166   8e-72   Camelina sativa [gold-of-pleasure]
emb|CDY21155.1|  BnaA01g33860D                                          168   8e-72   Brassica napus [oilseed rape]
gb|KJB82583.1|  hypothetical protein B456_013G203000                    161   8e-72   Gossypium raimondii
gb|KJB82579.1|  hypothetical protein B456_013G203000                    161   8e-72   Gossypium raimondii
gb|KHG17118.1|  Casein kinase I isoform delta                           163   8e-72   Gossypium arboreum [tree cotton]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...    166   9e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499    166   9e-72   Camelina sativa [gold-of-pleasure]
gb|KJB80965.1|  hypothetical protein B456_013G123300                    164   1e-71   Gossypium raimondii
gb|KJB80963.1|  hypothetical protein B456_013G123300                    164   1e-71   Gossypium raimondii
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...    164   1e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM91528.1|  putative casein kinase                                  166   1e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42890.1|  BnaC05g47610D                                          166   2e-71   Brassica napus [oilseed rape]
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100    165   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226    166   3e-71   Brassica rapa
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016    165   3e-71   Elaeis guineensis
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                   165   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200    166   3e-71   Brassica rapa
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...    166   4e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369    166   5e-71   Phoenix dactylifera
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...    166   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684    163   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg             157   2e-70   Eutrema salsugineum [saltwater cress]
gb|AAO41895.1|  putative casein kinase                                  157   2e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38493.1|  BnaA10g16650D                                          155   2e-70   Brassica napus [oilseed rape]
emb|CDY25451.1|  BnaC09g39660D                                          155   2e-70   Brassica napus [oilseed rape]
ref|NP_197320.1|  protein kinase                                        157   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147    157   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859    154   5e-70   Brassica rapa
emb|CDY50866.1|  BnaA05g37270D                                          166   5e-70   Brassica napus [oilseed rape]
ref|NP_001044393.1|  Os01g0772600                                       164   6e-70   
dbj|BAJ90552.1|  predicted protein                                      164   6e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208    155   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg             155   7e-70   Capsella rubella
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...    166   7e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873    155   8e-70   Camelina sativa [gold-of-pleasure]
gb|EAY92152.1|  hypothetical protein OsI_13865                          163   8e-70   Oryza sativa Indica Group [Indian rice]
dbj|BAN15568.1|  heading date 16                                        163   8e-70   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051531.1|  Os03g0793500                                       163   8e-70   
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...    164   8e-70   
ref|NP_001058996.1|  Os07g0171300                                       166   8e-70   
ref|NP_001183608.1|  uncharacterized protein LOC100502202               164   8e-70   
gb|EEC71557.1|  hypothetical protein OsI_03913                          164   9e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500    167   9e-70   Oryza brachyantha
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...    166   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295    163   1e-69   Brachypodium distachyon [annual false brome]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869    164   1e-69   Oryza brachyantha
ref|XP_002873876.1|  kinase family protein                              154   1e-69   
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940    164   1e-69   
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174    164   2e-69   Setaria italica
dbj|BAJ93086.1|  predicted protein                                      164   2e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB46016.1|  hypothetical protein B456_007G343500                    163   3e-69   Gossypium raimondii
gb|ABF99312.1|  protein kinase family protein, putative, expressed      162   3e-69   Oryza sativa Japonica Group [Japonica rice]
gb|KHF98002.1|  hypothetical protein F383_12939                         163   3e-69   Gossypium arboreum [tree cotton]
emb|CDX70801.1|  BnaC03g08850D                                          154   4e-69   
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...    164   4e-69   
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881    154   5e-69   Brassica rapa
emb|CDY51243.1|  BnaA03g06950D                                          154   5e-69   Brassica napus [oilseed rape]
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...    160   7e-69   Setaria italica
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...    160   7e-69   Setaria italica
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235    166   1e-68   Brachypodium distachyon [annual false brome]
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1          158   1e-68   Zea mays [maize]
ref|NP_001152463.1|  ATP binding protein                                158   1e-68   Zea mays [maize]
ref|NP_001152101.1|  LOC100285738                                       158   3e-68   Zea mays [maize]
gb|ACN36158.1|  unknown                                                 158   3e-68   Zea mays [maize]
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460          160   7e-68   Sorghum bicolor [broomcorn]
emb|CDY53253.1|  BnaA02g04010D                                          151   7e-68   Brassica napus [oilseed rape]
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...    158   8e-68   
emb|CDY02641.1|  BnaC02g07940D                                          151   1e-67   
gb|EMS51431.1|  Casein kinase I isoform beta                            164   2e-67   Triticum urartu
ref|XP_006842223.1|  hypothetical protein AMTR_s00078p00181940          157   2e-67   
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164    151   2e-67   Brassica rapa
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...    161   6e-67   Tarenaya hassleriana [spider flower]
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg                161   7e-67   Erythranthe guttata [common monkey flower]
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146    153   2e-66   Oryza brachyantha
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...    162   4e-66   
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...    162   4e-66   
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...    160   5e-66   Tarenaya hassleriana [spider flower]
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...    159   7e-66   Tarenaya hassleriana [spider flower]
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                       158   8e-66   
ref|XP_007024284.1|  Casein kinase I protein isoform 1                  154   1e-65   
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784    160   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...    163   2e-65   Phoenix dactylifera
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...    163   2e-65   Phoenix dactylifera
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...    163   2e-65   Phoenix dactylifera
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...    163   2e-65   Phoenix dactylifera
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg             161   4e-65   Eutrema salsugineum [saltwater cress]
ref|XP_001764211.1|  predicted protein                                  157   5e-65   
ref|XP_001770883.1|  predicted protein                                  157   5e-65   
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778    161   5e-65   
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg             160   5e-65   Citrus clementina [clementine]
gb|KHN27094.1|  Casein kinase I                                         158   5e-65   Glycine soja [wild soybean]
gb|KDP33655.1|  hypothetical protein JCGZ_07226                         155   6e-65   Jatropha curcas
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819    158   6e-65   Glycine max [soybeans]
ref|XP_006849555.1|  hypothetical protein AMTR_s00024p00176520          157   6e-65   Amborella trichopoda
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373    157   6e-65   Glycine max [soybeans]
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553    160   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792    162   7e-65   Phoenix dactylifera
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg             160   7e-65   Capsella rubella
ref|XP_002882838.1|  kinase family protein                              160   8e-65   Arabidopsis lyrata subsp. lyrata
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                    160   8e-65   Arabis alpina [alpine rockcress]
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616    160   8e-65   Camelina sativa [gold-of-pleasure]
gb|KHN24964.1|  Casein kinase I isoform alpha                           159   8e-65   Glycine soja [wild soybean]
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...    160   9e-65   Camelina sativa [gold-of-pleasure]
emb|CDY51730.1|  BnaA01g37130D                                          160   1e-64   Brassica napus [oilseed rape]
gb|KHN37292.1|  Casein kinase I                                         157   1e-64   Glycine soja [wild soybean]
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...    160   1e-64   
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...    159   1e-64   Glycine max [soybeans]
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765             159   1e-64   
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...    159   1e-64   Glycine max [soybeans]
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482             159   1e-64   
emb|CDY55141.1|  BnaC01g44810D                                          160   2e-64   Brassica napus [oilseed rape]
emb|CDX75726.1|  BnaC03g38090D                                          159   2e-64   
emb|CDP13154.1|  unnamed protein product                                151   2e-64   Coffea canephora [robusta coffee]
gb|KJB56821.1|  hypothetical protein B456_009G137100                    154   2e-64   Gossypium raimondii
ref|NP_187977.1|  protein kinase family protein                         159   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...    162   2e-64   
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106    158   2e-64   Brassica rapa
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...    161   2e-64   Elaeis guineensis
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g             158   2e-64   Phaseolus vulgaris [French bean]
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586    159   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_004162011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    159   2e-64   
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194    159   3e-64   Cucumis sativus [cucumbers]
emb|CDX97505.1|  BnaA05g25740D                                          158   3e-64   
gb|KDP44321.1|  hypothetical protein JCGZ_19188                         159   3e-64   Jatropha curcas
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...    159   3e-64   Camelina sativa [gold-of-pleasure]
gb|KHG14825.1|  hypothetical protein F383_08945                         154   3e-64   Gossypium arboreum [tree cotton]
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538    152   3e-64   Elaeis guineensis
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673    160   3e-64   Brassica rapa
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...    154   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...    154   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128    153   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21848.1|  hypothetical protein B456_004G018000                    159   3e-64   Gossypium raimondii
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457    151   3e-64   
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221    152   4e-64   Vitis vinifera
emb|CAN77676.1|  hypothetical protein VITISV_013722                     152   4e-64   Vitis vinifera
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531    160   4e-64   Brassica rapa
gb|ADE77861.1|  unknown                                                 153   4e-64   Picea sitchensis
emb|CDX82524.1|  BnaA03g32970D                                          160   4e-64   
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414    157   5e-64   Vitis vinifera
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...    150   5e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...    152   5e-64   Nelumbo nucifera [Indian lotus]
emb|CBI28086.3|  unnamed protein product                                157   5e-64   Vitis vinifera
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...    152   5e-64   Nelumbo nucifera [Indian lotus]
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956    159   5e-64   Vitis vinifera
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...    150   5e-64   
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845    151   5e-64   Prunus mume [ume]
ref|XP_002531638.1|  casein kinase, putative                            158   6e-64   Ricinus communis
emb|CDY23629.1|  BnaC05g39650D                                          157   6e-64   Brassica napus [oilseed rape]
emb|CAN69523.1|  hypothetical protein VITISV_040873                     159   6e-64   Vitis vinifera
ref|XP_006853659.1|  hypothetical protein AMTR_s00056p00104010          151   7e-64   Amborella trichopoda
ref|XP_008367866.1|  PREDICTED: casein kinase I                         149   8e-64   
ref|XP_003621013.1|  Casein kinase I isoform alpha                      159   8e-64   Medicago truncatula
ref|XP_007014774.1|  Casein kinase I protein isoform 1                  157   8e-64   
emb|CBI16476.3|  unnamed protein product                                159   8e-64   Vitis vinifera
ref|XP_002516524.1|  casein kinase, putative                            149   8e-64   
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...    158   9e-64   Cicer arietinum [garbanzo]
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                    152   9e-64   Arabis alpina [alpine rockcress]
gb|EMS55588.1|  Casein kinase I-like protein 2                          159   1e-63   Triticum urartu
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081    149   1e-63   
emb|CBI36074.3|  unnamed protein product                                152   1e-63   Vitis vinifera
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420    152   1e-63   Phoenix dactylifera
gb|ABR25333.1|  protein kinase family protein                           143   1e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_010093160.1|  Casein kinase I                                    158   1e-63   
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148    149   1e-63   
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417    147   1e-63   Populus euphratica
gb|ACO87665.1|  protein kinase                                          157   2e-63   Brachypodium sylvaticum
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg             159   2e-63   Prunus persica
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...    159   2e-63   
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176    146   2e-63   Cucumis melo [Oriental melon]
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127    159   2e-63   
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...    148   2e-63   Glycine max [soybeans]
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg             150   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg             151   2e-63   Prunus persica
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...    148   2e-63   Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg             148   2e-63   
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                   148   2e-63   Citrus sinensis [apfelsine]
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...    159   2e-63   
gb|KJB21850.1|  hypothetical protein B456_004G018100                    154   2e-63   Gossypium raimondii
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016    159   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441    159   2e-63   
gb|KHG18897.1|  Casein kinase I                                         149   2e-63   Gossypium arboreum [tree cotton]
ref|XP_007014775.1|  Kinase family protein isoform 2                    154   3e-63   
ref|XP_010102418.1|  Casein kinase I-2-like protein                     149   3e-63   
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488    159   3e-63   
gb|KJB70401.1|  hypothetical protein B456_011G072100                    149   3e-63   Gossypium raimondii
gb|AAT44311.1|  putative casein kinase                                  151   3e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78673.1|  hypothetical protein OsI_18806                          151   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660    148   3e-63   
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g             147   3e-63   
ref|NP_001054881.2|  Os05g0200500                                       151   3e-63   
emb|CDY21505.1|  BnaC03g26920D                                          149   3e-63   Brassica napus [oilseed rape]
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343    159   3e-63   Fragaria vesca subsp. vesca
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076    146   3e-63   Pyrus x bretschneideri [bai li]
dbj|BAG92829.1|  unnamed protein product                                151   3e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148393.1|  PREDICTED: uncharacterized protein LOC101218249    146   3e-63   
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...    148   3e-63   Glycine max [soybeans]
gb|KGN62809.1|  hypothetical protein Csa_2G373520                       146   3e-63   Cucumis sativus [cucumbers]
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...    149   3e-63   Vitis vinifera
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236    150   3e-63   Nelumbo nucifera [Indian lotus]
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                   147   4e-63   Citrus sinensis [apfelsine]
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596    148   4e-63   Tarenaya hassleriana [spider flower]
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456    157   4e-63   Nelumbo nucifera [Indian lotus]
gb|KHN10182.1|  Casein kinase I like 2                                  147   4e-63   Glycine soja [wild soybean]
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999    155   4e-63   Brachypodium distachyon [annual false brome]
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like          158   4e-63   
gb|ADE76410.1|  unknown                                                 154   4e-63   Picea sitchensis
gb|EMT06030.1|  Casein kinase I-2-like protein                          156   5e-63   
ref|XP_002880706.1|  kinase family protein                              145   5e-63   
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211    145   5e-63   
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...    151   5e-63   Elaeis guineensis
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263    150   5e-63   Eucalyptus grandis [rose gum]
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783    147   5e-63   Cucumis melo [Oriental melon]
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...    151   5e-63   Elaeis guineensis
gb|KHN18151.1|  Casein kinase I like 2                                  147   6e-63   Glycine soja [wild soybean]
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869    146   6e-63   Glycine max [soybeans]
ref|NP_180147.2|  protein kinase family protein                         144   6e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAC42254.1|  unknown protein                                         144   6e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973532.1|  protein kinase family protein                         144   6e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like      152   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...    148   7e-63   Sesamum indicum [beniseed]
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210    144   7e-63   Camelina sativa [gold-of-pleasure]
emb|CDP08183.1|  unnamed protein product                                147   7e-63   Coffea canephora [robusta coffee]
emb|CBI20566.3|  unnamed protein product                                148   7e-63   Vitis vinifera
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062    152   7e-63   Elaeis guineensis
gb|KDP34168.1|  hypothetical protein JCGZ_07739                         146   7e-63   Jatropha curcas
gb|ADI78885.1|  casein kinase I                                         148   7e-63   Sesamum indicum [beniseed]
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...    148   8e-63   Sesamum indicum [beniseed]
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g             155   8e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...    159   8e-63   Eucalyptus grandis [rose gum]
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg             145   8e-63   
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...    159   8e-63   Eucalyptus grandis [rose gum]
ref|XP_003592802.1|  Casein kinase-like protein                         154   9e-63   Medicago truncatula
dbj|BAJ99119.1|  predicted protein                                      157   9e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003    155   1e-62   Populus euphratica
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244    146   1e-62   
ref|XP_009117039.1|  PREDICTED: casein kinase I                         148   1e-62   
emb|CDX76739.1|  BnaC08g33250D                                          148   1e-62   
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like          149   1e-62   
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...    152   1e-62   
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726    147   1e-62   
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg             148   1e-62   
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...    152   1e-62   
emb|CDO97984.1|  unnamed protein product                                151   1e-62   
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...    144   1e-62   
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043    144   1e-62   
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125    149   1e-62   
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...    144   1e-62   
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132    155   1e-62   
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...    146   1e-62   
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg             146   1e-62   
ref|NP_001044224.1|  Os01g0744300                                       149   1e-62   
gb|KHG03332.1|  hypothetical protein F383_28165                         144   1e-62   
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770    148   1e-62   
emb|CDY11509.1|  BnaA09g40750D                                          148   1e-62   
gb|EEC71464.1|  hypothetical protein OsI_03705                          149   2e-62   
gb|KHN39248.1|  Casein kinase I isoform delta-like                      146   2e-62   
gb|AES58679.2|  casein kinase I-like protein                            148   2e-62   
gb|KHG27580.1|  Casein kinase I                                         155   2e-62   
ref|XP_002304015.1|  kinase family protein                              155   2e-62   
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...    156   2e-62   
gb|KGN45587.1|  hypothetical protein Csa_7G452910                       145   2e-62   
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...    151   2e-62   
gb|KJB07483.1|  hypothetical protein B456_001G026300                    145   2e-62   
dbj|BAD87518.1|  putative serine/threonine protein kinase               149   2e-62   
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...    151   2e-62   
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                    147   2e-62   
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068    151   2e-62   
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213589    145   2e-62   
gb|KJB07478.1|  hypothetical protein B456_001G026300                    144   2e-62   
ref|XP_004155952.1|  PREDICTED: uncharacterized protein LOC101230855    145   2e-62   
ref|XP_002515975.1|  casein kinase, putative                            144   2e-62   
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630    145   2e-62   
gb|EEE55368.1|  hypothetical protein OsJ_03423                          149   2e-62   
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378    149   2e-62   
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...    150   3e-62   
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912    148   3e-62   
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...    150   3e-62   
ref|XP_002309535.1|  kinase family protein                              145   3e-62   
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...    151   3e-62   
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189    147   3e-62   
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334    147   3e-62   
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    157   3e-62   
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429    149   3e-62   
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228    150   3e-62   
gb|KJB07481.1|  hypothetical protein B456_001G026300                    144   3e-62   
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043    148   3e-62   
ref|XP_007013205.1|  Kinase family protein isoform 1                    157   3e-62   
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864             152   3e-62   
gb|KDP40868.1|  hypothetical protein JCGZ_24867                         146   4e-62   
ref|XP_007024285.1|  Kinase family protein isoform 2                    153   4e-62   
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002             152   4e-62   
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336    148   4e-62   
dbj|BAJ94407.1|  predicted protein                                      148   4e-62   
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711    155   4e-62   
emb|CDM82151.1|  unnamed protein product                                148   4e-62   
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...    145   5e-62   
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g             142   5e-62   
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...    145   5e-62   
gb|KJB54779.1|  hypothetical protein B456_009G048800                    144   6e-62   
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg                148   6e-62   
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197    144   7e-62   
gb|KHG22911.1|  Casein kinase I                                         144   7e-62   
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375    145   7e-62   
gb|KJB54778.1|  hypothetical protein B456_009G048800                    144   7e-62   
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270          150   8e-62   
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720    146   9e-62   
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like      154   9e-62   
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359    146   1e-61   
ref|XP_008226475.1|  PREDICTED: protein kinase 3                        158   1e-61   
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149    145   1e-61   
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947    144   1e-61   
ref|NP_001169571.1|  hypothetical protein                               150   1e-61   
ref|XP_007013209.1|  Kinase family protein isoform 5                    155   1e-61   
ref|XP_007012164.1|  Casein kinase I protein                            141   1e-61   
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332    146   1e-61   
dbj|BAJ99167.1|  predicted protein                                      147   1e-61   
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860    145   2e-61   
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                    147   2e-61   
ref|XP_010098134.1|  Casein kinase I-2-like protein                     145   3e-61   
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g             144   3e-61   
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                   155   3e-61   
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg             155   3e-61   
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g             147   3e-61   
gb|EMT25395.1|  Casein kinase I-2-like protein                          146   4e-61   
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237    149   4e-61   
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445    155   4e-61   
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790          145   4e-61   
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938    145   4e-61   
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090    155   5e-61   
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757              154   5e-61   
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922    155   5e-61   
emb|CDM84047.1|  unnamed protein product                                146   6e-61   
ref|NP_001141429.1|  uncharacterized protein LOC100273539               154   6e-61   
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1    147   6e-61   
dbj|BAK02283.1|  predicted protein                                      146   6e-61   
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718    147   6e-61   
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757              154   7e-61   
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435    143   8e-61   
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...    153   9e-61   
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751    137   1e-60   
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757              152   1e-60   
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824    137   1e-60   
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791              145   1e-60   
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...    145   1e-60   
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg             155   1e-60   
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2              145   1e-60   
gb|KEH36077.1|  casein kinase I-like protein                            145   2e-60   
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like    148   2e-60   
gb|EMT27276.1|  Casein kinase I-2-like protein                          148   2e-60   
gb|EMS66552.1|  Casein kinase I-like protein 2                          146   2e-60   
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3         148   2e-60   
gb|KJB82881.1|  hypothetical protein B456_013G219500                    142   2e-60   
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like          145   2e-60   
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg                145   2e-60   
ref|XP_003057011.1|  Serine/Threonine protein kinase                    147   2e-60   
gb|KJB27133.1|  hypothetical protein B456_004G279600                    152   2e-60   
gb|KJB82582.1|  hypothetical protein B456_013G203000                    161   2e-60   
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g             141   2e-60   
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902    139   3e-60   
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026    139   3e-60   
ref|NP_001042306.1|  Os01g0198200                                       145   4e-60   
dbj|BAD73223.1|  putative serine/threonine protein kinase               145   4e-60   
gb|EEC70115.1|  hypothetical protein OsI_00774                          145   4e-60   
gb|EEE54054.1|  hypothetical protein OsJ_00747                          145   4e-60   
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g             143   5e-60   
dbj|BAD73224.1|  putative serine/threonine protein kinase               145   6e-60   
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546              140   7e-60   
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...    151   1e-59   
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...    151   1e-59   
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                    145   1e-59   
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324              142   1e-59   
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase       142   1e-59   
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...    153   5e-59   
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...    153   6e-59   
ref|XP_002502422.1|  predicted protein                                  143   6e-59   
ref|XP_002514324.1|  casein kinase, putative                            157   6e-59   
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase       144   1e-58   
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552             138   3e-58   
gb|EPS63371.1|  hypothetical protein M569_11412                         143   5e-58   
ref|XP_003075213.1|  protein kinase family protein (ISS)                140   7e-58   
gb|EMT06466.1|  Casein kinase I isoform alpha                           164   8e-58   
emb|CEG01140.1|  Serine/threonine-protein kinase, active site           140   9e-58   
gb|EMS55265.1|  Casein kinase I isoform alpha                           164   1e-57   
ref|XP_002882289.1|  hypothetical protein ARALYDRAFT_340491             161   1e-57   
ref|XP_001416335.1|  predicted protein                                  141   1e-57   
gb|EMS54400.1|  Casein kinase I-like protein 2                          136   2e-57   
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2         143   2e-57   
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3         143   2e-57   
ref|NP_187043.1|  protein kinase-related protein                        139   4e-57   
ref|XP_003588428.1|  Casein kinase I isoform alpha                      137   6e-57   
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3         152   1e-56   
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like    152   1e-56   
gb|KHG22741.1|  Casein kinase I isoform delta                           154   1e-56   
gb|KJB54170.1|  hypothetical protein B456_009G024100                    154   1e-56   
ref|XP_007514232.1|  predicted protein                                  139   2e-56   
gb|KJB54173.1|  hypothetical protein B456_009G024100                    154   9e-56   
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like    130   5e-55   
ref|XP_010088832.1|  Casein kinase I isoform alpha                      153   2e-54   
ref|XP_007014776.1|  Kinase family protein isoform 3                    156   9e-54   
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695             125   2e-53   
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1         129   2e-53   
gb|KJB46017.1|  hypothetical protein B456_007G343500                    145   2e-53   
gb|KDD76924.1|  hypothetical protein H632_c65p1                         132   2e-53   
ref|XP_010915572.1|  PREDICTED: uncharacterized protein LOC105040...    152   6e-53   
ref|XP_010915562.1|  PREDICTED: uncharacterized protein LOC105040...    152   9e-53   
ref|XP_010915546.1|  PREDICTED: uncharacterized protein LOC105040...    152   1e-52   
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein         137   1e-52   
ref|XP_010915554.1|  PREDICTED: uncharacterized protein LOC105040...    152   1e-52   
gb|AET01488.2|  casein kinase I-like protein                            119   1e-52   
emb|CAN74986.1|  hypothetical protein VITISV_008771                     148   1e-52   
gb|EMT12651.1|  Casein kinase I-2-like protein                          147   2e-52   
ref|XP_003627012.1|  Casein kinase-like protein                         119   3e-52   
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg             132   5e-52   
ref|XP_004963352.1|  PREDICTED: probable casein kinase I homolog ...    156   7e-52   
gb|KJB07477.1|  hypothetical protein B456_001G026300                    144   3e-51   
gb|KDD72198.1|  hypothetical protein H632_c3713p0                       137   1e-50   
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600          126   4e-50   
tpg|DAA35739.1|  TPA: putative homeodomain-like transcription fac...    138   1e-49   
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                    118   9e-49   
gb|EPS62497.1|  hypothetical protein M569_12290                         114   3e-48   
ref|XP_010229461.1|  PREDICTED: casein kinase I isoform alpha-like      140   1e-47   
gb|AFW85111.1|  hypothetical protein ZEAMMB73_338907                    143   4e-47   
gb|KJB54177.1|  hypothetical protein B456_009G024100                    154   1e-46   
tpg|DAA56574.1|  TPA: hypothetical protein ZEAMMB73_926529              154   1e-46   
ref|XP_011400089.1|  Casein kinase I-like protein 2                     120   1e-46   
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392    127   1e-46   
gb|ADE75678.1|  unknown                                                 162   1e-44   
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    107   4e-44   
gb|AAP80674.1|  casein kinase-like protein                              117   5e-44   
gb|EMT07061.1|  Casein kinase I-2-like protein                          122   6e-44   
gb|EMT21083.1|  Casein kinase I-2-like protein                          154   8e-43   
ref|XP_008452134.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    136   1e-42   
gb|EMT25758.1|  Casein kinase I isoform delta-like protein              144   3e-41   
gb|EMS61861.1|  Casein kinase I isoform delta-like protein              147   3e-41   
gb|AIS72786.1|  casein kinase-like protein                              112   7e-41   
ref|XP_002458472.1|  hypothetical protein SORBIDRAFT_03g034330          115   1e-38   
ref|XP_005648473.1|  kinase-like protein                                110   3e-38   
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855    146   2e-36   
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...    146   2e-36   
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...    145   2e-36   
ref|XP_010090279.1|  hypothetical protein L484_001310                   105   3e-35   
gb|KIY93350.1|  hypothetical protein MNEG_14612                         112   1e-34   
ref|XP_010103948.1|  hypothetical protein L484_020200                   104   3e-34   
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...    137   7e-34   
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...    137   7e-34   
gb|AEW08952.1|  hypothetical protein CL2426Contig1_01                   122   1e-33   
gb|EYU34156.1|  hypothetical protein MIMGU_mgv1a003255mg                110   3e-33   
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...    137   3e-33   
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...    137   4e-33   
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like    132   8e-32   
ref|XP_010051239.1|  PREDICTED: casein kinase I homolog hhp1-like     92.0    9e-32   
gb|KCW81595.1|  hypothetical protein EUGRSUZ_C02959                   92.0    1e-31   
ref|XP_010090282.1|  hypothetical protein L484_001313                 84.3    1e-31   
ref|XP_010109262.1|  hypothetical protein L484_014856                 98.2    2e-31   
ref|XP_010051251.1|  PREDICTED: casein kinase I homolog hhp1-like     89.4    3e-31   



