BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004F07

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO80165.1|  hypothetical protein CISIN_1g005652mg                   316   2e-103   Citrus sinensis [apfelsine]
gb|KDO80164.1|  hypothetical protein CISIN_1g005652mg                   319   8e-103   Citrus sinensis [apfelsine]
gb|KDO80158.1|  hypothetical protein CISIN_1g005652mg                   322   4e-102   Citrus sinensis [apfelsine]
gb|KDO80159.1|  hypothetical protein CISIN_1g005652mg                   321   6e-102   Citrus sinensis [apfelsine]
ref|XP_006475896.1|  PREDICTED: TBC1 domain family member 17-like       322   8e-102   Citrus sinensis [apfelsine]
gb|KDO80156.1|  hypothetical protein CISIN_1g005652mg                   322   1e-101   Citrus sinensis [apfelsine]
ref|XP_006381119.1|  hypothetical protein POPTR_0006s06520g             309   2e-101   
ref|XP_006450870.1|  hypothetical protein CICLE_v10007683mg             320   3e-101   Citrus clementina [clementine]
ref|XP_006401806.1|  hypothetical protein EUTSA_v10012867mg             319   8e-101   
gb|KHN22122.1|  TBC1 domain family member 15                            319   8e-101   Glycine soja [wild soybean]
ref|XP_006401805.1|  hypothetical protein EUTSA_v10012867mg             319   8e-101   Eutrema salsugineum [saltwater cress]
ref|XP_003542634.1|  PREDICTED: TBC1 domain family member 15-like       318   9e-101   Glycine max [soybeans]
ref|XP_007155039.1|  hypothetical protein PHAVU_003G167800g             317   2e-100   Phaseolus vulgaris [French bean]
ref|XP_004508468.1|  PREDICTED: TBC1 domain family member 17-like...    319   2e-100   Cicer arietinum [garbanzo]
ref|XP_002285365.1|  PREDICTED: TBC1 domain family member 17 isof...    317   3e-100   Vitis vinifera
emb|CDY65323.1|  BnaC02g44880D                                          318   3e-100   Brassica napus [oilseed rape]
ref|XP_010557604.1|  PREDICTED: TBC1 domain family member 15            317   5e-100   Tarenaya hassleriana [spider flower]
ref|XP_006280129.1|  hypothetical protein CARUB_v10026023mg             317   5e-100   Capsella rubella
ref|XP_007013521.1|  RabGAP/TBC domain-containing protein isoform 2     317   6e-100   
ref|XP_003549744.1|  PREDICTED: TBC1 domain family member 15-like       317   6e-100   
ref|XP_009624893.1|  PREDICTED: TBC1 domain family member 15-like       316   6e-100   Nicotiana tomentosiformis
dbj|BAA98077.1|  unnamed protein product                                306   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009758337.1|  PREDICTED: TBC1 domain family member 15-like       316   6e-100   Nicotiana sylvestris
ref|XP_010656459.1|  PREDICTED: TBC1 domain family member 17 isof...    317   6e-100   Vitis vinifera
ref|XP_002864184.1|  hypothetical protein ARALYDRAFT_495330             317   7e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_010656458.1|  PREDICTED: GTPase-activating protein GYP7 is...    317   8e-100   Vitis vinifera
emb|CDY27056.1|  BnaA02g10760D                                          317   9e-100   Brassica napus [oilseed rape]
ref|XP_006372159.1|  hypothetical protein POPTR_0018s12770g             315   1e-99    
ref|XP_009127224.1|  PREDICTED: TBC1 domain family member 15            316   1e-99    Brassica rapa
ref|XP_002324638.2|  hypothetical protein POPTR_0018s12770g             315   2e-99    
ref|XP_010482625.1|  PREDICTED: TBC1 domain family member 15-like...    315   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010482627.1|  PREDICTED: TBC1 domain family member 15-like...    315   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010482626.1|  PREDICTED: TBC1 domain family member 15-like...    315   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010442797.1|  PREDICTED: TBC1 domain family member 15-like       315   3e-99    Camelina sativa [gold-of-pleasure]
gb|KCW80045.1|  hypothetical protein EUGRSUZ_C01375                     311   3e-99    Eucalyptus grandis [rose gum]
ref|XP_010445073.1|  PREDICTED: TBC1 domain family member 15-like...    315   4e-99    Camelina sativa [gold-of-pleasure]
gb|KJB54007.1|  hypothetical protein B456_009G016100                    314   5e-99    Gossypium raimondii
ref|XP_003609386.1|  TBC1 domain family member                          314   5e-99    Medicago truncatula
ref|XP_007013520.1|  RabGAP/TBC domain-containing protein isoform 1     316   6e-99    
gb|AIU48656.1|  RabGAP/TBC domain-containing protein                    313   6e-99    Glycine max [soybeans]
ref|XP_010445069.1|  PREDICTED: TBC1 domain family member 15-like...    314   7e-99    Camelina sativa [gold-of-pleasure]
ref|XP_011017820.1|  PREDICTED: TBC1 domain family member 17-like...    312   1e-98    Populus euphratica
gb|AIU48673.1|  RabGAP/TBC domain-containing protein                    311   2e-98    Phaseolus vulgaris [French bean]
ref|XP_010241556.1|  PREDICTED: TBC1 domain family member 15 isof...    313   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010047970.1|  PREDICTED: TBC1 domain family member 15            312   4e-98    Eucalyptus grandis [rose gum]
ref|XP_010241554.1|  PREDICTED: TBC1 domain family member 17 isof...    313   4e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010241555.1|  PREDICTED: TBC1 domain family member 17 isof...    313   4e-98    Nelumbo nucifera [Indian lotus]
ref|XP_008362894.1|  PREDICTED: TBC1 domain family member 17-like       312   4e-98    
ref|XP_010323291.1|  PREDICTED: GTPase-activating protein gyp7          312   4e-98    Solanum lycopersicum
ref|XP_011017818.1|  PREDICTED: TBC1 domain family member 15-like...    312   4e-98    Populus euphratica
ref|XP_011017816.1|  PREDICTED: TBC1 domain family member 15-like...    312   5e-98    Populus euphratica
ref|XP_011084120.1|  PREDICTED: TBC1 domain family member 15            311   5e-98    Sesamum indicum [beniseed]
ref|XP_009363991.1|  PREDICTED: TBC1 domain family member 15            311   5e-98    Pyrus x bretschneideri [bai li]
ref|NP_200071.2|  RabGAP/TBC domain-containing protein                  311   6e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006358298.1|  PREDICTED: GTPase-activating protein gyp7-like     312   6e-98    Solanum tuberosum [potatoes]
emb|CDP10442.1|  unnamed protein product                                312   9e-98    Coffea canephora [robusta coffee]
gb|AIU48680.1|  RabGAP/TBC domain-containing protein                    310   9e-98    Schrenkiella parvula
ref|XP_004251725.1|  PREDICTED: TBC1 domain family member 17-like       311   9e-98    Solanum lycopersicum
ref|NP_001190524.1|  RabGAP/TBC domain-containing protein               311   1e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KFK26862.1|  hypothetical protein AALP_AA8G303600                    311   1e-97    Arabis alpina [alpine rockcress]
gb|EYU18249.1|  hypothetical protein MIMGU_mgv1a002604mg                310   1e-97    Erythranthe guttata [common monkey flower]
ref|XP_006345222.1|  PREDICTED: TBC1 domain family member 15-like       310   2e-97    Solanum tuberosum [potatoes]
gb|AIU48681.1|  RabGAP/TBC domain-containing protein                    309   3e-97    Vitis vinifera
ref|XP_002527173.1|  conserved hypothetical protein                     309   3e-97    