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score =   169 bits (429),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  605  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  638


 Score =   139 bits (351),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAF+LSIPRRKMMDETQETLRTSAFPS+HVKEKWSKNLYIASIC
Sbjct  639  WESGYRITSMAATADQAAFVLSIPRRKMMDETQETLRTSAFPSSHVKEKWSKNLYIASIC  698

Query  235  YGRTVC  218
            YGRTVC
Sbjct  699  YGRTVC  704


 Score = 21.9 bits (45),  Expect(3) = 3e-75, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   167 bits (424),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  610  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  643


 Score =   141 bits (355),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  644  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  703

Query  235  YGRTVC  218
            YGRTVC
Sbjct  704  YGRTVC  709


 Score = 21.9 bits (45),  Expect(3) = 3e-75, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  543  HKDWIME  549



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   168 bits (425),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  606  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  639


 Score =   140 bits (354),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  640  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  699

Query  235  YGRTVC  218
            YGRTVC
Sbjct  700  YGRTVC  705


 Score = 21.9 bits (45),  Expect(3) = 3e-75, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  539  HKDWIME  545



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score =   168 bits (426),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  583  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  642

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  643  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  676


 Score =   139 bits (349),  Expect(3) = 1e-74, Method: Composition-based stats.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRIT MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  677  WESGYRITCMAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  736

Query  235  YGRTVC  218
            YGRTVC
Sbjct  737  YGRTVC  742


 Score = 21.9 bits (45),  Expect(3) = 1e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  576  HKDWIME  582



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   168 bits (425),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  648


 Score =   139 bits (350),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  649  WESGYRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASIC  708

Query  235  YGRTVC  218
            YGRTVC
Sbjct  709  YGRTVC  714


 Score = 21.9 bits (45),  Expect(3) = 1e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  548  HKDWIME  554



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   168 bits (425),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  642


 Score =   139 bits (349),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WESGYRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.9 bits (45),  Expect(3) = 1e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   167 bits (424),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  648


 Score =   139 bits (350),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  649  WESGYRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASIC  708

Query  235  YGRTVC  218
            YGRTVC
Sbjct  709  YGRTVC  714


 Score = 21.9 bits (45),  Expect(3) = 1e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  548  HKDWIME  554



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   167 bits (424),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  642


 Score =   139 bits (349),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WESGYRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.9 bits (45),  Expect(3) = 2e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score =   168 bits (426),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNFYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  606  AGNRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  639


 Score =   137 bits (346),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  640  WESGYRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASIC  699

Query  235  YGRTVC  218
            YGRTVC
Sbjct  700  YGRTVC  705


 Score = 21.6 bits (44),  Expect(3) = 3e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  539  HKDWIME  545



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   168 bits (426),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGY+EQVVELDFLYPSEGIHR+
Sbjct  610  AGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHRR  643


 Score =   137 bits (344),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE G+RITSMAATADQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  644  WEGGFRITSMAATADQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASIC  703

Query  235  YGRTVC  218
            YGRTVC
Sbjct  704  YGRTVC  709


 Score = 21.9 bits (45),  Expect(3) = 4e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  543  HKDWIME  549



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   168 bits (425),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  606  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  639


 Score =   137 bits (345),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAAT DQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  640  WENGYRITSMAATGDQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASIC  699

Query  235  YGRTVC  218
            YGRTVC
Sbjct  700  YGRTVC  705


 Score = 21.9 bits (45),  Expect(3) = 5e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  539  HKDWIME  545



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score =   166 bits (421),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  605  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  638


 Score =   138 bits (348),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  639  WESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASIC  698

Query  235  YGRTVC  218
            YGRTVC
Sbjct  699  YGRTVC  704


 Score = 21.6 bits (44),  Expect(3) = 5e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score =   166 bits (421),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  609  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  642


 Score =   138 bits (348),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.6 bits (44),  Expect(3) = 5e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score =   168 bits (425),  Expect(3) = 6e-74, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  561  QWEKNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  620

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  621  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  654


 Score =   136 bits (343),  Expect(3) = 6e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  655  WESGFRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASIC  714

Query  235  YGRTVC  218
            YGRTVC
Sbjct  715  YGRTVC  720


 Score = 21.9 bits (45),  Expect(3) = 6e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  554  HKDWIME  560



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   166 bits (421),  Expect(3) = 6e-74, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLV+MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGAANGSSLVIMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  607  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  640