ref|XP_011020167.1|  PREDICTED: TBC1 domain family member 15            310   3e-97    Populus euphratica
gb|AIU48654.1|  RabGAP/TBC domain-containing protein                    308   5e-97    Citrus sinensis [apfelsine]
gb|AIU48653.1|  RabGAP/TBC domain-containing protein                    307   9e-97    Capsella rubella
gb|AIU48640.1|  RabGAP/TBC domain-containing protein                    307   1e-96    Arabidopsis lyrata [lyrate rockcress]
gb|AIU48647.1|  RabGAP/TBC domain-containing protein                    306   1e-96    Theobroma cacao [chocolate]
gb|AIU48650.1|  RabGAP/TBC domain-containing protein                    307   1e-96    Citrus clementina [clementine]
gb|AIU48658.1|  RabGAP/TBC domain-containing protein                    307   2e-96    Buxus sinica
gb|KJB64719.1|  hypothetical protein B456_010G061900                    307   2e-96    Gossypium raimondii
ref|XP_009593351.1|  PREDICTED: TBC1 domain family member 15 isof...    303   6e-96    
gb|AIU48670.1|  RabGAP/TBC domain-containing protein                    305   7e-96    Populus trichocarpa [western balsam poplar]
ref|XP_004173869.1|  PREDICTED: TBC1 domain family member 15-like       291   7e-96    
gb|AIU48666.1|  RabGAP/TBC domain-containing protein                    305   8e-96    Medicago truncatula
gb|AIU48682.1|  RabGAP/TBC domain-containing protein                    296   1e-95    Lactuca sativa [cultivated lettuce]
gb|AIU48675.1|  RabGAP/TBC domain-containing protein                    304   1e-95    Ricinus communis
ref|XP_010911930.1|  PREDICTED: TBC1 domain family member 17 isof...    301   2e-95    Elaeis guineensis
ref|XP_009789610.1|  PREDICTED: TBC1 domain family member 15-like...    301   3e-95    Nicotiana sylvestris
ref|XP_008785780.1|  PREDICTED: TBC1 domain family member 15            304   4e-95    Phoenix dactylifera
gb|AIU48668.1|  RabGAP/TBC domain-containing protein                    303   5e-95    Manihot esculenta [manioc]
ref|XP_010911929.1|  PREDICTED: TBC1 domain family member 15 isof...    304   6e-95    Elaeis guineensis
ref|XP_009593349.1|  PREDICTED: TBC1 domain family member 17 isof...    304   6e-95    Nicotiana tomentosiformis
gb|AIU48641.1|  RabGAP/TBC domain-containing protein                    303   7e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KJB27077.1|  hypothetical protein B456_004G276400                    302   1e-94    Gossypium raimondii
gb|KJB27078.1|  hypothetical protein B456_004G276400                    303   1e-94    Gossypium raimondii
ref|XP_007204093.1|  hypothetical protein PRUPE_ppa002904mg             301   2e-94    
gb|KJB27079.1|  hypothetical protein B456_004G276400                    303   2e-94    Gossypium raimondii
ref|XP_004287286.1|  PREDICTED: TBC1 domain family member 15            302   2e-94    Fragaria vesca subsp. vesca
gb|AIU48639.1|  RabGAP/TBC domain-containing protein                    301   3e-94    Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU48649.1|  RabGAP/TBC domain-containing protein                    293   3e-94    Sarcandra glabra
gb|AIU48669.1|  RabGAP/TBC domain-containing protein                    300   4e-94    Erythranthe guttata [common monkey flower]
gb|AIU48655.1|  RabGAP/TBC domain-containing protein                    300   4e-94    Eucalyptus grandis [rose gum]
ref|XP_009789608.1|  PREDICTED: TBC1 domain family member 17-like...    302   4e-94    Nicotiana sylvestris
gb|AIU48652.1|  RabGAP/TBC domain-containing protein                    300   6e-94    Carica papaya [mamon]
gb|KHG01737.1|  TBC1 domain family member 15                            301   7e-94    Gossypium arboreum [tree cotton]
ref|XP_008242808.1|  PREDICTED: TBC1 domain family member 17            300   2e-93    Prunus mume [ume]
gb|AIU48667.1|  RabGAP/TBC domain-containing protein                    298   3e-93    Canna indica [canna]
ref|XP_008377303.1|  PREDICTED: TBC1 domain family member 17            299   4e-93    
gb|AIU48644.1|  RabGAP/TBC domain-containing protein                    288   4e-93    Musa acuminata [banana]
gb|AIU48691.1|  RabGAP/TBC domain-containing protein                    291   5e-93    Cabomba caroliniana
gb|AIU48671.1|  RabGAP/TBC domain-containing protein                    296   1e-92    Prunus persica
ref|XP_008456989.1|  PREDICTED: TBC1 domain family member 15            296   2e-92    Cucumis melo [Oriental melon]
ref|XP_009420718.1|  PREDICTED: TBC1 domain family member 15            296   3e-92    
gb|AIU48662.1|  RabGAP/TBC domain-containing protein                    295   4e-92    Chimonanthus praecox [wintersweet]
ref|XP_004139297.1|  PREDICTED: TBC1 domain family member 15-like       295   8e-92    Cucumis sativus [cucumbers]
gb|AIU48648.1|  RabGAP/TBC domain-containing protein                    291   2e-91    Acorus calamus [flagroot]
gb|AIU48690.1|  RabGAP/TBC domain-containing protein                    294   2e-91    Trachycarpus fortunei
gb|AIU48645.1|  RabGAP/TBC domain-containing protein                    293   2e-91    Pinellia ternata
gb|AIU48651.1|  RabGAP/TBC domain-containing protein                    292   5e-91    Gossypium raimondii
gb|AIU48660.1|  RabGAP/TBC domain-containing protein                    292   6e-91    Chloranthus japonicus
ref|XP_011469988.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    292   7e-91    Fragaria vesca subsp. vesca
gb|AIU48664.1|  RabGAP/TBC domain-containing protein                    292   7e-91    Asparagus officinalis
gb|AIU48677.1|  RabGAP/TBC domain-containing protein                    291   1e-90    Yucca filamentosa [Adam's-needle]
gb|AIU48657.1|  RabGAP/TBC domain-containing protein                    290   4e-90    Illicium henryi
gb|AIU48687.1|  RabGAP/TBC domain-containing protein                    290   4e-90    Houttuynia cordata [chameleon-plant]
gb|AIU48686.1|  RabGAP/TBC domain-containing protein                    289   7e-90    Ginkgo biloba [ginkgo]
gb|AIU48684.1|  RabGAP/TBC domain-containing protein                    288   9e-90    Cinnamomum camphora
ref|XP_010687933.1|  PREDICTED: TBC1 domain family member 15 isof...    289   1e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687932.1|  PREDICTED: TBC1 domain family member 15 isof...    290   1e-89    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48665.1|  RabGAP/TBC domain-containing protein                    288   2e-89    Aristolochia tagala
gb|AIU48676.1|  RabGAP/TBC domain-containing protein                    287   8e-89    Dioscorea oppositifolia
gb|AIU48642.1|  RabGAP/TBC domain-containing protein                    286   1e-88    Lilium brownii [Hong Kong lily]
gb|AIU48683.1|  RabGAP/TBC domain-containing protein                    283   1e-87    Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU48661.1|  RabGAP/TBC domain-containing protein                    283   1e-87    Ceratophyllum demersum [hornwort]
gb|AIU48689.1|  RabGAP/TBC domain-containing protein                    282   5e-87    Alisma plantago-aquatica
ref|XP_006647781.1|  PREDICTED: TBC1 domain family member 15-like       281   2e-86    Oryza brachyantha
gb|AIU48688.1|  RabGAP/TBC domain-containing protein                    275   4e-86    Zea mays [maize]
gb|KDP30256.1|  hypothetical protein JCGZ_17038                         280   8e-86    Jatropha curcas
gb|AIU48659.1|  RabGAP/TBC domain-containing protein                    279   9e-86    Iris japonica
gb|AIU48672.1|  RabGAP/TBC domain-containing protein                    279   1e-85    Panicum virgatum
ref|XP_004953647.1|  PREDICTED: TBC1 domain family member 15-like       280   1e-85    Setaria italica
gb|AIU48679.1|  RabGAP/TBC domain-containing protein                    278   1e-85    Sorghum bicolor [broomcorn]
gb|AIU48678.1|  RabGAP/TBC domain-containing protein                    278   2e-85    Setaria italica
ref|XP_002452666.1|  hypothetical protein SORBIDRAFT_04g030250          278   6e-85    
ref|XP_003570212.1|  PREDICTED: TBC1 domain family member 15            277   1e-84    Brachypodium distachyon [annual false brome]
gb|AIU48646.1|  RabGAP/TBC domain-containing protein                    276   1e-84    Brachypodium distachyon [annual false brome]
ref|NP_001168835.1|  uncharacterized protein LOC100382640               276   4e-84    Zea mays [maize]
ref|XP_006855176.1|  hypothetical protein AMTR_s00051p00106780          274   2e-83    Amborella trichopoda
gb|AIU48643.1|  RabGAP/TBC domain-containing protein                    271   5e-83    Magnolia denudata [haku-mokuren]
ref|NP_001047892.1|  Os02g0709800                                       272   1e-82    
ref|XP_001783529.1|  predicted protein                                  261   2e-80    
dbj|BAK05291.1|  predicted protein                                      265   5e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972350.1|  hypothetical protein SELMODRAFT_97576              246   3e-76    
ref|XP_002971826.1|  hypothetical protein SELMODRAFT_96534              246   5e-76    
ref|XP_010112474.1|  TBC1 domain family member 15                       243   3e-73    
gb|EMT03185.1|  TBC1 domain family member 15                            235   2e-69    
ref|XP_009789609.1|  PREDICTED: TBC1 domain family member 17-like...    233   4e-68    Nicotiana sylvestris
ref|XP_009593350.1|  PREDICTED: TBC1 domain family member 17 isof...    231   2e-67    Nicotiana tomentosiformis
gb|EEC73873.1|  hypothetical protein OsI_08649                          226   3e-65    Oryza sativa Indica Group [Indian rice]
gb|EMS58117.1|  TBC1 domain family member 15                            201   8e-57    Triticum urartu
emb|CBI28233.3|  unnamed protein product                                171   1e-49    Vitis vinifera
gb|ABK92630.1|  unknown                                                 164   3e-47    Populus trichocarpa [western balsam poplar]
gb|EPS74110.1|  hypothetical protein M569_00644                         159   2e-44    Genlisea aurea
ref|XP_010656460.1|  PREDICTED: GTPase-activating protein GYP7-like     154   1e-43    Vitis vinifera
emb|CAN75817.1|  hypothetical protein VITISV_033040                     153   2e-43    Vitis vinifera
ref|XP_005649420.1|  RabGAP/TBC                                         162   3e-42    Coccomyxa subellipsoidea C-169
gb|EPS72188.1|  hypothetical protein M569_02568                         150   6e-42    Genlisea aurea
ref|XP_001692974.1|  RabGAP/TBC protein                                 154   4e-41    Chlamydomonas reinhardtii
emb|CEG81743.1|  hypothetical protein RMATCC62417_15905                 154   4e-39    Rhizopus microsporus
gb|KIO13611.1|  hypothetical protein M404DRAFT_993164                   153   2e-38    Pisolithus tinctorius Marx 270
ref|XP_009542802.1|  hypothetical protein HETIRDRAFT_471290             152   2e-38    Heterobasidion irregulare TC 32-1
emb|CEG74578.1|  hypothetical protein RMATCC62417_09764                 152   3e-38    Rhizopus microsporus
emb|CEG74577.1|  hypothetical protein RMATCC62417_09764                 152   3e-38    Rhizopus microsporus
gb|KIM49181.1|  hypothetical protein M413DRAFT_438347                   152   3e-38    Hebeloma cylindrosporum h7
gb|KIP09589.1|  hypothetical protein PHLGIDRAFT_67361                   151   5e-38    Phlebiopsis gigantea 11061_1 CR5-6
emb|CEI91235.1|  hypothetical protein RMCBS344292_05533                 151   5e-38    Rhizopus microsporus
ref|XP_007345802.1|  RabGAP/TBC                                         151   6e-38    
ref|XP_007764671.1|  GTPase-activating protein gyp7                     151   7e-38    Coniophora puteana RWD-64-598 SS2
gb|EPT06212.1|  hypothetical protein FOMPIDRAFT_1110507                 151   7e-38    Fomitopsis pinicola FP-58527 SS1
ref|XP_002609518.1|  hypothetical protein BRAFLDRAFT_95612              147   9e-38    Branchiostoma floridae
gb|EMD38374.1|  hypothetical protein CERSUDRAFT_113536                  150   1e-37    Gelatoporia subvermispora B
gb|KIK30947.1|  hypothetical protein PISMIDRAFT_86279                   150   1e-37    Pisolithus microcarpus 441
gb|KDR81554.1|  hypothetical protein GALMADRAFT_221417                  150   2e-37    Galerina marginata CBS 339.88
gb|KIM62089.1|  hypothetical protein SCLCIDRAFT_1178195                 150   2e-37    Scleroderma citrinum Foug A
gb|KII88599.1|  hypothetical protein PLICRDRAFT_41787                   150   2e-37    Plicaturopsis crispa FD-325 SS-3
gb|KIM21739.1|  hypothetical protein M408DRAFT_29311                    149   3e-37    Serendipita vermifera MAFF 305830
emb|CEP17529.1|  hypothetical protein                                   149   4e-37    Parasitella parasitica
emb|CCA66945.1|  probable GTPase activating protein                     149   4e-37    Serendipita indica DSM 11827
ref|XP_007361169.1|  RabGAP/TBC                                         149   4e-37    Dichomitus squalens LYAD-421 SS1
gb|KEP45951.1|  GTPase-activating protein Gyp7                          149   4e-37    Rhizoctonia solani 123E
gb|KDQ60762.1|  hypothetical protein JAAARDRAFT_204574                  149   4e-37    Jaapia argillacea MUCL 33604
emb|CEI91236.1|  hypothetical protein RMCBS344292_05534                 145   5e-37    Rhizopus microsporus
ref|XP_007385727.1|  RabGAP/TBC                                         149   5e-37    Punctularia strigosozonata HHB-11173 SS5
ref|XP_008045239.1|  RabGAP/TBC                                         149   5e-37    Trametes versicolor FP-101664 SS1
emb|CEI91237.1|  hypothetical protein RMCBS344292_05534                 145   6e-37    Rhizopus microsporus
gb|EUC67275.1|  GTPase-activating protein GYP7                          148   6e-37    Rhizoctonia solani AG-3 Rhs1AP
gb|KIO32502.1|  hypothetical protein M407DRAFT_241400                   148   7e-37    Tulasnella calospora MUT 4182
gb|EJU05764.1|  RabGAP/TBC                                              147   1e-36    Dacryopinax primogenitus
ref|XP_006458178.1|  hypothetical protein AGABI2DRAFT_183265            149   1e-36    Agaricus bisporus var. bisporus H97
ref|XP_007326252.1|  hypothetical protein AGABI1DRAFT_68626             149   1e-36    Agaricus bisporus var. burnettii JB137-S8
gb|KJA20210.1|  hypothetical protein HYPSUDRAFT_167151                  147   1e-36    Hypholoma sublateritium FD-334 SS-4
ref|XP_007300987.1|  RabGAP/TBC                                         147   1e-36    Stereum hirsutum FP-91666 SS1