 Score =   138 bits (348),  Expect(3) = 6e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRIT+MAATADQ AFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  641  WENGYRITAMAATADQGAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.9 bits (45),  Expect(3) = 6e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   168 bits (426),  Expect(3) = 6e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  642


 Score =   136 bits (342),  Expect(3) = 6e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRIT MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WESGYRITCMAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.9 bits (45),  Expect(3) = 6e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score =   168 bits (425),  Expect(3) = 7e-74, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  608  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  641


 Score =   136 bits (343),  Expect(3) = 7e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  642  WESGFRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.9 bits (45),  Expect(3) = 7e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   168 bits (426),  Expect(3) = 7e-74, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  642


 Score =   136 bits (342),  Expect(3) = 7e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRIT MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WESGYRITCMAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.6 bits (44),  Expect(3) = 7e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   167 bits (422),  Expect(3) = 9e-74, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGY+EQVVELDFLYPSEGIHR+
Sbjct  610  AGNRWGVVMSRNAGYAEQVVELDFLYPSEGIHRR  643


 Score =   137 bits (344),  Expect(3) = 9e-74, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE G+RITSMAATADQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  644  WEGGFRITSMAATADQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASIC  703

Query  235  YGRTVC  218
            YGRTVC
Sbjct  704  YGRTVC  709


 Score = 21.9 bits (45),  Expect(3) = 9e-74, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  543  HKDWIME  549



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score =   167 bits (424),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGY+EQVVELDFLYPSEGIH++
Sbjct  607  AGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHKR  640


 Score =   136 bits (342),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC
Sbjct  641  WENGYRITSMAATADQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASIC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.6 bits (44),  Expect(3) = 1e-73, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score =   166 bits (419),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  378  QWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  437

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  438  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  471


 Score =   138 bits (347),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  472  WESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASIC  531

Query  235  YGRTVC  218
            YGRTVC
Sbjct  532  YGRTVC  537



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score =   165 bits (418),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA+NGSSLVVMSKGTP+TQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGASNGSSLVVMSKGTPFTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  606  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  639


 Score =   137 bits (346),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  640  WESGYRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASIC  699

Query  235  YGRTVC  218
            YGRTVC
Sbjct  700  YGRTVC  705


 Score = 21.6 bits (44),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  539  HKDWIME  545



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   167 bits (423),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNFYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG RWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  608  AGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  641


 Score =   135 bits (340),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC
Sbjct  642  WESGYRITSMAATTDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.6 bits (44),  Expect(3) = 3e-73, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score =   166 bits (419),  Expect(3) = 5e-73, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGANNASSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  606  AGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  639


 Score =   136 bits (343),  Expect(3) = 5e-73, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  640  WESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSAHVKEKWAKNLYIASIC  699

Query  235  YGRTVC  218
            YGRTVC
Sbjct  700  YGRTVC  705


 Score = 21.6 bits (44),  Expect(3) = 5e-73, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  539  HKDWIME  545



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score =   167 bits (424),  Expect(3) = 7e-73, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  610  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  643


 Score =   134 bits (336),  Expect(3) = 7e-73, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  644  WENGYRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASIC  703

Query  235  YGRTVC  218
            YGRTVC
Sbjct  704  YGRTVC  709


 Score = 21.9 bits (45),  Expect(3) = 7e-73, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  543  HKDWIME  549



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score =   167 bits (423),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG RWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  608  AGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  641


 Score =   134 bits (336),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC
Sbjct  642  WESGYRITSMAATTDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASIC  701

Query  235  YGRTVC  218
            +GRTVC
Sbjct  702  HGRTVC  707


 Score = 21.6 bits (44),  Expect(3) = 1e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score =   163 bits (412),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE+N+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSE+FPFKWINKKWKEGFHVTSMTT
Sbjct  543  QWERNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVTSMTT  602

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  603  AGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  636


 Score =   138 bits (347),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  637  WESGYRITSMAATADQAAFILSIPKRKVMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  696

Query  235  YGRTVC  218
            YGRTVC
Sbjct  697  YGRTVC  702


 Score = 21.6 bits (44),  Expect(3) = 1e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  536  HKDWIME  542



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score =   163 bits (413),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWENNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAG+S+QVVELDF+YPSEGIHR+
Sbjct  608  AGNRWGVVMSRNAGFSDQVVELDFVYPSEGIHRR  641


 Score =   137 bits (344),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC
Sbjct  642  WESGYRITSMAATADQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.6 bits (44),  Expect(3) = 1e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score =   167 bits (424),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  642


 Score =   132 bits (332),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+ YRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WENNYRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.6 bits (44),  Expect(3) = 2e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score =   166 bits (419),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE+N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWERNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  607  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  640


 Score =   134 bits (338),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  641  WESGYRITSMAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASIC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.6 bits (44),  Expect(3) = 2e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score =   165 bits (418),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  533  QWDKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  592

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  593  AGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  626


 Score =   134 bits (337),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT+DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC
Sbjct  627  WESGYRITSMAATSDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASIC  686

Query  235  YGRTVC  218
            +GRTVC
Sbjct  687  FGRTVC  692


 Score = 21.6 bits (44),  Expect(3) = 2e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  526  HKDWIME  532



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score =   168 bits (425),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRR  642


 Score =   131 bits (330),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+ YRITSMAAT DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WENNYRITSMAATNDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.9 bits (45),  Expect(3) = 2e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   165 bits (418),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYS+QVVE+DFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNSGYSDQVVEIDFLYPSEGIHRR  642


 Score =   134 bits (336),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  643  WENGYRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.9 bits (45),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   165 bits (418),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GY++QVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRR  642


 Score =   134 bits (337),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE GYRITSMAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+IC
Sbjct  643  WECGYRITSMAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAIC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708


 Score = 21.6 bits (44),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score =   166 bits (419),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHR+
Sbjct  605  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRR  638


 Score =   133 bits (335),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  639  WEGGYRITSMAATADQAAFILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASIC  698

Query  235  YGRTVC  218
            YGRTVC
Sbjct  699  YGRTVC  704


 Score = 21.6 bits (44),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score =   166 bits (419),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHR+
Sbjct  604  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRR  637


 Score =   133 bits (335),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  638  WEGGYRITSMAATADQAAFILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASIC  697

Query  235  YGRTVC  218
            YGRTVC
Sbjct  698  YGRTVC  703


 Score = 21.6 bits (44),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  537  HKDWIME  543



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score =   168 bits (425),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  648


 Score =   130 bits (327),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  649  WESGYRITSTAATHDQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  708

Query  235  YGRTV  221
            YGRTV
Sbjct  709  YGRTV  713


 Score = 21.9 bits (45),  Expect(3) = 4e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  548  HKDWIME  554



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score =   166 bits (421),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  635


 Score =   132 bits (332),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  636  WESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  695

Query  235  YGRTVC  218
            YGRTVC
Sbjct  696  YGRTVC  701


 Score = 21.9 bits (45),  Expect(3) = 4e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  535  HKDWIME  541



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score =   169 bits (427),  Expect(3) = 5e-72, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  544  QWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  604  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  637


 Score =   129 bits (325),  Expect(3) = 5e-72, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASIC
Sbjct  638  WESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASIC  697

Query  235  YGRTVC  218
            YGRTVC
Sbjct  698  YGRTVC  703


 Score = 21.9 bits (45),  Expect(3) = 5e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  537  HKDWIME  543



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score =   166 bits (420),  Expect(3) = 5e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  635


 Score =   132 bits (331),  Expect(3) = 5e-72, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  636  WESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  695

Query  235  YGRTVC  218
            YGRTVC
Sbjct  696  YGRTVC  701


 Score = 21.9 bits (45),  Expect(3) = 5e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  535  HKDWIME  541



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   164 bits (416),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  434  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  493

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GY++QVVELDFLYPSEGIHR+
Sbjct  494  AGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRR  527


 Score =   134 bits (337),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE GYRITSMAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+IC
Sbjct  528  WECGYRITSMAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAIC  587

Query  235  YGRTVC  218
            YGRTVC
Sbjct  588  YGRTVC  593



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   163 bits (413),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  607  SGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  640


 Score =   135 bits (339),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  641  WESGYRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASIC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.6 bits (44),  Expect(3) = 6e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score =   166 bits (420),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  543  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  602

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  603  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  636


 Score =   132 bits (332),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  637  WESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  696

Query  235  YGRTVC  218
            YGRTVC
Sbjct  697  YGRTVC  702


 Score = 21.6 bits (44),  Expect(3) = 6e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  536  HKDWIME  542



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score =   161 bits (408),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGATNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS WGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  607  AGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  640


 Score =   136 bits (343),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAF+LSIP+RKMMDETQETLRTSAFPSTHVKEKW+KNLY+AS+C
Sbjct  641  WESGYRITSMAATADQAAFVLSIPKRKMMDETQETLRTSAFPSTHVKEKWAKNLYLASVC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.9 bits (45),  Expect(3) = 6e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score =   167 bits (423),  Expect(3) = 7e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGSNNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  635


 Score =   130 bits (327),  Expect(3) = 7e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASIC
Sbjct  636  WESGYRITSMAATADQAALILSIPKRKISDETQETLRTSAFPSTHVKDKWAKNLYIASIC  695

Query  235  YGRTVC  218
            YGRTVC
Sbjct  696  YGRTVC  701


 Score = 21.9 bits (45),  Expect(3) = 7e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  535  HKDWIME  541



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score =   166 bits (421),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  635


 Score =   131 bits (329),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  636  WENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  695

Query  235  YGRTVC  218
            YGRTVC
Sbjct  696  YGRTVC  701


 Score = 21.9 bits (45),  Expect(3) = 8e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  535  HKDWIME  541



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score =   168 bits (425),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  605  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRR  638


 Score =   129 bits (325),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASIC
Sbjct  639  WESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASIC  698

Query  235  YGRTVC  218
            YGRTVC
Sbjct  699  YGRTVC  704


 Score = 21.9 bits (45),  Expect(3) = 8e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score =   161 bits (407),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS WGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  608  AGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  641


 Score =   136 bits (343),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASIC
Sbjct  642  WESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.9 bits (45),  Expect(3) = 8e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score =   161 bits (407),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS WGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  607  AGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  640


 Score =   136 bits (343),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASIC
Sbjct  641  WESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASIC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.9 bits (45),  Expect(3) = 8e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score =   163 bits (413),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE+N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWERNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            A SRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  607  AASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  640


 Score =   134 bits (338),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  641  WESGYRITSMAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASIC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.6 bits (44),  Expect(3) = 8e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score =   166 bits (421),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  600

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  601  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  634


 Score =   131 bits (329),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  635  WENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  694

Query  235  YGRTVC  218
            YGRTVC
Sbjct  695  YGRTVC  700


 Score = 21.9 bits (45),  Expect(3) = 9e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  534  HKDWIME  540



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score =   166 bits (421),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  635


 Score =   131 bits (329),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  636  WENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  695

Query  235  YGRTVC  218
            YGRTVC
Sbjct  696  YGRTVC  701


 Score = 21.9 bits (45),  Expect(3) = 9e-72, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  535  HKDWIME  541



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score =   164 bits (414),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  608  SGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  641


 Score =   133 bits (335),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  642  WENGYRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.6 bits (44),  Expect(3) = 1e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score =   164 bits (414),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHR+
Sbjct  607  SGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRR  640


 Score =   133 bits (335),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  641  WENGYRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706


 Score = 21.6 bits (44),  Expect(3) = 1e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score =   164 bits (414),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  554  QWEKNFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  613

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            A SRWGVVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  614  AASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRR  647


 Score =   133 bits (335),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAF+LSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  648  WESGYRITSMAATPDQAAFVLSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASIC  707

Query  235  YGRTVC  218
            YGRTVC
Sbjct  708  YGRTVC  713


 Score = 21.6 bits (44),  Expect(3) = 1e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  547  HKDWIME  553



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score =   166 bits (419),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  144  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  203

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  204  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  237


 Score =   132 bits (331),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  238  WESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  297

Query  235  YGRTVC  218
            YGRTVC
Sbjct  298  YGRTVC  303



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score =   166 bits (421),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  600

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  601  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRR  634


 Score =   130 bits (327),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH+KEKW+KNLYIASIC
Sbjct  635  WESGFRITSMAATADQAALILSIPKRKLTDETQETLRTSAFPSTHIKEKWAKNLYIASIC  694

Query  235  YGRTVC  218
            YGRTVC
Sbjct  695  YGRTVC  700


 Score = 21.9 bits (45),  Expect(3) = 2e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  534  HKDWIME  540



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   165 bits (417),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAG  NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISAIAGTTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG RWGVVMSRN+GYS+QVVELDFLYPSEGIHR+
Sbjct  615  AGGRWGVVMSRNSGYSDQVVELDFLYPSEGIHRR  648


 Score =   131 bits (330),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  649  WESGYRITSTAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  708

Query  235  YGRTVC  218
            YGRTVC
Sbjct  709  YGRTVC  714


 Score = 21.9 bits (45),  Expect(3) = 2e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  548  HKDWIME  554



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score =   166 bits (420),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA NGSS VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNFYISSIAGANNGSSFVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  605  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRR  638


 Score =   129 bits (325),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASIC
Sbjct  639  WESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASIC  698

Query  235  YGRTVC  218
            YGRTVC
Sbjct  699  YGRTVC  704


 Score = 21.9 bits (45),  Expect(3) = 3e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score =   165 bits (418),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTT
Sbjct  559  QWEKNYYISAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTT  618

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHR+
Sbjct  619  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRR  652


 Score =   130 bits (327),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  653  WENGYRITSTAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  712

Query  235  YGRTVC  218
            YGRTVC
Sbjct  713  YGRTVC  718


 Score = 21.6 bits (44),  Expect(3) = 3e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  552  HKDWIME  558



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score =   165 bits (418),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  335  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  394

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  395  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  428


 Score =   130 bits (328),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  429  WESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASIC  488

Query  235  YGRTVC  218
            YGRTVC
Sbjct  489  YGRTVC  494



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score =   166 bits (421),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  536  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  595

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  596  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRR  629


 Score =   129 bits (324),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASIC
Sbjct  630  WESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASIC  689

Query  235  YGRTVC  218
            YGRTVC
Sbjct  690  YGRTVC  695


 Score = 21.6 bits (44),  Expect(3) = 3e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  529  HKDWIME  535



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score =   166 bits (421),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  592  QWEKNYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  651

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHR+
Sbjct  652  AGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRR  685


 Score =   129 bits (323),  Expect(3) = 4e-71, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASIC
Sbjct  686  WESGYRITSTAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASIC  745

Query  235  YGRTVC  218
            YGRTVC
Sbjct  746  YGRTVC  751


 Score = 21.6 bits (44),  Expect(3) = 4e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  585  HKDWIME  591



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score =   166 bits (419),  Expect(3) = 5e-71, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTT
Sbjct  559  QWEKNYYISAIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTT  618

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHR+
Sbjct  619  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRR  652


 Score =   129 bits (324),  Expect(3) = 5e-71, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASIC
Sbjct  653  WENGYRITSTAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASIC  712

Query  235  YGRTVC  218
            YGRTVC
Sbjct  713  YGRTVC  718


 Score = 21.9 bits (45),  Expect(3) = 5e-71, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  552  HKDWIME  558



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   166 bits (420),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  557  QWEKNYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  616

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHR+
Sbjct  617  AGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRR  650


 Score =   128 bits (321),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASIC
Sbjct  651  WESGYRITSTAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASIC  710

Query  235  YGRTVC  218
            YGRTVC
Sbjct  711  YGRTVC  716


 Score = 21.6 bits (44),  Expect(3) = 1e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  550  HKDWIME  556



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score =   163 bits (412),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYS+QVVELDFLYPSEGIH++
Sbjct  609  AGNRWGVVMSRNSGYSDQVVELDFLYPSEGIHKR  642


 Score =   130 bits (328),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASIC
Sbjct  643  WESGYRITSTAATVDQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  702

Query  235  YGRTV  221
            YGRTV
Sbjct  703  YGRTV  707


 Score = 21.9 bits (45),  Expect(3) = 1e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  542  HKDWIME  548



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score =   157 bits (397),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  536  QWEKNYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  595

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+SEQVVELDFLYPS+GIHR+
Sbjct  596  AGNRWGVVMSRNSGFSEQVVELDFLYPSDGIHRR  629


 Score =   136 bits (343),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  630  WESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKDKWAKNLYIASIC  689

Query  235  YGRTVC  218
            YGRTVC
Sbjct  690  YGRTVC  695


 Score = 21.6 bits (44),  Expect(3) = 2e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  529  HKDWIME  535



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score =   157 bits (398),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  148  QWEKNYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  207

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHR+
Sbjct  208  AGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRR  241


 Score =   135 bits (340),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  242  WESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASIC  301

Query  235  YGRTVC  218
            +GRTVC
Sbjct  302  FGRTVC  307



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score =   155 bits (392),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  531  QWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  590

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  591  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  624


 Score =   137 bits (345),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+C
Sbjct  625  WESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVC  684

Query  235  YGRTVC  218
            YGRTVC
Sbjct  685  YGRTVC  690


 Score = 21.6 bits (44),  Expect(3) = 2e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  524  HKDWIME  530



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score =   155 bits (392),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  531  QWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  590

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  591  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  624


 Score =   137 bits (345),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+C
Sbjct  625  WESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVC  684

Query  235  YGRTVC  218
            YGRTVC
Sbjct  685  YGRTVC  690


 Score = 21.9 bits (45),  Expect(3) = 2e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  524  HKDWIME  530



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score =   157 bits (397),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  532  QWEKNYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  591

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHR+
Sbjct  592  AGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRR  625


 Score =   135 bits (341),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  626  WESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASIC  685

Query  235  YGRTVC  218
            +GRTVC
Sbjct  686  FGRTVC  691


 Score = 21.6 bits (44),  Expect(3) = 3e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  525  HKDWIME  531



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score =   157 bits (396),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  533  QWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  592

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHR+
Sbjct  593  AGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRR  626


 Score =   136 bits (342),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  627  WESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASIC  686

Query  235  YGRTVC  218
            +GRTVC
Sbjct  687  FGRTVC  692


 Score = 21.6 bits (44),  Expect(3) = 3e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  526  HKDWIME  532



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score =   154 bits (389),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FH+TSMTT
Sbjct  532  QWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHLTSMTT  591

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  592  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  625


 Score =   137 bits (345),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+C
Sbjct  626  WESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVC  685

Query  235  YGRTVC  218
            YGRTVC
Sbjct  686  YGRTVC  691


 Score = 21.6 bits (44),  Expect(3) = 5e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  525  HKDWIME  531



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score =   166 bits (420),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  540  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  599

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  600  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRR  633


 Score =   125 bits (315),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASIC
Sbjct  634  WESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASIC  693

Query  235  YGRTV  221
            YGRTV
Sbjct  694  YGRTV  698


 Score = 21.9 bits (45),  Expect(3) = 5e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  533  HKDWIME  539



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score =   164 bits (415),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  539  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  598

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHR+
Sbjct  599  AGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRR  632


 Score =   128 bits (321),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  633  WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  692

Query  235  YGRTV  221
            YGRTV
Sbjct  693  YGRTV  697



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   164 bits (415),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  535  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  594

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  595  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  628


 Score =   128 bits (321),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  629  WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  688

Query  235  YGRTV  221
            YGRTV
Sbjct  689  YGRTV  693



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score =   155 bits (392),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  488  QWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  547

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  548  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  581


 Score =   136 bits (342),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  582  WESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASIC  641

Query  235  YGRTVC  218
            +GRTVC
Sbjct  642  FGRTVC  647


 Score = 21.6 bits (44),  Expect(3) = 6e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  481  HKDWIME  487



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score =   155 bits (393),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  533  QWEKNYYISSIAGSDNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  592

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  593  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  626


 Score =   135 bits (341),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  627  WESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASIC  686

Query  235  YGRTVC  218
            +GRTVC
Sbjct  687  FGRTVC  692


 Score = 21.6 bits (44),  Expect(3) = 7e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  526  HKDWIME  532



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score =   166 bits (421),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  635


 Score =   124 bits (312),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 1/66 (2%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASIC
Sbjct  636  WENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASIC  694

Query  235  YGRTVC  218
            YGRTVC
Sbjct  695  YGRTVC  700


 Score = 21.9 bits (45),  Expect(3) = 7e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  535  HKDWIME  541



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score =   155 bits (392),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  533  QWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  592

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  593  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  626


 Score =   135 bits (341),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  627  WESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASIC  686

Query  235  YGRTVC  218
            +GRTVC
Sbjct  687  FGRTVC  692


 Score = 21.6 bits (44),  Expect(3) = 8e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  526  HKDWIME  532



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score =   163 bits (412),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHR+
Sbjct  608  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRR  641


 Score =   128 bits (322),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASIC
Sbjct  642  WETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.6 bits (44),  Expect(3) = 8e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   163 bits (412),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHR+
Sbjct  608  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRR  641


 Score =   128 bits (322),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASIC
Sbjct  642  WETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.6 bits (44),  Expect(3) = 8e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   163 bits (412),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHR+
Sbjct  608  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRR  641


 Score =   128 bits (322),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASIC
Sbjct  642  WETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 21.6 bits (44),  Expect(3) = 8e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score =   164 bits (415),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTT
Sbjct  653  QWENNYYISAIAGAMNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTT  712

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  713  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  746


 Score =   127 bits (319),  Expect(3) = 8e-70, Method: Composition-based stats.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  747  WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  806

Query  235  YGRTV  221
            YGRTV
Sbjct  807  YGRTV  811


 Score = 21.6 bits (44),  Expect(3) = 8e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  646  HKDWIME  652



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score =   166 bits (420),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEKNFYI++IAG+ANGSSLVVMSKGTPY+QQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  539  DQWEKNFYITAIAGSANGSSLVVMSKGTPYSQQSYKVSESFPFKWINKKWKEGFHVTSMA  598

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  599  TAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  633


 Score =   125 bits (314),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS+AAT DQAAFILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC
Sbjct  634  WETGYRITSIAATNDQAAFILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASIC  693

Query  235  YGRTVC  218
            +GRTVC
Sbjct  694  FGRTVC  699



>ref|NP_001183608.1| uncharacterized protein LOC100502202 [Zea mays]
 gb|ACR37739.1| unknown [Zea mays]
Length=162

 Score =   164 bits (414),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTT
Sbjct  3    QWENNYYISAIAGAMNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTT  62

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  63   AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  96


 Score =   128 bits (321),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  97   WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  156

Query  235  YGRTV  221
            YGRTV
Sbjct  157  YGRTV  161



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score =   164 bits (414),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  488  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  547

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHR+
Sbjct  548  AGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRR  581


 Score =   127 bits (320),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  582  WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  641

Query  235  YGRTV  221
            YGRTV
Sbjct  642  YGRTV  646



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score =   167 bits (423),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEKNFYI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  542  DQWEKNFYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  601

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  TAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  636


 Score =   124 bits (311),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC
Sbjct  637  WETGYRITSTAATNDQAAFILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASIC  696

Query  235  YGRTVC  218
            +GRTVC
Sbjct  697  FGRTVC  702



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score =   166 bits (421),  Expect(3) = 9e-70, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  600

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  601  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  634


 Score =   124 bits (311),  Expect(3) = 9e-70, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 1/66 (2%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASIC
Sbjct  635  WENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASIC  693

Query  235  YGRTVC  218
            YGRTVC
Sbjct  694  YGRTVC  699


 Score = 21.9 bits (45),  Expect(3) = 9e-70, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  534  HKDWIME  540



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score =   163 bits (412),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE ++YIS+IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  539  QWENSYYISAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  598

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  599  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  632


 Score =   128 bits (321),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  633  WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  692

Query  235  YGRTV  221
            YGRTV
Sbjct  693  YGRTV  697


 Score = 21.2 bits (43),  Expect(3) = 1e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  532  HKDWIME  538



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score =   164 bits (415),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRR  635


 Score =   126 bits (317),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASIC
Sbjct  636  WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASIC  695

Query  235  YGRTV  221
            YGRTV
Sbjct  696  YGRTV  700


 Score = 21.2 bits (43),  Expect(3) = 1e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  535  HKDWIME  541



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score =   154 bits (390),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  532  QWEKNYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  591

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  592  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  625


 Score =   135 bits (341),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  626  WESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASIC  685

Query  235  YGRTVC  218
            +GRTVC
Sbjct  686  FGRTVC  691


 Score = 21.6 bits (44),  Expect(3) = 1e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  525  HKDWIME  531



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score =   164 bits (415),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  550  QWEKNFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGT  609

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HR+
Sbjct  610  AGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRR  643


 Score =   126 bits (316),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS A T DQAAFILSIP+RK MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  644  WETGYRITSSAGTPDQAAFILSIPKRKPMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  703

Query  235  YGRTVC  218
            YGRT C
Sbjct  704  YGRTAC  709


 Score = 21.9 bits (45),  Expect(3) = 1e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  543  HKDWIME  549



>ref|XP_004970128.1| PREDICTED: uncharacterized protein LOC101772174 [Setaria italica]
Length=697

 Score =   164 bits (415),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTT
Sbjct  538  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  598  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  631


 Score =   126 bits (317),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  632  WENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASIC  691

Query  235  YGRTV  221
            +GRTV
Sbjct  692  FGRTV  696


 Score = 21.2 bits (43),  Expect(3) = 2e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  531  HKDWIME  537



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   164 bits (414),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HR+
Sbjct  608  AGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRR  641


 Score =   126 bits (316),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS A T DQAAFILSIP+RK +DETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  642  WESGYRITSSAGTPDQAAFILSIPKRKPLDETQETLRTSAFPSNHVKEKWAKNLYIASIC  701

Query  235  YGRTVC  218
            YGRT C
Sbjct  702  YGRTAC  707


 Score = 21.9 bits (45),  Expect(3) = 2e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score =   163 bits (412),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+S+AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTT
Sbjct  552  QWEKNYYITSVAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTT  611

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  612  AGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  645


 Score =   126 bits (316),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAFILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  646  WESGYRITSMAATVDQAAFILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASIC  705

Query  235  YGRTV  221
            YGRTV
Sbjct  706  YGRTV  710


 Score = 21.9 bits (45),  Expect(3) = 3e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  545  HKDWIME  551



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score =   162 bits (409),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  363  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  422

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHR+
Sbjct  423  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRR  456


 Score =   127 bits (320),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASIC
Sbjct  457  WETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASIC  516

Query  235  YGRTVC  218
            YGRTVC
Sbjct  517  YGRTVC  522



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score =   163 bits (413),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+S+AGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTT
Sbjct  509  QWEKNYYITSVAGANNESSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTT  568

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  569  AGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  602


 Score =   126 bits (316),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAFILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASIC
Sbjct  603  WESGYRITSMAATVDQAAFILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASIC  662

Query  235  YGRTV  221
            YGRTV
Sbjct  663  YGRTV  667



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score =   154 bits (390),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  525  QWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  584

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  585  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  618


 Score =   134 bits (337),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  619  WENGYRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASIC  678

Query  235  YGRTVC  218
            YGRTVC
Sbjct  679  YGRTVC  684


 Score = 21.9 bits (45),  Expect(3) = 4e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  518  HKDWIME  524



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score =   164 bits (414),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  554  QWEKNFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  613

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            A SRWGVVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  614  AASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRR  647


 Score =   125 bits (314),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 2/66 (3%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAAT DQAAF+LSIP+RK MDETQETLRTSAFPSTH  EKW+KNLYIASIC
Sbjct  648  WESGYRITSMAATPDQAAFVLSIPKRKTMDETQETLRTSAFPSTH--EKWAKNLYIASIC  705

Query  235  YGRTVC  218
            YGRTVC
Sbjct  706  YGRTVC  711


 Score = 21.6 bits (44),  Expect(3) = 4e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  547  HKDWIME  553



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score =   154 bits (390),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  517  QWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  576

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  577  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  610


 Score =   134 bits (336),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  611  WENGYRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASIC  670

Query  235  YGRTVC  218
            YGRTVC
Sbjct  671  YGRTVC  676


 Score = 21.9 bits (45),  Expect(3) = 5e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  510  HKDWIME  516



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score =   154 bits (390),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  525  QWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  584

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  585  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRR  618


 Score =   134 bits (336),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  619  WENGYRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASIC  678

Query  235  YGRTVC  218
            YGRTVC
Sbjct  679  YGRTVC  684


 Score = 21.9 bits (45),  Expect(3) = 5e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  518  HKDWIME  524



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score =   160 bits (404),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYS QVVELDFLYPSEGIHR+
Sbjct  608  AGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRR  641


 Score =   127 bits (319),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  642  WETGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASIC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707


 Score = 22.3 bits (46),  Expect(3) = 7e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  541  HKDWIME  547



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score =   160 bits (404),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  573  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  632

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYS QVVELDFLYPSEGIHR+
Sbjct  633  AGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRR  666


 Score =   127 bits (319),  Expect(3) = 7e-69, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  667  WETGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASIC  726

Query  235  YGRTVC  218
            YGRTVC
Sbjct  727  YGRTVC  732


 Score = 22.3 bits (46),  Expect(3) = 7e-69, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  566  HKDWIME  572



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score =   166 bits (419),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEK+FYI++IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  542  DQWEKSFYITAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  601

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  602  TAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  636


 Score =   122 bits (306),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE GYRITS AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC
Sbjct  637  WEQGYRITSSAATIDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASIC  696

Query  235  YGRTVC  218
            YGRTVC
Sbjct  697  YGRTVC  702



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score =   158 bits (399),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHR+
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRR  638


 Score =   129 bits (323),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC
Sbjct  639  WESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASIC  698

Query  235  YGRTVC  218
            YGRTVC
Sbjct  699  YGRTVC  704


 Score = 21.9 bits (45),  Expect(3) = 1e-68, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score =   158 bits (399),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHR+
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRR  638


 Score =   129 bits (323),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC
Sbjct  639  WESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASIC  698

Query  235  YGRTVC  218
            YGRTVC
Sbjct  699  YGRTVC  704


 Score = 21.9 bits (45),  Expect(3) = 1e-68, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score =   158 bits (399),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEK++YI++IAG++NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSSNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHR+
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRR  638


 Score =   127 bits (319),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC
Sbjct  639  WESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASIC  698

Query  235  YGRTVC  218
            +GRTVC
Sbjct  699  FGRTVC  704


 Score = 21.9 bits (45),  Expect(3) = 3e-68, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score =   158 bits (399),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEK++YI++IAG++NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSSNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHR+
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRR  638


 Score =   127 bits (320),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC
Sbjct  639  WESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASIC  698

Query  235  YGRTVC  218
            +GRTVC
Sbjct  699  FGRTVC  704


 Score = 21.9 bits (45),  Expect(3) = 3e-68, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  538  HKDWIME  544



>ref|XP_002466312.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
 gb|EER93310.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
Length=707

 Score =   160 bits (405),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI++IAGA NGSSL+VMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLIVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGV++SRNAGYS QVVELDFLYPSEGIHR+
Sbjct  608  AGNRWGVIVSRNAGYSTQVVELDFLYPSEGIHRR  641