ref|XP_007862850.1|  RabGAP/TBC                                         148   1e-36    Gloeophyllum trabeum ATCC 11539
gb|KDN51536.1|  hypothetical protein RSAG8_00081                        147   2e-36    Rhizoctonia solani AG-8 WAC10335
ref|XP_003848770.1|  hypothetical protein MYCGRDRAFT_76044              147   2e-36    Zymoseptoria tritici IPO323
ref|XP_007805043.1|  hypothetical protein EPUS_03989                    148   2e-36    Endocarpon pusillum Z07020
ref|XP_001875369.1|  predicted protein                                  147   2e-36    Laccaria bicolor S238N-H82
gb|KIK08687.1|  hypothetical protein K443DRAFT_84333                    147   2e-36    Laccaria amethystina LaAM-08-1
ref|XP_006633652.1|  PREDICTED: TBC1 domain family member 15-like       145   3e-36    
gb|KFH67583.1|  hypothetical protein MVEG_06315                         147   3e-36    Mortierella verticillata NRRL 6337
ref|XP_002950778.1|  hypothetical protein VOLCADRAFT_60703              141   3e-36    Volvox carteri f. nagariensis
emb|CCX13007.1|  Similar to GTPase-activating protein GYP7; acc. ...    146   4e-36    Pyronema omphalodes CBS 100304
gb|KIL69693.1|  hypothetical protein M378DRAFT_1048890                  146   4e-36    Amanita muscaria Koide BX008
gb|EWC44833.1|  hypothetical protein DRE_06471                          146   4e-36    Drechslerella stenobrocha 248
gb|EPB92968.1|  hypothetical protein HMPREF1544_00042                   146   5e-36    Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN09723.1|  GTPase activating protein (Gyp7)                       145   6e-36    Mucor ambiguus
gb|KDQ18528.1|  hypothetical protein BOTBODRAFT_127404                  145   6e-36    Botryobasidium botryosum FD-172 SS1
gb|KIJ69240.1|  hypothetical protein HYDPIDRAFT_105840                  145   7e-36    Hydnomerulius pinastri MD-312
ref|XP_007776922.1|  hypothetical protein W97_00820                     145   8e-36    Coniosporium apollinis CBS 100218
gb|KIY69995.1|  RabGAP/TBC                                              145   8e-36    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_011111334.1|  hypothetical protein H072_5454                     145   8e-36    
ref|XP_007395913.1|  hypothetical protein PHACADRAFT_173743             145   9e-36    Phanerochaete carnosa HHB-10118-sp
gb|EKG21073.1|  hypothetical protein MPH_01617                          145   1e-35    Macrophomina phaseolina MS6
ref|XP_007267802.1|  RabGAP/TBC                                         145   1e-35    Fomitiporia mediterranea MF3/22
gb|KIK49290.1|  hypothetical protein CY34DRAFT_797241                   145   1e-35    Suillus luteus UH-Slu-Lm8-n1
gb|KIM87015.1|  hypothetical protein PILCRDRAFT_95906                   145   1e-35    Piloderma croceum F 1598
emb|CCM02409.1|  predicted protein                                      145   1e-35    Fibroporia radiculosa
ref|XP_007321851.1|  hypothetical protein SERLADRAFT_452033             144   1e-35    Serpula lacrymans var. lacrymans S7.9
dbj|GAM83758.1|  hypothetical protein ANO11243_017480                   144   1e-35    fungal sp. No.11243
gb|EGN95360.1|  hypothetical protein SERLA73DRAFT_162269                144   1e-35    Serpula lacrymans var. lacrymans S7.3
ref|XP_009063579.1|  hypothetical protein LOTGIDRAFT_221303             143   2e-35    Lottia gigantea
ref|XP_011448760.1|  PREDICTED: TBC1 domain family member 15-like...    143   2e-35    Crassostrea gigas
dbj|GAN03755.1|  GTPase-activating protein GYP7                         144   2e-35    Mucor ambiguus
ref|XP_011448761.1|  PREDICTED: TBC1 domain family member 15-like...    142   2e-35    Crassostrea gigas
ref|XP_007684557.1|  hypothetical protein COCMIDRAFT_85923              144   3e-35    Bipolaris oryzae ATCC 44560
ref|XP_002911878.1|  GTPase-activating protein gyp7                     144   3e-35    Coprinopsis cinerea okayama7#130
emb|CEG04196.1|  unnamed protein product                                144   3e-35    Fusarium sp. FIESC_5 CS3069
gb|KIK59737.1|  hypothetical protein GYMLUDRAFT_44173                   144   3e-35    Gymnopus luxurians FD-317 M1
emb|CDO69529.1|  hypothetical protein BN946_scf184785.g34               144   3e-35    Trametes cinnabarina
gb|EIE81059.1|  hypothetical protein RO3G_05764                         143   3e-35    Rhizopus delemar RA 99-880
ref|XP_007847684.1|  gtpase-activating protein gyp7                     143   4e-35    
ref|XP_011121238.1|  hypothetical protein AOL_s00076g384                143   4e-35    Arthrobotrys oligospora ATCC 24927
ref|XP_005833659.1|  hypothetical protein GUITHDRAFT_70335              139   4e-35    Guillardia theta CCMP2712
gb|KDO80161.1|  hypothetical protein CISIN_1g005652mg                   140   7e-35    Citrus sinensis [apfelsine]
gb|KDO80160.1|  hypothetical protein CISIN_1g005652mg                   140   8e-35    Citrus sinensis [apfelsine]
gb|EME47991.1|  hypothetical protein DOTSEDRAFT_69807                   142   9e-35    Dothistroma septosporum NZE10
gb|KFA60970.1|  hypothetical protein S40285_02773                       142   9e-35    Stachybotrys chlorohalonata IBT 40285
gb|KFA46459.1|  hypothetical protein S40293_04279                       142   9e-35    Stachybotrys chartarum IBT 40293
gb|KEY73259.1|  hypothetical protein S7711_01380                        142   9e-35    Stachybotrys chartarum IBT 7711
ref|XP_011323699.1|  GTPase-activating protein GYP7                     142   9e-35    Fusarium graminearum PH-1
ref|XP_009258695.1|  hypothetical protein FPSE_07302                    142   9e-35    Fusarium pseudograminearum CS3096
gb|EUN32280.1|  hypothetical protein COCVIDRAFT_22116                   142   9e-35    Bipolaris victoriae FI3
ref|XP_007707138.1|  hypothetical protein COCCADRAFT_772                142   9e-35    Bipolaris zeicola 26-R-13
ref|XP_007705031.1|  hypothetical protein COCSADRAFT_127796             142   9e-35    Bipolaris sorokiniana ND90Pr
ref|XP_008153766.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    142   1e-34    
ref|XP_001642096.1|  predicted protein                                  139   1e-34    Nematostella vectensis
gb|ENI06740.1|  hypothetical protein COCC4DRAFT_192817                  142   1e-34    Bipolaris maydis ATCC 48331
gb|KIV99936.1|  hypothetical protein PV09_08456                         142   1e-34    Verruconis gallopava
ref|XP_008501845.1|  PREDICTED: TBC1 domain family member 15-like       134   1e-34    Calypte anna
gb|EPB92353.1|  hypothetical protein HMPREF1544_00922                   141   1e-34    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002117757.1|  hypothetical protein TRIADDRAFT_38489              139   1e-34    Trichoplax adhaerens
gb|EPE09161.1|  gtpase-activating protein gyp7                          142   2e-34    Ophiostoma piceae UAMH 11346
ref|XP_007676059.1|  hypothetical protein BAUCODRAFT_33679              142   2e-34    Baudoinia panamericana UAMH 10762
gb|EFX01643.1|  GTPase activating protein                               141   2e-34    Grosmannia clavigera kw1407
gb|KEQ79017.1|  RabGAP/TBC                                              141   2e-34    Aureobasidium pullulans EXF-150