 Score =   125 bits (313),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS+AAT DQAAFILSIP+RK MDETQE LRTSAFPS+HVKEKW KNLYI+S+C
Sbjct  642  WETGYRITSIAATPDQAAFILSIPKRKPMDETQEILRTSAFPSSHVKEKWVKNLYISSVC  701

Query  235  YGRTVC  218
            YGRTVC
Sbjct  702  YGRTVC  707



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score =   151 bits (382),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  603  QWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  662

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  663  AGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRR  696


 Score =   133 bits (335),  Expect(2) = 7e-68, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  697  WESGYRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASIC  756

Query  235  YGRTVC  218
            YGRTVC
Sbjct  757  YGRTVC  762



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score =   158 bits (399),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  547  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GY+ QVVELDFLYPSEGIH +
Sbjct  607  AGNRWGVVMSRNSGYATQVVELDFLYPSEGIHHR  640


 Score =   126 bits (317),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTSAFPS HVKEKW KNLYI+SIC
Sbjct  641  WETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSAFPSNHVKEKWVKNLYISSIC  700

Query  235  YGRTVC  218
            YGRTVC
Sbjct  701  YGRTVC  706



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score =   151 bits (382),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  527  QWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  586

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  587  AGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRR  620


 Score =   132 bits (333),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  621  WESGYRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASIC  680

Query  235  YGRTVC  218
            YGRTVC
Sbjct  681  YGRTVC  686



>gb|EMS51431.1| Casein kinase I isoform beta [Triticum urartu]
Length=695

 Score =   164 bits (416),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEK+FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  535  DQWEKSFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  594

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RWGVVMSRN+GYSEQ+VELDFLYPSEGIHR+
Sbjct  595  TAGNRWGVVMSRNSGYSEQIVELDFLYPSEGIHRR  629


 Score =   119 bits (299),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE GYRITS AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC
Sbjct  630  WEHGYRITSSAATGDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASIC  689

Query  235  YGRTV  221
            YGRTV
Sbjct  690  YGRTV  694



>ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
 gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score =   157 bits (398),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NG SLVVMSKGTPY+QQSYKVS+SFPFKWINKKW+EGF+VTSMTT
Sbjct  546  QWEKNYYISSIAGANNGGSLVVMSKGTPYSQQSYKVSDSFPFKWINKKWREGFYVTSMTT  605

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +G+RWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  606  SGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  639


 Score =   125 bits (315),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+G+RITS AAT DQAAFILS+P+RKM DETQETLRTSAFPSTHVKEKWSKNLYIAS+C
Sbjct  640  WENGFRITSTAATVDQAAFILSVPKRKMSDETQETLRTSAFPSTHVKEKWSKNLYIASVC  699

Query  235  YGRTV  221
            YGRTV
Sbjct  700  YGRTV  704


 Score = 21.6 bits (44),  Expect(3) = 2e-67, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  539  HKDWIME  545



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score =   151 bits (382),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  525  QWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  584

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHR+
Sbjct  585  AGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRR  618


 Score =   131 bits (330),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASIC
Sbjct  619  WENGYRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASIC  678

Query  235  YGRTVC  218
            YGRTVC
Sbjct  679  YGRTVC  684



>ref|XP_010552201.1| PREDICTED: serine/threonine-protein kinase ste20-like [Tarenaya 
hassleriana]
Length=702

 Score =   161 bits (407),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKWKEGFHVTSM T
Sbjct  543  QWEKNYYISSIAGSNNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWKEGFHVTSMAT  602

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHR+
Sbjct  603  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRR  636


 Score =   120 bits (302),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W SGYRITS AATADQ A +LSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+ASIC
Sbjct  637  WNSGYRITSTAATADQTALVLSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASIC  696

Query  235  YGRTV  221
            YGRTV
Sbjct  697  YGRTV  701



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score =   161 bits (407),  Expect(3) = 7e-67, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWI+KKWKEGFHVTSMT+
Sbjct  527  QWEKNYYISCIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWISKKWKEGFHVTSMTS  586

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVE+DF+YPSEGIHR+
Sbjct  587  AGSRWGVVMSRNSGYSEQVVEVDFVYPSEGIHRR  620


 Score =   120 bits (300),  Expect(3) = 7e-67, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRK-MMDETQETLRTSAFPSTHVKEKWSKNLYIASI  239
            WESGYRITSMAAT DQ+AF+LSIPRRK MMDE QETLRTSAFPS+HVK KWS+NLYIAS+
Sbjct  621  WESGYRITSMAATTDQSAFVLSIPRRKLMMDEAQETLRTSAFPSSHVKAKWSRNLYIASM  680

Query  238  CYGRTVC  218
            C+G TVC
Sbjct  681  CHGPTVC  687


 Score = 21.6 bits (44),  Expect(3) = 7e-67, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  520  HKDWIME  526



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score =   153 bits (387),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWE+N+YI++IAGA NGSSLVVMSK T YTQQSYKVSESFP+KWINKKWKEGFHVTSM 
Sbjct  566  DQWEQNYYITAIAGANNGSSLVVMSKETSYTQQSYKVSESFPYKWINKKWKEGFHVTSMA  625

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RWGVVMSRN GYS QVVELDFLYPSEGIHR+
Sbjct  626  TAGNRWGVVMSRNTGYSHQVVELDFLYPSEGIHRR  660


 Score =   126 bits (317),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFIL++P+RK +DETQETLRTS+FPSTHVKEKWSKNLYIASIC
Sbjct  661  WETGYRITSTAATPDQAAFILTMPKRKPVDETQETLRTSSFPSTHVKEKWSKNLYIASIC  720

Query  235  YGRTVC  218
            YGRTVC
Sbjct  721  YGRTVC  726



>ref|XP_010936995.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X1 [Elaeis 
guineensis]
Length=601

 Score =   162 bits (411),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  442  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  501

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  502  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  535


 Score =   116 bits (291),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITSMAAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+C
Sbjct  536  WDNGYRITSMAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVC  595

Query  235  YGRTV  221
            YGRTV
Sbjct  596  YGRTV  600



>ref|XP_010936996.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   162 bits (411),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  441  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  500

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  501  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  534


 Score =   116 bits (291),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITSMAAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+C
Sbjct  535  WDNGYRITSMAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVC  594

Query  235  YGRTV  221
            YGRTV
Sbjct  595  YGRTV  599



>ref|XP_010534909.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   160 bits (405),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHR+
Sbjct  604  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRR  637


 Score =   118 bits (296),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+C
Sbjct  638  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLC  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>ref|XP_010542444.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   159 bits (401),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIH++
Sbjct  604  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHKR  637


 Score =   119 bits (299),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SG+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+C
Sbjct  638  WDSGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLC  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>gb|EMT21659.1| Casein kinase I-RAG8-like protein [Aegilops tauschii]
Length=640

 Score =   158 bits (400),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEK+FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  480  DQWEKSFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  539

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIH  423
            TAG+RWGVVMSRN+GYS Q+VELDFLYPSEGIH
Sbjct  540  TAGNRWGVVMSRNSGYSGQIVELDFLYPSEGIH  572


 Score =   119 bits (299),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE GYRITS AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC
Sbjct  575  WEHGYRITSSAATGDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASIC  634

Query  235  YGRTV  221
            YGRTV
Sbjct  635  YGRTV  639



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score =   154 bits (388),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NG SLVVMS+GT Y+QQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  568  QWEKNYYISAIAGATNGFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVTSMAT  627

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  628  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRR  661


 Score =   124 bits (310),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAF+LS+PRRK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  662  WDCGYRITATAATWDQAAFVLSVPRRKPMDETQETLRTSAFPSTHVKEKWAKNLYIASVC  721

Query  235  YGRTV  221
            YGRTV
Sbjct  722  YGRTV  726



>ref|XP_009382978.1| PREDICTED: uncharacterized protein LOC103970784 [Musa acuminata 
subsp. malaccensis]
Length=721

 Score =   160 bits (405),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  562  QWEKNYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  621

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  622  AGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  655


 Score =   116 bits (291),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITSM AT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASIC
Sbjct  656  WDSGYRITSMGATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASIC  715

Query  235  YGRTV  221
            YGRTV
Sbjct  716  YGRTV  720



>ref|XP_008797939.1| PREDICTED: uncharacterized protein LOC103712966 isoform X4 [Phoenix 
dactylifera]
Length=727

 Score =   163 bits (413),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  568  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  627

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  628  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  661


 Score =   113 bits (283),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++C
Sbjct  662  WDNGYRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVC  721

Query  235  YGRTV  221
            YGRTV
Sbjct  722  YGRTV  726



>ref|XP_008797915.1| PREDICTED: uncharacterized protein LOC103712966 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   163 bits (413),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  573  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  632

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  633  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  666


 Score =   113 bits (283),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++C
Sbjct  667  WDNGYRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVC  726

Query  235  YGRTV  221
            YGRTV
Sbjct  727  YGRTV  731



>ref|XP_008797922.1| PREDICTED: uncharacterized protein LOC103712966 isoform X2 [Phoenix 
dactylifera]
Length=731

 Score =   163 bits (413),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  572  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  631

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  632  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  665


 Score =   113 bits (283),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++C
Sbjct  666  WDNGYRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVC  725

Query  235  YGRTV  221
            YGRTV
Sbjct  726  YGRTV  730



>ref|XP_008797930.1| PREDICTED: uncharacterized protein LOC103712966 isoform X3 [Phoenix 
dactylifera]
Length=728

 Score =   163 bits (413),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  569  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  628

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  629  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  662


 Score =   113 bits (283),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++C
Sbjct  663  WDNGYRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVC  722

Query  235  YGRTV  221
            YGRTV
Sbjct  723  YGRTV  727



>ref|XP_006407187.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
 gb|ESQ48640.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
Length=703

 Score =   161 bits (407),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKEGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWKEGFHVTSMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  604  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  637


 Score =   114 bits (286),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  638  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>ref|XP_001764211.1| predicted protein [Physcomitrella patens]
 gb|EDQ71052.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   157 bits (398),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  444  QWEKNFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  503

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  504  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  537


 Score =   118 bits (295),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ 
Sbjct  538  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVS  597

Query  235  YGRTV  221
            YGRTV
Sbjct  598  YGRTV  602



>ref|XP_001770883.1| predicted protein [Physcomitrella patens]
 gb|EDQ64213.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   157 bits (397),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  444  QWEKNFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  503

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  504  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  537


 Score =   118 bits (295),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ 
Sbjct  538  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVS  597

Query  235  YGRTV  221
            YGRTV
Sbjct  598  YGRTV  602



>ref|XP_009413490.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413491.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   161 bits (408),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEKN+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  557  DQWEKNYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  616

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  617  TAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  651


 Score =   114 bits (285),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT M AT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASIC
Sbjct  652  WDNGYRITCMGATWDQAALILSVPKRKPCDETQETLRTSAFPSAHVKDKWAKNLYLASIC  711

Query  235  YGRTV  221
            YGRTV
Sbjct  712  YGRTV  716



>ref|XP_006445886.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 ref|XP_006492686.1| PREDICTED: uncharacterized protein LOC102618306 [Citrus sinensis]
 gb|ESR59126.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 gb|KDO62936.1| hypothetical protein CISIN_1g048600mg [Citrus sinensis]
Length=707

 Score =   160 bits (404),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  548  QWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+SEQVVELDFLYPSEGIHR+
Sbjct  608  AGSRWGVVMSRNAGFSEQVVELDFLYPSEGIHRR  641


 Score =   115 bits (288),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  642  WDGGYRITSTAATCDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  701

Query  235  YGRTV  221
            YGRTV
Sbjct  702  YGRTV  706



>gb|KHN27094.1| Casein kinase I [Glycine soja]
Length=657

 Score =   158 bits (399),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  498  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  557

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH++
Sbjct  558  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKR  591


 Score =   117 bits (293),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +C
Sbjct  592  WDKGYRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLC  651

Query  235  YGRTVC  218
            YGRTVC
Sbjct  652  YGRTVC  657



>gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score =   155 bits (393),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YI+S+AG ANGS+LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF VTSMTT
Sbjct  505  QWDKNYYITSVAGTANGSALVVMSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSMTT  564

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS+WG+VMSRNAGY  QVVELDFLYPSEGIHR+
Sbjct  565  AGSKWGIVMSRNAGYPNQVVELDFLYPSEGIHRR  598


 Score =   119 bits (299),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AATADQAAFILS P+RK  D  QETLRTSAFPSTHVK+KWSKNLYIASIC
Sbjct  599  WESGYRITSTAATADQAAFILSAPKRKSSDVAQETLRTSAFPSTHVKDKWSKNLYIASIC  658

Query  235  YGRTV  221
            YGRTV
Sbjct  659  YGRTV  663



>ref|XP_003536792.1| PREDICTED: uncharacterized protein LOC100783819 [Glycine max]
Length=672

 Score =   158 bits (399),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  513  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  572

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH++
Sbjct  573  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKR  606


 Score =   117 bits (293),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +C
Sbjct  607  WDKGYRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLC  666

Query  235  YGRTVC  218
            YGRTVC
Sbjct  667  YGRTVC  672



>ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score =   157 bits (397),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE+N+YIS+I GA NGSSLVVMSKGT YTQQSYKVS++FPFKWINKKW+EGFHVTSM T
Sbjct  548  QWERNYYISAIGGANNGSSLVVMSKGTQYTQQSYKVSDTFPFKWINKKWREGFHVTSMAT  607

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  608  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  641


 Score =   118 bits (295),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAA ILS+P+RK  DETQETLRTSAFPS+HVKEKWSKNLY+ASIC
Sbjct  642  WDSGYRITATAATFDQAALILSVPKRKPGDETQETLRTSAFPSSHVKEKWSKNLYLASIC  701

Query  235  YGRTV  221
            YGRTV
Sbjct  702  YGRTV  706



>ref|XP_003556554.1| PREDICTED: uncharacterized protein LOC100807373 [Glycine max]
Length=669

 Score =   157 bits (398),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  510  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  569

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH++
Sbjct  570  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKR  603


 Score =   117 bits (293),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +C
Sbjct  604  WDKGYRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLC  663

Query  235  YGRTVC  218
            YGRTVC
Sbjct  664  YGRTVC  669



>ref|XP_009404157.1| PREDICTED: uncharacterized protein LOC103987553 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   160 bits (406),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEKN+YI+S+AGA NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  565  DQWEKNYYITSLAGANNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  624

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  625  TAGTRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  659


 Score =   114 bits (286),  Expect(2) = 7e-65, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRITSMAAT DQAA ILS+P+RK  DETQETLRTS+FPS HVK+KW+KNLY+ASIC
Sbjct  660  WDGGYRITSMAATWDQAALILSVPKRKPGDETQETLRTSSFPSAHVKDKWAKNLYLASIC  719

Query  235  YGRTV  221
            YGRTV
Sbjct  720  YGRTV  724



>ref|XP_008787870.1| PREDICTED: uncharacterized protein LOC103705792 [Phoenix dactylifera]
Length=730

 Score =   162 bits (410),  Expect(3) = 7e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  571  QWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  630

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  631  SGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  664


 Score =   112 bits (279),  Expect(3) = 7e-65, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++C
Sbjct  665  WDNGYRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVC  724

Query  235  YGRTV  221
            YGRTV
Sbjct  725  YGRTV  729


 Score = 21.9 bits (45),  Expect(3) = 7e-65, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  564  HKDWIME  570



>ref|XP_006297084.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
 gb|EOA29982.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
Length=704

 Score =   160 bits (405),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  545  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  605  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  638


 Score =   114 bits (286),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  639  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  698

Query  235  YGRTV  221
            YGRTV
Sbjct  699  YGRTV  703



>ref|XP_002882838.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59097.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   160 bits (405),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  604  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  637


 Score =   114 bits (286),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  638  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>gb|KFK38714.1| hypothetical protein AALP_AA3G150500 [Arabis alpina]
Length=700

 Score =   160 bits (405),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  600

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  601  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  634


 Score =   114 bits (286),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  635  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  694

Query  235  YGRTV  221
            YGRTV
Sbjct  695  YGRTV  699



>ref|XP_010465212.1| PREDICTED: uncharacterized protein LOC104745616 [Camelina sativa]
Length=714

 Score =   160 bits (405),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  555  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  614

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  648


 Score =   114 bits (286),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  649  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  708

Query  235  YGRTV  221
            YGRTV
Sbjct  709  YGRTV  713



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score =   159 bits (402),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  549  QWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  608

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  609  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  642


 Score =   115 bits (288),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +C
Sbjct  643  WDNGYRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLC  702

Query  235  YGRTVC  218
            YGRTVC
Sbjct  703  YGRTVC  708



>ref|XP_010500960.1| PREDICTED: uncharacterized protein LOC104778257 isoform X1 [Camelina 
sativa]
Length=711

 Score =   160 bits (405),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  552  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  611

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  612  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  645


 Score =   114 bits (286),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  646  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  705

Query  235  YGRTV  221
            YGRTV
Sbjct  706  YGRTV  710



>emb|CDY51730.1| BnaA01g37130D [Brassica napus]
Length=684

 Score =   160 bits (405),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  525  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  584

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HR+
Sbjct  585  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRR  618


 Score =   114 bits (285),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  619  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  678

Query  235  YGRTV  221
            YGRTV
Sbjct  679  YGRTV  683



>gb|KHN37292.1| Casein kinase I [Glycine soja]
Length=590

 Score =   157 bits (398),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  431  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  490

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH++
Sbjct  491  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKR  524


 Score =   117 bits (292),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +C
Sbjct  525  WDKGYRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLC  584

Query  235  YGRTVC  218
            YGRTVC
Sbjct  585  YGRTVC  590



>ref|XP_010487127.1| PREDICTED: serine/threonine-protein kinase STE20-like [Camelina 
sativa]
Length=717

 Score =   160 bits (404),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  558  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  617

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  618  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  651


 Score =   114 bits (286),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  652  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  711

Query  235  YGRTV  221
            YGRTV
Sbjct  712  YGRTV  716



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score =   159 bits (401),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  513  QWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  572

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  573  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  606


 Score =   115 bits (288),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +C
Sbjct  607  WDNGYRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLC  666

Query  235  YGRTVC  218
            YGRTVC
Sbjct  667  YGRTVC  672



>ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
 gb|EFJ31718.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
Length=596

 Score =   159 bits (401),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  437  QWEKNFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  496

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  497  AGTRWGVVMSRNAGFTDQVVELDFLYPSEGIHRR  530


 Score =   115 bits (288),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ 
Sbjct  531  WDCGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVS  590

Query  235  YGRTV  221
            YGRTV
Sbjct  591  YGRTV  595



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score =   159 bits (401),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  513  QWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  572

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  573  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  606


 Score =   115 bits (288),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +C
Sbjct  607  WDNGYRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLC  666

Query  235  YGRTVC  218
            YGRTVC
Sbjct  667  YGRTVC  672



>ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
 gb|EFJ38433.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
Length=596

 Score =   159 bits (401),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  437  QWEKNFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  496

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  497  AGTRWGVVMSRNAGFTDQVVELDFLYPSEGIHRR  530


 Score =   115 bits (288),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ 
Sbjct  531  WDCGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVS  590

Query  235  YGRTV  221
            YGRTV
Sbjct  591  YGRTV  595



>emb|CDY55141.1| BnaC01g44810D [Brassica napus]
Length=632

 Score =   160 bits (404),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  473  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  532

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HR+
Sbjct  533  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRR  566


 Score =   114 bits (285),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  567  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  626

Query  235  YGRTV  221
            YGRTV
Sbjct  627  YGRTV  631



>emb|CDX75726.1| BnaC03g38090D [Brassica napus]
Length=652

 Score =   159 bits (403),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  493  QWEKNYYISSIAGATNGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  552

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  553  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  586


 Score =   114 bits (285),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  587  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  646

Query  235  YGRTV  221
            YGRTV
Sbjct  647  YGRTV  651



>emb|CDP13154.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   151 bits (382),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QW+KN+YIS +AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGFHVTSM 
Sbjct  441  DQWDKNYYISCLAGATNGSSLVVMSKGTMYNQQSYKVSDSFPFKWINKKWKEGFHVTSMA  500

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RW VVMSRN+G+S+QVVELDFLYPSEGIH++
Sbjct  501  TAGTRWAVVMSRNSGFSDQVVELDFLYPSEGIHKR  535


 Score =   122 bits (306),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAA ILS+PRRK++DETQETLRTS FPSTHVKEKW+KNLY+AS+C
Sbjct  536  WDSGYRITATAATWDQAALILSVPRRKLLDETQETLRTSQFPSTHVKEKWAKNLYLASLC  595

Query  235  YGRTVC  218
            YGRTVC
Sbjct  596  YGRTVC  601



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score =   154 bits (388),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  560  QWEKNYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMAT  619

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  620  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRR  653


 Score =   120 bits (300),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  654  WDSGYRITATAATWDQAAFVLSVPRRRPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  713

Query  235  YGRTV  221
            YGRTV
Sbjct  714  YGRTV  718



>ref|NP_187977.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01914.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AAL85021.1| putative casein kinase [Arabidopsis thaliana]
 gb|AAM51279.1| putative casein kinase [Arabidopsis thaliana]
 gb|AEE75390.1| protein kinase family protein [Arabidopsis thaliana]
Length=703

 Score =   159 bits (402),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA+NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGASNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  604  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  637


 Score =   114 bits (286),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  638  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>ref|XP_010939945.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939946.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
Length=729

 Score =   162 bits (409),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  570  QWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  629

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  630  SGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  663


 Score =   111 bits (278),  Expect(3) = 2e-64, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++C
Sbjct  664  WDNGYRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVC  723

Query  235  YGRTV  221
            YGRTV
Sbjct  724  YGRTV  728


 Score = 21.6 bits (44),  Expect(3) = 2e-64, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  563  HKDWIME  569



>ref|XP_009146466.1| PREDICTED: uncharacterized protein LOC103870106 [Brassica rapa]
Length=689

 Score =   158 bits (400),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  530  QWEKNYYISSIAGAANGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMAT  589

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HR+
Sbjct  590  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRR  623


 Score =   115 bits (288),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  624  WDGGYRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLS  683

Query  235  YGRTV  221
            YGRTV
Sbjct  684  YGRTV  688



>ref|XP_010939947.1| PREDICTED: uncharacterized protein LOC105058653 isoform X2 [Elaeis 
guineensis]
Length=725

 Score =   161 bits (408),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  566  QWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  625

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  626  SGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  659


 Score =   111 bits (278),  Expect(3) = 2e-64, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++C
Sbjct  660  WDNGYRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVC  719

Query  235  YGRTV  221
            YGRTV
Sbjct  720  YGRTV  724


 Score = 21.6 bits (44),  Expect(3) = 2e-64, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  559  HKDWIME  565



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score =   158 bits (400),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  516  QWEKNFYITSIAGANNGSSLVVMSKGTHYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  575

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GY++QV+ELDFLYPSEGIHR+
Sbjct  576  AGSRWGVVMSRNSGYTDQVIELDFLYPSEGIHRR  609


 Score =   115 bits (288),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +C
Sbjct  610  WDNGYRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLC  669

Query  235  YGRTVC  218
            YGRTVC
Sbjct  670  YGRTVC  675



>ref|XP_010257513.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257516.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257517.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
Length=726

 Score =   159 bits (401),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  567  QWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  626

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  627  AGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRR  660


 Score =   115 bits (287),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+AS+C
Sbjct  661  WDSGYRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLASLC  720

Query  235  YGRTV  221
            YGRTV
Sbjct  721  YGRTV  725



>ref|XP_004162011.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213194 
[Cucumis sativus]
Length=694

 Score =   159 bits (402),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  535  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  594

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  595  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  628


 Score =   114 bits (285),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  629  WDNGYRITSTAATWDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  688

Query  235  YGRTVC  218
            YGRTV 
Sbjct  689  YGRTVA  694



>ref|XP_004142151.1| PREDICTED: uncharacterized protein LOC101213194 [Cucumis sativus]
 ref|XP_008449783.1| PREDICTED: uncharacterized protein LOC103491568 [Cucumis melo]
 gb|KGN54092.1| hypothetical protein Csa_4G285680 [Cucumis sativus]
Length=694

 Score =   159 bits (402),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  535  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  594

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  595  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  628


 Score =   114 bits (285),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  629  WDNGYRITSTAATWDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  688

Query  235  YGRTVC  218
            YGRTV 
Sbjct  689  YGRTVA  694



>emb|CDX97505.1| BnaA05g25740D [Brassica napus]
Length=653

 Score =   158 bits (400),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  494  QWEKNYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMAT  553

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HR+
Sbjct  554  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRR  587


 Score =   115 bits (287),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  588  WDGGYRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLS  647

Query  235  YGRTV  221
            YGRTV
Sbjct  648  YGRTV  652



>gb|KDP44321.1| hypothetical protein JCGZ_19188 [Jatropha curcas]
Length=710

 Score =   159 bits (401),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  551  QWEKNYYISSIAGSNNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  610

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  611  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  644


 Score =   114 bits (285),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  645  WDNGFRITSTAATLDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  704

Query  235  YGRTV  221
            YGRTV
Sbjct  705  YGRTV  709



>ref|XP_010500967.1| PREDICTED: uncharacterized protein LOC104778257 isoform X2 [Camelina 
sativa]
Length=390

 Score =   159 bits (403),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  231  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  290

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  291  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  324


 Score =   113 bits (283),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  325  WDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  384

Query  235  YGRTV  221
            YGRTV
Sbjct  385  YGRTV  389



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score =   154 bits (388),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  560  QWEKNYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMAT  619

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  620  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRR  653


 Score =   119 bits (298),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  654  WDNGYRITATAATWDQAAFVLSVPRRRPTDETQETLRTSAFPSTHVKEKWAKNLYIASVC  713

Query  235  YGRTV  221
            YGRTV
Sbjct  714  YGRTV  718



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score =   152 bits (384),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M T
Sbjct  524  QWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMAT  583

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  584  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRR  617


 Score =   120 bits (302),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLYIASIC
Sbjct  618  WDSGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSQHVKEKWSKNLYIASIC  677

Query  235  YGRTV  221
            YGRTV
Sbjct  678  YGRTV  682



>ref|XP_009117581.1| PREDICTED: uncharacterized protein LOC103842673 [Brassica rapa]
Length=683

 Score =   160 bits (405),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  524  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  583

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HR+
Sbjct  584  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRR  617


 Score =   112 bits (281),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILSIPRR+++D+TQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  618  WDGGFRITSTAATTDQAALILSIPRRRLVDKTQETLRTSQFPSTHVKEKWGKNLYLASLS  677

Query  235  YGRTV  221
            YGRTV
Sbjct  678  YGRTV  682



>ref|XP_009395055.1| PREDICTED: uncharacterized protein LOC103980386 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   154 bits (388),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  525  QWEKNYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMAT  584

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RW VVMSRNAG+ EQVVELDFLYPSEGIHR+
Sbjct  585  AGNRWAVVMSRNAGFLEQVVELDFLYPSEGIHRR  618


 Score =   119 bits (298),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPS HVKEKW+KNLY+AS+C
Sbjct  619  WDSGYRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSQHVKEKWAKNLYLASVC  678

Query  235  YGRTV  221
            YGRTV
Sbjct  679  YGRTV  683



>ref|XP_009395056.1| PREDICTED: uncharacterized protein LOC103980386 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   154 bits (388),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  521  QWEKNYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMAT  580

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RW VVMSRNAG+ EQVVELDFLYPSEGIHR+
Sbjct  581  AGNRWAVVMSRNAGFLEQVVELDFLYPSEGIHRR  614


 Score =   119 bits (298),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPS HVKEKW+KNLY+AS+C
Sbjct  615  WDSGYRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSQHVKEKWAKNLYLASVC  674

Query  235  YGRTV  221
            YGRTV
Sbjct  675  YGRTV  679



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   153 bits (387),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QW+KN+YI+++AGA N SSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M 
Sbjct  525  DQWDKNYYITALAGANNVSSLVVMSKGTQYVQQSYKVSESFPFKWINKKWREGFYVTAMA  584

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  585  TAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  619


 Score =   119 bits (298),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKW+KNLYIAS+C
Sbjct  620  WDGGYRITATAATMDQAAFVLSVPRRKPTDETQETLRTSAFPSQHVKEKWAKNLYIASVC  679

Query  235  YGRTV  221
            YGRTV
Sbjct  680  YGRTV  684



>gb|KJB21848.1| hypothetical protein B456_004G018000 [Gossypium raimondii]
Length=704

 Score =   159 bits (402),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEKN+YISSIAG+ +G+SLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSMT
Sbjct  544  DQWEKNYYISSIAGSNSGNSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMT  603

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  604  TAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  638


 Score =   114 bits (284),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAA ILSIP+RK  DETQETLRTS FPS HVKEKW+KNLY+A +C
Sbjct  639  WDSGYRITSTAATLDQAALILSIPKRKPGDETQETLRTSQFPSIHVKEKWAKNLYLACLC  698

Query  235  YGRTV  221
            YGRTV
Sbjct  699  YGRTV  703



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score =   151 bits (382),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M T
Sbjct  518  QWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMAT  577

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+SEQVVELDFLYPSEGIHR+
Sbjct  578  AGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRR  611


 Score =   121 bits (304),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASIC
Sbjct  612  WDNGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASIC  671

Query  235  YGRTV  221
            YGRTV
Sbjct  672  YGRTV  676



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score =   152 bits (385),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  545  QWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  604

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSR AG+SEQVVELDFLYPSEGIHR+
Sbjct  605  SGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRR  638


 Score =   120 bits (300),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  639  WDNGFRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVC  698

Query  235  YGRTV  221
            YGRTV
Sbjct  699  YGRTV  703



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score =   152 bits (385),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  551  QWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  610

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSR AG+SEQVVELDFLYPSEGIHR+
Sbjct  611  SGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRR  644


 Score =   120 bits (300),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  645  WDNGFRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVC  704

Query  235  YGRTV  221
            YGRTV
Sbjct  705  YGRTV  709



>ref|XP_009135319.1| PREDICTED: uncharacterized protein LOC103859531 [Brassica rapa]
Length=676

 Score =   160 bits (404),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  517  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  576

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  577  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  610


 Score =   112 bits (281),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQ A ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  611  WDGGFRITSTAATTDQTALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  670

Query  235  YGRTV  221
            YGRTV
Sbjct  671  YGRTV  675



>gb|ADE77861.1| unknown [Picea sitchensis]
Length=186

 Score =   153 bits (386),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM +
Sbjct  27   QWEKNYYISAIAGANNGSSLVVMSKGTNYTQQSYKVSDSFPFKWINKKWREGFYVTSMAS  86

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  87   AGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRR  120


 Score =   119 bits (299),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  121  WDHGYRITATAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYIASVC  180

Query  235  YGRTV  221
            YGRTV
Sbjct  181  YGRTV  185



>emb|CDX82524.1| BnaA03g32970D [Brassica napus]
Length=654

 Score =   160 bits (404),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  495  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  554

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHR+
Sbjct  555  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRR  588


 Score =   112 bits (281),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQ A ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  589  WDGGFRITSTAATTDQTALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLS  648

Query  235  YGRTV  221
            YGRTV
Sbjct  649  YGRTV  653



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score =   157 bits (397),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KNFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTT
Sbjct  541  QWDKNFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTT  600

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRNAG+S QVVELDFLYPSEGIHR+
Sbjct  601  AGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRR  634