gb|EPQ18866.1|  TBC1 domain family member 15                            141   2e-34    Myotis brandtii
ref|XP_006923814.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    140   2e-34    
gb|KHJ32497.1|  putative gtpase-activating protein gyp7                 141   2e-34    Erysiphe necator
ref|XP_003302157.1|  hypothetical protein PTT_13880                     141   3e-34    
ref|XP_005884185.1|  PREDICTED: TBC1 domain family member 15 isof...    140   3e-34    Myotis brandtii
ref|XP_009223960.1|  GTPase-activating protein GYP7                     141   3e-34    Gaeumannomyces tritici R3-111a-1
ref|XP_003036056.1|  hypothetical protein SCHCODRAFT_65991              141   3e-34    Schizophyllum commune H4-8
ref|XP_008023866.1|  hypothetical protein SETTUDRAFT_168350             141   3e-34    Exserohilum turcica Et28A
gb|EHK41792.1|  hypothetical protein TRIATDRAFT_147224                  140   3e-34    Trichoderma atroviride IMI 206040
gb|KIH87159.1|  GTPase-activating protein GYP7                          141   3e-34    Sporothrix brasiliensis 5110
gb|ERS95154.1|  hypothetical protein HMPREF1624_08364                   141   3e-34    Sporothrix schenckii ATCC 58251
ref|XP_006095517.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    140   3e-34    
gb|KIY50870.1|  GTPase-activating protein gyp7                          140   3e-34    Fistulina hepatica ATCC 64428
ref|XP_006696481.1|  GTPase-activating protein gyp7-like protein        141   3e-34    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_003050169.1|  predicted protein                                  140   3e-34    [Nectria] haematococca mpVI 77-13-4
ref|XP_005884184.1|  PREDICTED: TBC1 domain family member 15 isof...    140   3e-34    Myotis brandtii
ref|XP_001911856.1|  hypothetical protein                               140   3e-34    Podospora anserina S mat+
ref|XP_003292326.1|  hypothetical protein DICPUDRAFT_89768              140   4e-34    Dictyostelium purpureum
ref|XP_009848362.1|  GTPase-activating protein GYP7                     140   4e-34    Neurospora tetrasperma FGSC 2508
ref|XP_007054875.1|  PREDICTED: TBC1 domain family member 15            140   4e-34    
gb|KIK93712.1|  hypothetical protein PAXRUDRAFT_144473                  140   4e-34    Paxillus rubicundulus Ve08.2h10
gb|KIM95971.1|  hypothetical protein OIDMADRAFT_183435                  140   4e-34    Oidiodendron maius Zn
gb|EMF15935.1|  RabGAP/TBC                                              140   4e-34    
emb|CDS04735.1|  hypothetical protein LRAMOSA07265                      140   4e-34    
ref|XP_960741.3|  GTPase-activating protein GYP7                        140   5e-34    
ref|XP_007586932.1|  putative gtpase-activating protein gyp7 protein    139   5e-34    
ref|XP_010752961.1|  PREDICTED: TBC1 domain family member 15 isof...    139   5e-34    
emb|CAC18154.2|  probable GTPase activating protein                     140   5e-34    
gb|KJB64721.1|  hypothetical protein B456_010G061900                    138   5e-34    
ref|XP_010752960.1|  PREDICTED: TBC1 domain family member 15 isof...    139   5e-34    
ref|XP_003719772.1|  GTPase-activating protein GYP7                     140   5e-34    
ref|XP_010890362.1|  PREDICTED: TBC1 domain family member 15-like       139   5e-34    
gb|EMR80986.1|  putative gtpase-activating protein gyp7 protein         140   5e-34    
dbj|BAE36734.1|  unnamed protein product                                133   5e-34    
gb|ELR08750.1|  hypothetical protein GMDG_03429                         140   6e-34    
gb|KDQ33241.1|  hypothetical protein PLEOSDRAFT_1060916                 141   6e-34    
gb|KEQ99263.1|  hypothetical protein AUEXF2481DRAFT_409411              140   7e-34    
emb|CDH50024.1|  gtpase-activating protein gyp7                         139   7e-34    
gb|ENH88280.1|  GTPase-activating protein gyp7                          140   7e-34    
ref|XP_007923993.1|  hypothetical protein MYCFIDRAFT_162455             139   8e-34    
ref|XP_772226.1|  hypothetical protein CNBM0320                         139   9e-34    
ref|XP_004069404.1|  PREDICTED: TBC1 domain family member 15            138   9e-34    
ref|XP_010312019.1|  PREDICTED: TBC1 domain family member 15            135   1e-33    
ref|XP_003352101.1|  hypothetical protein SMAC_02536                    139   1e-33    
gb|EIE92219.1|  hypothetical protein RO3G_17026                         137   1e-33    
ref|XP_007284657.1|  GTPase-activating protein gyp7                     139   1e-33    
gb|EXK97365.1|  hypothetical protein FOQG_02584                         139   1e-33    
gb|EXK97364.1|  hypothetical protein FOQG_02584                         139   1e-33    
gb|EFQ29904.1|  GTPase-activating protein GYP7                          139   1e-33    
ref|XP_008083948.1|  Ypt/Rab-GAP of gyp1p                               139   1e-33    
emb|CEP13047.1|  hypothetical protein                                   139   1e-33    
gb|KFW83412.1|  TBC1 domain family member 15                            137   1e-33    
ref|XP_007293593.1|  GTPase-activating protein GYP7                     139   1e-33    
gb|KEZ44130.1|  GTPase-activating protein GYP7                          139   1e-33    
ref|XP_568367.1|  Rab GTPase activator                                  139   1e-33    
gb|KIJ16899.1|  hypothetical protein PAXINDRAFT_168334                  139   1e-33    
ref|XP_003662116.1|  hypothetical protein MYCTH_2302291                 139   1e-33    
ref|XP_007007846.1|  hypothetical protein TREMEDRAFT_70187              138   1e-33    
gb|KFZ23787.1|  hypothetical protein V502_01744                         139   2e-33    
gb|KFY49624.1|  hypothetical protein V495_00520                         139   2e-33    
gb|KFX86963.1|  hypothetical protein V490_08692                         139   2e-33    
gb|KFY87267.1|  hypothetical protein V500_07070                         139   2e-33    
gb|KIL91611.1|  hypothetical protein FAVG1_05228                        138   2e-33    
ref|XP_001590252.1|  hypothetical protein SS1G_09016                    139   2e-33    
gb|EQB54704.1|  GTPase-activating protein GYP7                          139   2e-33    
gb|EXM25993.1|  hypothetical protein FOTG_07675                         138   2e-33    
gb|EXA42370.1|  hypothetical protein FOVG_07627                         138   2e-33    
gb|EXK45382.1|  hypothetical protein FOMG_03838                         138   2e-33    
gb|EWZ48058.1|  hypothetical protein FOZG_03761                         138   2e-33    
gb|EWZ01993.1|  hypothetical protein FOYG_01424                         138   2e-33    
emb|CCT67233.1|  probable GTPase activating protein                     138   2e-33    
ref|XP_006258530.1|  PREDICTED: TBC1 domain family member 15            137   2e-33    
gb|EXM25992.1|  hypothetical protein FOTG_07675                         138   2e-33    
gb|EXM06665.1|  hypothetical protein FOIG_03387                         138   2e-33    
gb|EXK45381.1|  hypothetical protein FOMG_03838                         138   2e-33    
gb|EXA42369.1|  hypothetical protein FOVG_07627                         138   2e-33    
gb|EWZ48057.1|  hypothetical protein FOZG_03761                         138   2e-33    