 Score =   115 bits (288),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AATADQAAFILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASIC
Sbjct  635  WESGYRITSTAATADQAAFILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASIC  694

Query  235  YGRTV  221
            YGRTV
Sbjct  695  YGRTV  699



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   150 bits (380),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  534  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  593

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW VVMSR+AG+S+QVVELDFLYPSEGIHR+
Sbjct  594  AGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRR  627


 Score =   121 bits (304),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  628  WDSGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  687

Query  235  YGRTV  221
            YGRTV
Sbjct  688  YGRTV  692



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   152 bits (384),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  534  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  593

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHR+
Sbjct  594  AGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRR  627


 Score =   120 bits (300),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+C
Sbjct  628  WDSGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVC  687

Query  235  YGRTV  221
            YGRTV
Sbjct  688  YGRTV  692



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   157 bits (396),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KNFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTT
Sbjct  470  QWDKNFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTT  529

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWG+VMSRNAG+S QVVELDFLYPSEGIHR+
Sbjct  530  AGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRR  563


 Score =   115 bits (288),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AATADQAAFILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASIC
Sbjct  564  WESGYRITSTAATADQAAFILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASIC  623

Query  235  YGRTV  221
            YGRTV
Sbjct  624  YGRTV  628



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   152 bits (384),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHR+
Sbjct  598  AGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRR  631


 Score =   120 bits (300),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+C
Sbjct  632  WDSGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVC  691

Query  235  YGRTV  221
            YGRTV
Sbjct  692  YGRTV  696



>ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera]
Length=714

 Score =   159 bits (402),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  555  QWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  614

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  615  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  648


 Score =   113 bits (282),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  649  WDSGYRITSTAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVC  708

Query  235  YGRTV  221
            YGRTV
Sbjct  709  YGRTV  713



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   150 bits (380),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW VVMSR+AG+S+QVVELDFLYPSEGIHR+
Sbjct  598  AGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRR  631


 Score =   121 bits (304),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  632  WDSGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  691

Query  235  YGRTV  221
            YGRTV
Sbjct  692  YGRTV  696



>ref|XP_008228435.1| PREDICTED: uncharacterized protein LOC103327845 [Prunus mume]
Length=706

 Score =   151 bits (381),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTP+TQQSYKVS++FPFKWINKKW+EGF+VT+M T
Sbjct  547  QWENNYYISAIAGATNGSSLVVMSKGTPFTQQSYKVSDTFPFKWINKKWREGFYVTAMAT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRW VVMSR AGYSEQVVELDFLYPSEGIHR+
Sbjct  607  SGSRWAVVMSRGAGYSEQVVELDFLYPSEGIHRR  640


 Score =   121 bits (303),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  641  WDSGYRITATAATWDQAAFVLSVPRRKPQDETQETLRTSAFPSTHVKEKWAKNLYIASMC  700

Query  235  YGRTV  221
            YGRTV
Sbjct  701  YGRTV  705



>ref|XP_002531638.1| casein kinase, putative [Ricinus communis]
 gb|EEF30734.1| casein kinase, putative [Ricinus communis]
Length=703

 Score =   158 bits (400),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  604  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  637


 Score =   113 bits (283),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  638  WDNGFRITSTAATFDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>emb|CDY23629.1| BnaC05g39650D [Brassica napus]
Length=525

 Score =   157 bits (398),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  366  QWEKNYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMAT  425

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HR+
Sbjct  426  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRR  459


 Score =   114 bits (285),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ 
Sbjct  460  WDGGYRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLS  519

Query  235  YGRTV  221
            YGRTV
Sbjct  520  YGRTV  524



>emb|CAN69523.1| hypothetical protein VITISV_040873 [Vitis vinifera]
Length=670

 Score =   159 bits (402),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  511  QWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  570

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  571  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  604


 Score =   112 bits (281),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  605  WDSGYRITSTAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVC  664

Query  235  YGRTV  221
            YGRTV
Sbjct  665  YGRTV  669



>ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score =   151 bits (382),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF VTSM T
Sbjct  544  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDTFPFKWINKKWREGFFVTSMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  604  AGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRR  637


 Score =   120 bits (300),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PR+K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  638  WDSGYRITATAATWDQAAFVLSVPRKKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score =   149 bits (375),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YIS IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGFHVT+M T
Sbjct  381  QWDKNYYISXIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFHVTAMAT  440

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  441  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  474


 Score =   122 bits (307),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASIC
Sbjct  475  WDNGYRITSTAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASIC  534

Query  235  YGRTV  221
            YGRTV
Sbjct  535  YGRTV  539



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score =   159 bits (401),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+SIAG  NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  440  QWEKNYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  499

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  500  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  533


 Score =   112 bits (281),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQ+A ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +C
Sbjct  534  WDNGYRITATAATWDQSALILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLC  593

Query  235  YGRTVC  218
            YGRTVC
Sbjct  594  YGRTVC  599



>ref|XP_007014774.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY32393.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=891

 Score =   157 bits (396),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEKN+YIS+IAG+++GSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM 
Sbjct  731  DQWEKNYYISAIAGSSSGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMA  790

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  791  TAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  825


 Score =   114 bits (286),  Expect(2) = 8e-64, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  826  WDNGYRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  885

Query  235  YGRTV  221
            YGRTV
Sbjct  886  YGRTV  890



>emb|CBI16476.3| unnamed protein product [Vitis vinifera]
Length=603

 Score =   159 bits (401),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  444  QWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  503

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  504  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  537


 Score =   112 bits (281),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  538  WDSGYRITSTAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVC  597

Query  235  YGRTV  221
            YGRTV
Sbjct  598  YGRTV  602



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score =   149 bits (376),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  512  QWEKNFYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  571

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  572  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  605


 Score =   122 bits (306),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  606  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  665

Query  235  YGRTV  221
            YGRTV
Sbjct  666  YGRTV  670



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score =   158 bits (400),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+SIAG  NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  508  QWEKNYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  567

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  568  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  601


 Score =   112 bits (281),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQ+A ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +C
Sbjct  602  WDNGYRITATAATWDQSALILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLC  661

Query  235  YGRTVC  218
            YGRTVC
Sbjct  662  YGRTVC  667



>gb|KFK32550.1| hypothetical protein AALP_AA6G257400 [Arabis alpina]
Length=673

 Score =   152 bits (385),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKWKEGF+VTSM T
Sbjct  514  QWEKNYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWKEGFYVTSMAT  573

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS+WG+VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  574  AGSKWGIVMSRGAGFSDQVVELDFLYPSEGIHRR  607


 Score =   119 bits (297),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS+AAT DQAA +LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYI+S+C
Sbjct  608  WDNGYRITSVAATCDQAALVLSVPRRKPSDETQETLRTSAFPSTHVKEKWAKNLYISSMC  667

Query  235  YGRTV  221
            YGRTV
Sbjct  668  YGRTV  672



>gb|EMS55588.1| Casein kinase I-like protein 2 [Triticum urartu]
Length=597

 Score =   159 bits (401),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSM T
Sbjct  438  QWEKNFYISSVAGANIGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMAT  497

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRW +VMSRNAG+++QVVELDFLYPSEG+HR+
Sbjct  498  SGSRWAIVMSRNAGFTDQVVELDFLYPSEGVHRR  531


 Score =   112 bits (281),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+MAAT DQ+A ILS+PRR+  DETQETLRTS FPS HVK+KW+KNLY+A IC
Sbjct  532  WDNGYRITAMAATMDQSALILSMPRRRPRDETQETLRTSQFPSAHVKDKWAKNLYLAGIC  591

Query  235  YGRTVC  218
            YGRTV 
Sbjct  592  YGRTVA  597



>ref|XP_010033842.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 ref|XP_010033843.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 gb|KCW53681.1| hypothetical protein EUGRSUZ_J02945 [Eucalyptus grandis]
Length=709

 Score =   149 bits (377),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+I G+ NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VTSM T
Sbjct  550  QWEKNYYISAIGGSTNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWKEGFYVTSMGT  609

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+SEQVVELDFLYPSEGIHR+
Sbjct  610  AGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRR  643


 Score =   121 bits (304),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LSIPRRK  DETQETLRTSAFPSTHVKEKW+KNLY+ASIC
Sbjct  644  WDSGYRITATAATWDQAAFVLSIPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYLASIC  703

Query  235  YGRTV  221
            YGRTV
Sbjct  704  YGRTV  708



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   152 bits (383),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  447  QWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  506

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRWGVVMSR AG+SEQVVELDFLYPSEGIHR+
Sbjct  507  SGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRR  540


 Score =   119 bits (298),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  541  WDNGFRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVC  600

Query  235  YGRTV  221
            YGRTV
Sbjct  601  YGRTV  605



>ref|XP_008791563.1| PREDICTED: uncharacterized protein LOC103708420 [Phoenix dactylifera]
Length=683

 Score =   152 bits (385),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M T
Sbjct  524  QWEKNFYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMAT  583

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG+RW VVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  584  AGTRWAVVMSRNAGFSDQVVELDFLYPSEGIHRR  617


 Score =   119 bits (297),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKW+KNLYIASIC
Sbjct  618  WDGGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSQHVKEKWAKNLYIASIC  677

Query  235  YGRTV  221
            YGRTV
Sbjct  678  YGRTV  682



>gb|ABR25333.1| protein kinase family protein [Oryza sativa Indica Group]
Length=137

 Score =   143 bits (361),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -1

Query  629  SKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD  450
            SKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELD
Sbjct  1    SKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELD  60

Query  449  FLYPSEGIHRQ  417
            FLYPSEGIHR+
Sbjct  61   FLYPSEGIHRR  71


 Score =   127 bits (320),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASIC
Sbjct  72   WETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASIC  131

Query  235  YGRTVC  218
            YGRTVC
Sbjct  132  YGRTVC  137



>ref|XP_010093160.1| Casein kinase I [Morus notabilis]
 gb|EXB53619.1| Casein kinase I [Morus notabilis]
Length=801

 Score =   158 bits (399),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  642  QWEKNYYISSIAGANNGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMAT  701

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  702  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  735


 Score =   112 bits (281),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQ+A ILSIPRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  736  WDSGYRITATAATWDQSALILSIPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  795

Query  235  YGRTV  221
            YGRTV
Sbjct  796  YGRTV  800



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score =   149 bits (376),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M T
Sbjct  524  QWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMAT  583

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S QVVELDFLYPSEGIHR+
Sbjct  584  AGSRWAIVMSRGAGFSXQVVELDFLYPSEGIHRR  617


 Score =   121 bits (304),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASIC
Sbjct  618  WDNGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASIC  677

Query  235  YGRTV  221
            YGRTV
Sbjct  678  YGRTV  682



>ref|XP_011006418.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006419.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006420.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006421.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
Length=691

 Score =   147 bits (372),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  532  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  591

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  592  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  625


 Score =   122 bits (307),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRITS AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  626  WDGGYRITSTAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWAKNLYIASVC  685

Query  235  YGRTV  221
            YGRTV
Sbjct  686  YGRTV  690



>gb|ACO87665.1| protein kinase [Brachypodium sylvaticum]
Length=648

 Score =   157 bits (396),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISS+AG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSM T
Sbjct  489  QWEKNFYISSVAGSNNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMAT  548

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRW +VMSRNAG+++QVVELDFLYPSEGIH++
Sbjct  549  SGSRWAIVMSRNAGFTDQVVELDFLYPSEGIHKR  582


 Score =   113 bits (282),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+MAAT DQ+A ILS+PRR+  DETQETLRTS FPS HVK+KW+KNLY+A IC
Sbjct  583  WDNGYRITAMAATMDQSALILSMPRRRPRDETQETLRTSQFPSAHVKDKWAKNLYLAGIC  642

Query  235  YGRTVC  218
            YGRTV 
Sbjct  643  YGRTVA  648


 Score = 21.6 bits (44),  Expect(3) = 2e-63, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  482  HKDWIME  488



>ref|XP_007208054.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
 gb|EMJ09253.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
Length=701

 Score =   159 bits (402),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  602  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  635


 Score =   111 bits (278),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  636  WDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  695

Query  235  YGRTV  221
            YGRTV
Sbjct  696  YGRTV  700



>ref|XP_008338507.1| PREDICTED: uncharacterized protein LOC103401567 isoform X2 [Malus 
domestica]
Length=699

 Score =   159 bits (402),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  540  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  599

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  600  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  633


 Score =   111 bits (278),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  634  WDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  693

Query  235  YGRTV  221
            YGRTV
Sbjct  694  YGRTV  698



>ref|XP_008445007.1| PREDICTED: uncharacterized protein LOC103488176 [Cucumis melo]
Length=699

 Score =   146 bits (368),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  540  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  599

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG RW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  600  AGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  633


 Score =   124 bits (311),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  634  WDSGYRITSTAATLDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASIC  693

Query  235  YGRTV  221
            YGRTV
Sbjct  694  YGRTV  698



>ref|XP_009375296.1| PREDICTED: uncharacterized protein LOC103964127 [Pyrus x bretschneideri]
Length=697

 Score =   159 bits (402),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  538  QWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  598  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  631


 Score =   111 bits (278),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  632  WDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  691

Query  235  YGRTV  221
            YGRTV
Sbjct  692  YGRTV  696



>ref|XP_003523751.1| PREDICTED: uncharacterized protein LOC100779382 isoform X1 [Glycine 
max]
 ref|XP_006578236.1| PREDICTED: uncharacterized protein LOC100779382 isoform X2 [Glycine 
max]
 ref|XP_006578237.1| PREDICTED: uncharacterized protein LOC100779382 isoform X3 [Glycine 
max]
 ref|XP_006578238.1| PREDICTED: uncharacterized protein LOC100779382 isoform X4 [Glycine 
max]
Length=710

 Score =   148 bits (374),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAG  NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  551  QWEKNYYISAIAGVNNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  610

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  611  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  644


 Score =   122 bits (305),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASIC
Sbjct  645  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASIC  704

Query  235  YGRTV  221
            YGRTV
Sbjct  705  YGRTV  709



>ref|XP_006408871.1| hypothetical protein EUTSA_v10001925mg [Eutrema salsugineum]
 gb|ESQ50324.1| hypothetical protein EUTSA_v10001925mg [Eutrema salsugineum]
Length=676

 Score =   150 bits (379),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  517  QWEKNYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  576

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS+WG+VMSR A +SEQVVELDFLYPSEGIHR+
Sbjct  577  AGSKWGIVMSRGAAFSEQVVELDFLYPSEGIHRR  610


 Score =   120 bits (300),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLYI+SIC
Sbjct  611  WDNGYRITSTAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSNHVKEKWSKNLYISSIC  670

Query  235  YGRTV  221
            YGRTV
Sbjct  671  YGRTV  675



>ref|XP_007217013.1| hypothetical protein PRUPE_ppa002136mg [Prunus persica]
 gb|EMJ18212.1| hypothetical protein PRUPE_ppa002136mg [Prunus persica]
Length=711

 Score =   151 bits (381),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YIS+IAGA NGSSLVVMSKGTP+TQQSYKVS++FPFKWINKKW+EGF+VT+M T
Sbjct  552  QWENNYYISAIAGATNGSSLVVMSKGTPFTQQSYKVSDTFPFKWINKKWREGFYVTAMAT  611

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRW VVMSR AGYSEQVVELDFLYPSEGIHR+
Sbjct  612  SGSRWAVVMSRGAGYSEQVVELDFLYPSEGIHRR  645


 Score =   119 bits (298),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKW+KNLYIAS+C
Sbjct  646  WDSGYRITATAATWDQAAFVLSVPRRKPQDETQETLRTSAFPSPHVKEKWAKNLYIASMC  705

Query  235  YGRTV  221
            YGRTV
Sbjct  706  YGRTV  710



>ref|XP_006476018.1| PREDICTED: uncharacterized protein LOC102627154 isoform X1 [Citrus 
sinensis]
Length=697