gb|EWZ01992.1|  hypothetical protein FOYG_01424                         138   2e-33    
ref|XP_006026311.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    137   2e-33    
gb|EMT68461.1|  GTPase-activating protein GYP7                          138   3e-33    
ref|XP_008925123.1|  PREDICTED: TBC1 domain family member 15            137   3e-33    
gb|ENH68472.1|  GTPase-activating protein GYP7                          138   3e-33    
gb|KFY71427.1|  hypothetical protein V499_08379                         139   3e-33    
dbj|GAD91559.1|  GTPase activating protein (Gyp7), putative             138   3e-33    
ref|XP_005039952.1|  PREDICTED: TBC1 domain family member 15            137   4e-33    
ref|XP_009658420.1|  GTPase-activating protein GYP7                     138   4e-33    
gb|EKV12198.1|  hypothetical protein PDIG_45230                         137   4e-33    
ref|XP_007602678.1|  GTPase-activating protein GYP7                     138   4e-33    
gb|KFG86284.1|  putative GTPase activating protein                      137   4e-33    
ref|XP_007822425.1|  RasGAP protein                                     137   4e-33    
emb|CAB75666.1|  hypothetical protein                                   131   4e-33    
gb|KIY30756.1|  rab GTPase activator                                    137   4e-33    
gb|KFY17694.1|  hypothetical protein V492_00470                         138   4e-33    
gb|KFU93704.1|  TBC1 domain family member 15                            136   4e-33    
gb|KFY32446.1|  hypothetical protein V493_00179                         137   4e-33    
gb|KID94181.1|  Rab-GAP/TBC domain protein                              137   4e-33    
gb|EHK26045.1|  hypothetical protein TRIVIDRAFT_79653                   137   4e-33    
gb|EGU78450.1|  hypothetical protein FOXB_11064                         137   4e-33    
gb|EXU95631.1|  Rab GTPase-TBC domain protein                           137   5e-33    
ref|XP_009808653.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    135   5e-33    
gb|KDN68210.1|  putative GTPase-activating protein GYP7                 137   5e-33    
ref|XP_009085252.1|  PREDICTED: TBC1 domain family member 15            136   5e-33    
ref|XP_006121609.1|  PREDICTED: TBC1 domain family member 15 isof...    136   5e-33    
ref|XP_005480662.1|  PREDICTED: TBC1 domain family member 15            136   5e-33    
ref|XP_005305159.1|  PREDICTED: TBC1 domain family member 15 isof...    136   5e-33    
gb|KID91980.1|  Rab-GAP/TBC domain protein                              137   5e-33    
dbj|GAM28092.1|  hypothetical protein SAMD00019534_112680               137   5e-33    
gb|KFZ14516.1|  hypothetical protein V501_03215                         137   5e-33    
gb|KID79339.1|  Rab-GAP/TBC domain protein                              137   6e-33    
gb|KFZ52722.1|  TBC1 domain family member 15                            134   6e-33    
ref|XP_006121607.1|  PREDICTED: TBC1 domain family member 15 isof...    136   6e-33    
ref|XP_010176692.1|  PREDICTED: TBC1 domain family member 15            135   6e-33    
ref|XP_009484857.1|  PREDICTED: TBC1 domain family member 15            134   6e-33    
ref|XP_005514233.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    136   6e-33    
emb|CDM37395.1|  GTPase-activating protein GYP7                         137   6e-33    
gb|ESZ91462.1|  GTPase-activating protein GYP7                          137   7e-33    
ref|XP_009863167.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    135   7e-33    
ref|XP_005305158.1|  PREDICTED: TBC1 domain family member 15 isof...    136   7e-33    
gb|KFY52836.1|  hypothetical protein V496_08122                         137   7e-33    
ref|XP_006121608.1|  PREDICTED: TBC1 domain family member 15 isof...    136   7e-33    
gb|KGO74275.1|  protein of unknown function DUF3548                     137   7e-33    
gb|KFY33553.1|  hypothetical protein V494_07514                         137   8e-33    
gb|KFY18154.1|  hypothetical protein V491_04839                         137   8e-33    
ref|XP_009266617.1|  GTPase-activating protein gyp7                     138   8e-33    
ref|XP_008717453.1|  hypothetical protein HMPREF1541_04887              137   8e-33    
gb|EEH33536.2|  GTPase-activating protein GYP7                          137   8e-33    
emb|CCD56098.1|  hypothetical protein BofuT4_P152300.1                  137   8e-33    
ref|XP_010001382.1|  PREDICTED: TBC1 domain family member 15            136   8e-33    
ref|XP_003798993.1|  PREDICTED: TBC1 domain family member 15 isof...    135   8e-33    
ref|XP_010014050.1|  PREDICTED: TBC1 domain family member 15            135   8e-33    
gb|ETS03039.1|  putative GTPase activating protein                      136   9e-33    
ref|XP_006964672.1|  RasGAP protein                                     136   9e-33    
ref|XP_001550785.1|  hypothetical protein BC1G_10670                    130   9e-33    
ref|XP_003798994.1|  PREDICTED: TBC1 domain family member 15 isof...    135   9e-33    
gb|KIW75834.1|  hypothetical protein Z517_10579                         137   9e-33    
ref|XP_003840393.1|  similar to GTPase-activating protein gyp7          136   1e-32    
gb|KFQ50653.1|  TBC1 domain family member 15                            135   1e-32    
ref|XP_005851631.1|  hypothetical protein CHLNCDRAFT_138187             136   1e-32    
gb|KFP37050.1|  TBC1 domain family member 15                            135   1e-32    
gb|KFY03953.1|  hypothetical protein O988_01112                         137   1e-32    
ref|XP_010123979.1|  PREDICTED: TBC1 domain family member 15            135   1e-32    
gb|KGO62085.1|  protein of unknown function DUF3548                     136   1e-32    
gb|KGO49159.1|  protein of unknown function DUF3548                     136   1e-32    
ref|XP_004316834.1|  PREDICTED: TBC1 domain family member 15-like       131   1e-32    
ref|XP_636536.1|  RabGAP/TBC domain-containing protein                  136   1e-32    
gb|KIW57240.1|  hypothetical protein PV05_05817                         136   1e-32    
ref|XP_007918529.1|  putative gtpase-activating protein gyp7 protein    136   1e-32    
ref|NP_989223.1|  TBC1 domain family member 15                          135   1e-32    
gb|KFO58466.1|  TBC1 domain family member 15                            135   1e-32    
ref|XP_010706484.1|  PREDICTED: TBC1 domain family member 15            135   1e-32    
gb|AAH76966.1|  TBC1 domain family, member 15                           135   1e-32    
ref|XP_007664518.1|  PREDICTED: TBC1 domain family member 15            135   1e-32    
gb|EWG43354.1|  hypothetical protein FVEG_04864                         136   1e-32    
ref|XP_001396696.1|  GTPase-activating protein gyp7                     136   1e-32    
gb|KIX10380.1|  hypothetical protein Z518_01462                         136   1e-32    
gb|KFV67974.1|  TBC1 domain family member 15                            135   1e-32    
gb|KIW17270.1|  hypothetical protein PV08_04461                         136   2e-32    
ref|XP_008631121.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
ref|XP_009975733.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
gb|EWG43355.1|  hypothetical protein FVEG_04864                         136   2e-32    