 Score =   148 bits (373),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  598  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  631


 Score =   122 bits (306),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  632  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  691

Query  235  YGRTV  221
            YGRTV
Sbjct  692  YGRTV  696



>ref|XP_006450715.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 ref|XP_006450716.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63955.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63956.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
Length=697

 Score =   148 bits (373),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  598  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  631


 Score =   122 bits (306),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  632  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  691

Query  235  YGRTV  221
            YGRTV
Sbjct  692  YGRTV  696



>gb|KDO79859.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79860.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79861.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79862.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79863.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=697

 Score =   148 bits (373),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  598  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  631


 Score =   122 bits (306),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  632  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  691

Query  235  YGRTV  221
            YGRTV
Sbjct  692  YGRTV  696



>ref|XP_008338505.1| PREDICTED: uncharacterized protein LOC103401567 isoform X1 [Malus 
domestica]
Length=699

 Score =   159 bits (401),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  540  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  599

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  600  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  633


 Score =   111 bits (278),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  634  WDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  693

Query  235  YGRTV  221
            YGRTV
Sbjct  694  YGRTV  698



>gb|KJB21850.1| hypothetical protein B456_004G018100 [Gossypium raimondii]
Length=690

 Score =   154 bits (390),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWEKN+YISSIAG++ GSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM 
Sbjct  530  DQWEKNYYISSIAGSSGGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMA  589

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            T GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  590  TTGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  624


 Score =   115 bits (289),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  625  WDNGYRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  684

Query  235  YGRTV  221
            YGRTV
Sbjct  685  YGRTV  689



>ref|XP_009364099.1| PREDICTED: uncharacterized protein LOC103954016 [Pyrus x bretschneideri]
Length=699

 Score =   159 bits (401),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  540  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  599

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  600  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  633


 Score =   111 bits (277),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  634  WDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  693

Query  235  YGRTV  221
            YGRTV
Sbjct  694  YGRTV  698



>ref|XP_008390151.1| PREDICTED: uncharacterized protein LOC103452441 [Malus domestica]
Length=697

 Score =   159 bits (401),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  538  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  597

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  598  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  631


 Score =   111 bits (277),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  632  WDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  691

Query  235  YGRTV  221
            YGRTV
Sbjct  692  YGRTV  696



>gb|KHG18897.1| Casein kinase I [Gossypium arboreum]
Length=727

 Score =   149 bits (376),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA +G SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VTSM T
Sbjct  568  QWEKNYYISAIAGATDGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFYVTSMAT  627

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRW VVMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  628  SGSRWAVVMSRGAGFSDQVVELDFLYPSEGIHRR  661


 Score =   120 bits (302),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAFILS+PRR+ +DETQETLRTSAFPSTHVKEKW+KNLY+ASIC
Sbjct  662  WDCGYRITATAATWDQAAFILSLPRRRPVDETQETLRTSAFPSTHVKEKWAKNLYLASIC  721

Query  235  YGRTV  221
            YGRTV
Sbjct  722  YGRTV  726



>ref|XP_007014775.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY32394.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=701

 Score =   154 bits (389),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            ++WEKN+YIS+IAG+++GSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM 
Sbjct  541  HKWEKNYYISAIAGSSSGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMA  600

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  601  TAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  635


 Score =   115 bits (289),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  636  WDNGYRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  695

Query  235  YGRTV  221
            YGRTV
Sbjct  696  YGRTV  700



>ref|XP_010102418.1| Casein kinase I-2-like protein [Morus notabilis]
 gb|EXB93403.1| Casein kinase I-2-like protein [Morus notabilis]
Length=703

 Score =   149 bits (376),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYIS+IAGA+NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  544  QWEKNFYISAIAGASNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  603

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  604  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  637


 Score =   120 bits (301),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  638  WDGGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASIC  697

Query  235  YGRTV  221
            YGRTV
Sbjct  698  YGRTV  702



>ref|XP_008351086.1| PREDICTED: uncharacterized protein LOC103414488 [Malus domestica]
Length=486

 Score =   159 bits (401),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  327  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  386

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  387  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  420


 Score =   110 bits (276),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  421  WDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  480

Query  235  YGRTV  221
            YGRTV
Sbjct  481  YGRTV  485



>gb|KJB70401.1| hypothetical protein B456_011G072100 [Gossypium raimondii]
Length=727

 Score =   149 bits (376),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA +G SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VTSM T
Sbjct  568  QWEKNYYISAIAGATDGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFYVTSMAT  627

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +GSRW VVMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  628  SGSRWAVVMSRGAGFSDQVVELDFLYPSEGIHRR  661


 Score =   120 bits (301),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRIT+ AAT DQAAFILS+PRR+ +DETQETLRTSAFPSTHVKEKW KNLY+ASIC
Sbjct  662  WDCGYRITATAATWDQAAFILSLPRRRPVDETQETLRTSAFPSTHVKEKWEKNLYLASIC  721

Query  235  YGRTV  221
            YGRTV
Sbjct  722  YGRTV  726



>gb|AAT44311.1| putative casein kinase [Oryza sativa Japonica Group]
 gb|AAV59374.1| putative casein kinase [Oryza sativa Japonica Group]
Length=608

 Score =   151 bits (382),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWE+NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M 
Sbjct  448  DQWERNFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMA  507

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  508  TAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRR  542


 Score =   118 bits (296),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASIC
Sbjct  543  WDNGFRITATAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASIC  602

Query  235  YGRTV  221
            YGRTV
Sbjct  603  YGRTV  607



>gb|EEC78673.1| hypothetical protein OsI_18806 [Oryza sativa Indica Group]
Length=607

 Score =   151 bits (382),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWE+NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M 
Sbjct  447  DQWERNFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMA  506

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  507  TAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRR  541


 Score =   118 bits (296),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASIC
Sbjct  542  WDNGFRITATAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASIC  601

Query  235  YGRTV  221
            YGRTV
Sbjct  602  YGRTV  606



>ref|XP_010668618.1| PREDICTED: uncharacterized protein LOC104885660 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score =   148 bits (374),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGAANGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF+VTSM T
Sbjct  572  QWEKNYYISAIAGAANGSSLVVMSKGTQYLQQSYKVSDAFPFKWINKKWREGFYVTSMAT  631

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW VVMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  632  AGSRWAVVMSRGAGFSDQVVELDFLYPSEGIHRR  665


 Score =   121 bits (303),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQ+A +LSIPRRK  DETQETLRTSAFPSTHVKEKW KNLYIASIC
Sbjct  666  WDSGYRITSTAATFDQSALVLSIPRRKPTDETQETLRTSAFPSTHVKEKWDKNLYIASIC  725

Query  235  YGRTV  221
            YGRTV
Sbjct  726  YGRTV  730



>ref|XP_002324211.2| hypothetical protein POPTR_0018s08230g [Populus trichocarpa]
 gb|EEF02776.2| hypothetical protein POPTR_0018s08230g [Populus trichocarpa]
Length=687

 Score =   147 bits (372),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAG  NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  528  QWEKNYYISAIAGGNNGSSLVVMSKGTQYVQQSYKVSDSFPFKWINKKWREGFYVTAMAT  587

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  588  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  621


 Score =   122 bits (305),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ GYRITS AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  622  WDGGYRITSTAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVC  681

Query  235  YGRTV  221
            YGRTV
Sbjct  682  YGRTV  686



>ref|NP_001054881.2| Os05g0200500 [Oryza sativa Japonica Group]
 dbj|BAF16795.2| Os05g0200500, partial [Oryza sativa Japonica Group]
Length=649

 Score =   151 bits (382),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWE+NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M 
Sbjct  489  DQWERNFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMA  548

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  549  TAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRR  583


 Score =   118 bits (295),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASIC
Sbjct  584  WDNGFRITATAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASIC  643

Query  235  YGRTV  221
            YGRTV
Sbjct  644  YGRTV  648



>emb|CDY21505.1| BnaC03g26920D [Brassica napus]
Length=615

 Score =   149 bits (375),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  456  QWEKNYYITAVAGADNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  515

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS+WG+VMSR A +S+QVVELDFLYPSEGIHR+
Sbjct  516  AGSKWGIVMSRGAAFSDQVVELDFLYPSEGIHRR  549


 Score =   120 bits (302),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS+AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLYI+SIC
Sbjct  550  WDNGYRITSIAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSNHVKEKWSKNLYISSIC  609

Query  235  YGRTV  221
            YGRTV
Sbjct  610  YGRTV  614



>ref|XP_004294964.1| PREDICTED: uncharacterized protein LOC101294343 [Fragaria vesca 
subsp. vesca]
Length=731

 Score =   159 bits (402),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  572  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  631

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  632  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  665


 Score =   110 bits (275),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  666  WDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  725

Query  235  YGRTV  221
            YGRTV
Sbjct  726  YGRTV  730



>ref|XP_009367436.1| PREDICTED: uncharacterized protein LOC103957076 [Pyrus x bretschneideri]
Length=677

 Score =   146 bits (369),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGFHVT+M T
Sbjct  518  QWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFHVTAMAT  577

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            A SRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  578  ARSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  611


 Score =   123 bits (308),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASIC
Sbjct  612  WDNGYRITSTAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASIC  671

Query  235  YGRTV  221
            YGRTV
Sbjct  672  YGRTV  676



>dbj|BAG92829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62667.1| hypothetical protein OsJ_17470 [Oryza sativa Japonica Group]
Length=607

 Score =   151 bits (382),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  701  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  522
            +QWE+NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M 
Sbjct  447  DQWERNFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMA  506

Query  521  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  507  TAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRR  541


 Score =   118 bits (295),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++G+RIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASIC
Sbjct  542  WDNGFRITATAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASIC  601

Query  235  YGRTV  221
            YGRTV
Sbjct  602  YGRTV  606



>ref|XP_004148393.1| PREDICTED: uncharacterized protein LOC101218249 [Cucumis sativus]
 ref|XP_004162975.1| PREDICTED: uncharacterized LOC101218249 [Cucumis sativus]
Length=695

 Score =   146 bits (368),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  536  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  595

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG RW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  596  AGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  629


 Score =   123 bits (309),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  630  WDNGYRITSTAATLDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASIC  689

Query  235  YGRTV  221
            YGRTV
Sbjct  690  YGRTV  694



>ref|XP_003523750.1| PREDICTED: uncharacterized protein LOC100778855 isoform X1 [Glycine 
max]
Length=663

 Score =   148 bits (373),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  504  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  563

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  564  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  597


 Score =   121 bits (304),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASIC
Sbjct  598  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASIC  657

Query  235  YGRTV  221
            YGRTV
Sbjct  658  YGRTV  662



>gb|KGN62809.1| hypothetical protein Csa_2G373520 [Cucumis sativus]
Length=699

 Score =   146 bits (368),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  540  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  599

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AG RW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  600  AGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  633


 Score =   123 bits (309),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASIC
Sbjct  634  WDNGYRITSTAATLDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASIC  693

Query  235  YGRTV  221
            YGRTV
Sbjct  694  YGRTV  698



>ref|XP_002272679.2| PREDICTED: serine/threonine-protein kinase STE20 [Vitis vinifera]
Length=695

 Score =   149 bits (376),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  536  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTAMAT  595

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  596  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  629


 Score =   120 bits (301),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  630  WDNGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  689

Query  235  YGRTV  221
            YGRTV
Sbjct  690  YGRTV  694



>ref|XP_010249770.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249771.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249772.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249773.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
Length=706

 Score =   150 bits (378),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QW+KN+YISS+AGA NGS++VVMSKGTPYTQQSYKVS+ FPFKWINKKW EGF VT M T
Sbjct  547  QWDKNYYISSVAGATNGSAVVVMSKGTPYTQQSYKVSDVFPFKWINKKWNEGFFVTCMAT  606

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGS+WG+VMSRNAG+S QVVELDFLYPSEGIHR+
Sbjct  607  AGSKWGIVMSRNAGFSNQVVELDFLYPSEGIHRR  640


 Score =   118 bits (296),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            WESGYRITS AAT DQAAFILS P+RK  D TQETLRTSAFPS HVK+KWSKNLYIASIC
Sbjct  641  WESGYRITSAAATTDQAAFILSTPKRKSPDVTQETLRTSAFPSNHVKDKWSKNLYIASIC  700

Query  235  YGRTV  221
            YGRTV
Sbjct  701  YGRTV  705


 Score = 21.9 bits (45),  Expect(3) = 3e-63, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  540  HKDWIME  546



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score =   147 bits (372),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  353  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  412

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  413  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  446


 Score =   121 bits (304),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+C
Sbjct  447  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVC  506

Query  235  YGRTV  221
            YGRTV
Sbjct  507  YGRTV  511



>ref|XP_010546534.1| PREDICTED: uncharacterized protein LOC104818596 [Tarenaya hassleriana]
Length=701

 Score =   148 bits (373),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWE N+YI++IAG  NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VTSM T
Sbjct  542  QWENNYYITAIAGTNNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTSMAT  601

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  602  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  635


 Score =   121 bits (303),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS+AAT DQAA ILS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIA IC
Sbjct  636  WDSGYRITSLAATLDQAALILSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIAYIC  695

Query  235  YGRTV  221
            YGRTV
Sbjct  696  YGRTV  700



>ref|XP_010243375.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243376.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243377.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
Length=728

 Score =   157 bits (398),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  569  QWEKNYYISSIAGSTNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  628

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHR+
Sbjct  629  AGSRWGVVMSRNAGFNDQVVELDFLYPSEGIHRR  662


 Score =   111 bits (278),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT  AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKWSKNLY+A +C
Sbjct  663  WDNGYRITCAAATWDQAALILSVPKRKPSDETQETLRTSQFPSTHVKEKWSKNLYLACVC  722

Query  235  YGRTV  221
            YGRTV
Sbjct  723  YGRTV  727



>gb|KHN10182.1| Casein kinase I like 2 [Glycine soja]
Length=606

 Score =   147 bits (372),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  447  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  506

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHR+
Sbjct  507  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRR  540


 Score =   121 bits (304),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASIC
Sbjct  541  WDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASIC  600

Query  235  YGRTV  221
            YGRTV
Sbjct  601  YGRTV  605



>ref|XP_003577056.1| PREDICTED: uncharacterized protein LOC100836999 [Brachypodium 
distachyon]
Length=644

 Score =   155 bits (392),  Expect(3) = 4e-63, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKNFYISS+AG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSM T
Sbjct  485  QWEKNFYISSVAGSNNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMAT  544

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            +G RW +VMSRNAG+++QVVELDFLYPSEGIH++
Sbjct  545  SGGRWAIVMSRNAGFTDQVVELDFLYPSEGIHKR  578


 Score =   113 bits (283),  Expect(3) = 4e-63, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W++GYRIT+MAAT DQ+A ILS+PRR+  DETQETLRTS FPS HVK+KW+KNLY+A IC
Sbjct  579  WDNGYRITAMAATMDQSALILSMPRRRPRDETQETLRTSQFPSAHVKDKWAKNLYLAGIC  638

Query  235  YGRTVC  218
            YGRTV 
Sbjct  639  YGRTVA  644


 Score = 21.6 bits (44),  Expect(3) = 4e-63, Method: Composition-based stats.
 Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
 Frame = -3

Query  720  HKDWIME  700
            HKDWIME
Sbjct  478  HKDWIME  484



>ref|XP_008338530.1| PREDICTED: casein kinase I homolog 2-like [Malus domestica]
Length=538

 Score =   158 bits (399),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  698  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  519
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  379  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  438

Query  518  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRQ  417
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHR+
Sbjct  439  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRR  472


 Score =   111 bits (277),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  415  WESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  236
            W+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +C
Sbjct  473  WDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLC  532

Query  235  YGRTV  221
            YGRTV
Sbjct  533  YGRTV  537



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425