ref|XP_007731781.1|  hypothetical protein A1O3_03453                    136   2e-32    
ref|XP_009899605.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
gb|KFV88938.1|  TBC1 domain family member 15                            135   2e-32    
ref|XP_009584974.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
gb|EXX64804.1|  Gyp7p                                                   134   2e-32    
gb|KFP76577.1|  TBC1 domain family member 15                            135   2e-32    
gb|KFP22081.1|  TBC1 domain family member 15                            135   2e-32    
gb|KFV12457.1|  TBC1 domain family member 15                            135   2e-32    
ref|XP_009946918.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
gb|EXX64805.1|  Gyp7p                                                   133   2e-32    
gb|KGL95544.1|  TBC1 domain family member 15                            135   2e-32    
gb|KEF61744.1|  hypothetical protein A1O9_03314                         136   2e-32    
ref|XP_010078295.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
ref|XP_009069186.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    135   2e-32    
ref|XP_010760538.1|  hypothetical protein PADG_11819                    135   2e-32    
ref|XP_009644606.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
ref|XP_010285040.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
gb|KFQ74636.1|  TBC1 domain family member 15                            135   2e-32    
ref|XP_005519422.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
ref|XP_010560090.1|  PREDICTED: TBC1 domain family member 15 isof...    134   2e-32    
gb|KFM03402.1|  TBC1 domain family member 15                            134   2e-32    
ref|XP_010131193.1|  PREDICTED: TBC1 domain family member 15            134   2e-32    
gb|AFR98261.1|  rab GTPase activator                                    135   2e-32    
dbj|GAA90625.1|  GTPase-activating protein Gyp7                         135   2e-32    
ref|XP_002190300.1|  PREDICTED: TBC1 domain family member 15            134   2e-32    
ref|XP_005143065.1|  PREDICTED: TBC1 domain family member 15            134   2e-32    
ref|XP_001224860.1|  hypothetical protein CHGG_07204                    135   2e-32    
ref|XP_009271513.1|  PREDICTED: TBC1 domain family member 15            134   2e-32    
gb|KHN95685.1|  Rab-GAP/TBC domain protein                              135   2e-32    
gb|EOA97812.1|  TBC1 domain family member 15                            134   2e-32    
ref|XP_005431957.1|  PREDICTED: TBC1 domain family member 15            134   2e-32    
ref|XP_005419335.1|  PREDICTED: TBC1 domain family member 15            135   2e-32    
gb|KFZ49120.1|  TBC1 domain family member 15                            134   2e-32    
gb|EIE80740.1|  hypothetical protein RO3G_05445                         132   2e-32    
ref|XP_009461518.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    135   2e-32    
gb|EEH22146.1|  hypothetical protein PABG_04357                         135   2e-32    
ref|XP_005104242.1|  PREDICTED: TBC1 domain family member 15-like...    134   2e-32    
gb|KIV85239.1|  hypothetical protein PV11_00962                         135   2e-32    
gb|KFQ85381.1|  TBC1 domain family member 15                            134   2e-32    
gb|KFV78597.1|  TBC1 domain family member 15                            134   2e-32    
gb|KFO87733.1|  TBC1 domain family member 15                            134   2e-32    
gb|KEQ65027.1|  RabGAP/TBC                                              135   2e-32    
ref|XP_006959912.1|  RabGAP/TBC                                         135   2e-32    
gb|KFH46971.1|  GTPase-activating protein-like protein                  135   2e-32    
ref|XP_005104241.1|  PREDICTED: TBC1 domain family member 15-like...    134   2e-32    
ref|XP_005024460.1|  PREDICTED: TBC1 domain family member 15            134   2e-32    
gb|KJB27076.1|  hypothetical protein B456_004G276400                    134   2e-32    
ref|XP_010412149.1|  PREDICTED: TBC1 domain family member 15            135   3e-32    
ref|XP_009667915.1|  PREDICTED: TBC1 domain family member 15            134   3e-32    
gb|KFR06581.1|  TBC1 domain family member 15                            134   3e-32    
gb|EPS28577.1|  hypothetical protein PDE_03523                          135   3e-32    
ref|XP_010178473.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    134   3e-32    
ref|XP_009886127.1|  PREDICTED: TBC1 domain family member 15            135   3e-32    
ref|XP_010560088.1|  PREDICTED: TBC1 domain family member 15 isof...    134   3e-32    
ref|XP_008938492.1|  PREDICTED: TBC1 domain family member 21            133   3e-32    
gb|KFQ10699.1|  TBC1 domain family member 15                            134   3e-32    
gb|EFW19039.1|  GTPase activating protein                               135   3e-32    
ref|XP_009504749.1|  PREDICTED: TBC1 domain family member 15            134   3e-32    
gb|KFQ18609.1|  TBC1 domain family member 15                            133   3e-32    
ref|XP_009325940.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    134   3e-32    
ref|XP_009962025.1|  PREDICTED: TBC1 domain family member 15            134   3e-32    
ref|XP_005242171.1|  PREDICTED: TBC1 domain family member 15            134   3e-32    
gb|KFV47134.1|  TBC1 domain family member 15                            134   3e-32    
ref|XP_009564626.1|  PREDICTED: TBC1 domain family member 15            134   3e-32    
ref|XP_003072101.1|  GTPase-activating protein GYP7, putative           135   3e-32    
gb|EAS27562.3|  GTPase activating protein                               135   3e-32    
tpe|CBF71108.1|  TPA: GTPase activating protein (Gyp7), putative ...    135   3e-32    
gb|KFX49045.1|  GTPase-activating protein GYP7                          135   3e-32    
ref|XP_002143396.1|  GTPase activating protein (Gyp7), putative         135   3e-32    
gb|KFP53694.1|  TBC1 domain family member 15                            134   3e-32    
ref|XP_004338737.1|  TBC domain containing protein                      132   4e-32    
gb|KEQ68644.1|  RabGAP/TBC                                              135   4e-32    
emb|CCU76618.1|  DUF3548 family protein similar to GTPase-activat...    135   4e-32    
ref|XP_002563791.1|  Pc20g13090                                         135   4e-32    
ref|XP_009925542.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    134   4e-32    
gb|EIT80559.1|  Ypt/Rab-specific GTPase-activating protein              134   4e-32    
gb|ERG82665.1|  tbc1 domain family member 15                            132   4e-32    
ref|XP_001934026.1|  GTPase-activating protein GYP7                     134   5e-32    
ref|XP_001823032.1|  GTPase-activating protein gyp7                     134   5e-32    
ref|XP_002378356.1|  GTPase activating protein (Gyp7), putative         134   5e-32    
ref|XP_007441051.1|  PREDICTED: TBC1 domain family member 15            134   5e-32    
ref|XP_006672355.1|  GTPase-activating protein GYP7                     134   5e-32    
gb|KGL84754.1|  TBC1 domain family member 15                            133   5e-32    



>gb|KDO80165.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=356

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  173  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  232

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  233  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  292

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI N LL+SQ++
Sbjct  293  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPIDNGLLYSQQE  352

Query  197  DDVM  186
            D+V+
Sbjct  353  DEVL  356



>gb|KDO80164.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=496

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  313  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  372

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  373  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  432

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI N LL+SQ++
Sbjct  433  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPIDNGLLYSQQE  492

Query  197  DDVM  186
            D+V+
Sbjct  493  DEVL  496



>gb|KDO80158.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=638

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  455  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  514

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  515  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  574

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI N LL+SQ++
Sbjct  575  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPIDNGLLYSQQE  634

Query  197  DDVM  186
            D+V+
Sbjct  635  DEVL  638



>gb|KDO80159.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=630

 Score =   321 bits (822),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  447  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  506

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  507  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  566

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI N LL+SQ++
Sbjct  567  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPIDNGLLYSQQE  626

Query  197  DDVM  186
            D+V+
Sbjct  627  DEVL  630



>ref|XP_006475896.1| PREDICTED: TBC1 domain family member 17-like [Citrus sinensis]
 gb|KDO80157.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=658

 Score =   322 bits (824),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  475  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  534

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  535  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  594

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI N LL+SQ++
Sbjct  595  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPIDNGLLYSQQE  654

Query  197  DDVM  186
            D+V+
Sbjct  655  DEVL  658



>gb|KDO80156.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=685

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  502  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  561

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  562  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  621

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI N LL+SQ++
Sbjct  622  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPIDNGLLYSQQE  681

Query  197  DDVM  186
            D+V+
Sbjct  682  DEVL  685



>ref|XP_006381119.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 ref|XP_006381120.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58916.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58917.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
Length=315

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  131  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDCPLHNYFKQNDC  190

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR KI+GE M
Sbjct  191  LNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGEHM  250

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQ  204
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP   +N LL++Q
Sbjct  251  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAAHIPPGTPPSLPTENENALLYAQ  310

Query  203  EDD  195
            +D+
Sbjct  311  DDE  313



>ref|XP_006450870.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
 gb|ESR64110.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
Length=658

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD   HNYFKQ DC
Sbjct  475  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPFHNYFKQNDC  534

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  535  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  594

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI N LL+SQ++
Sbjct  595  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPIDNGLLYSQQE  654

Query  197  DDVM  186
            D+V+
Sbjct  655  DEVL  658



>ref|XP_006401806.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43259.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=681

 Score =   319 bits (818),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  499  ILFVMGDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKQNDC  558

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR RSKI+GE+M
Sbjct  559  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRCRSKIMGEQM  618

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+   +L+ Q+D
Sbjct  619  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDEGILYPQDD  678

Query  197  D  195
            D
Sbjct  679  D  679



>gb|KHN22122.1| TBC1 domain family member 15 [Glycine soja]
Length=656

 Score =   319 bits (817),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  472  ILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  531

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRYR KIIGE+M
Sbjct  532  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRYRGKIIGEEM  591

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTPPSLP+++   ++Q++
Sbjct  592  DFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTPPSLPVEDGSFYAQQE  651

Query  197  DD  192
             D
Sbjct  652  QD  653



>ref|XP_006401805.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43258.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=675

 Score =   319 bits (818),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  493  ILFVMGDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKQNDC  552

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR RSKI+GE+M
Sbjct  553  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRCRSKIMGEQM  612

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+   +L+ Q+D
Sbjct  613  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDEGILYPQDD  672

Query  197  D  195
            D
Sbjct  673  D  673



>ref|XP_003542634.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
Length=656

 Score =   318 bits (816),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  472  ILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  531

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRYR KIIGE+M
Sbjct  532  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRYRGKIIGEEM  591

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTPPSLP+++   ++Q++
Sbjct  592  DFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTPPSLPVEDGSFYAQQE  651

Query  197  DD  192
             D
Sbjct  652  QD  653



>ref|XP_007155039.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
 gb|ESW27033.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
Length=652

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  470  ILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  529

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLY+CVAILKRYR KI+GE M
Sbjct  530  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYLCVAILKRYRGKIVGEGM  589

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLPI +  +++Q+D
Sbjct  590  DFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTPPSLPIDDGSVYAQQD  649

Query  197  D  195
            +
Sbjct  650  E  650



>ref|XP_004508468.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Cicer 
arietinum]
Length=705

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+V+ DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVE+LD  LHNYFKQ+DC
Sbjct  522  ILFVIDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVEMLDSPLHNYFKQRDC  581

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFEFEKTLRLWEVLWT + +EHLHLYVCVA+LKR+RSKI+GE+M
Sbjct  582  LNYFFCFRWILIQFKREFEFEKTLRLWEVLWTHYPSEHLHLYVCVAVLKRFRSKIMGEEM  641

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFD+LL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLP+ +   + Q+D
Sbjct  642  DFDSLLKFINELSGHIDLDATLRDAEALCICAGEEGAARIPPGTPPSLPVDDGSFYIQQD  701

Query  197  DDVM  186
            D+V+
Sbjct  702  DEVL  705



>ref|XP_002285365.1| PREDICTED: TBC1 domain family member 17 isoform X3 [Vitis vinifera]
Length=657

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  LHNYFKQ DC
Sbjct  475  ILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPLHNYFKQNDC  534

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  535  LNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  594

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI + LL  Q+D
Sbjct  595  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPIDSGLLCPQQD  654

Query  197  D  195
            D
Sbjct  655  D  655



>emb|CDY65323.1| BnaC02g44880D [Brassica napus]
Length=672

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  490  ILFVMEDESEAFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKQNDC  549

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR RS I+GE+M
Sbjct  550  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRCRSTIMGEQM  609

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ + +++S ED
Sbjct  610  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDDGIVYSLED  669

Query  197  D  195
            D
Sbjct  670  D  670



>ref|XP_010557604.1| PREDICTED: TBC1 domain family member 15 [Tarenaya hassleriana]
Length=669

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYF Q DC
Sbjct  487  ILFVMEDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFSQNDC  546

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+ KT+RLWEVLWT +L+EHLHLYVCVAILKRYR KIIGE+M
Sbjct  547  LNYFFCFRWILIQFKREFEYGKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRRKIIGEQM  606

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLP+ + +L+ Q+D
Sbjct  607  DFDTLLKFINELSGHIDLDSVLRDAEALCICAGENGAASIPPGTPPSLPVDDGMLYPQQD  666

Query  197  D  195
            +
Sbjct  667  E  667



>ref|XP_006280129.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
 gb|EOA13027.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
Length=672

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  490  ILYVMENESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPLHNYFKQNDC  549

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWT + +EHLHLYVCVAILKR RSKI+GE+M
Sbjct  550  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYHSEHLHLYVCVAILKRCRSKIMGEQM  609

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDLE+T+RDAEALC+CAGE GAA IPPGTPPSLP+ +++L+  ED
Sbjct  610  DFDTLLKFINELSGHIDLESTVRDAEALCICAGENGAASIPPGTPPSLPLDDIMLYPLED  669

Query  197  D  195
            D
Sbjct  670  D  670



>ref|XP_007013521.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY31140.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
Length=656

 Score =   317 bits (811),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  474  ILFVMEEESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKQNDC  533

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVA+LKRYR KI+GE+M
Sbjct  534  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAVLKRYRGKIMGEQM  593

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP+ N L +SQ+D
Sbjct  594  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSLPVDNGLFYSQQD  653

Query  197  D  195
            +
Sbjct  654  E  654



>ref|XP_003549744.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
 gb|KHN15067.1| TBC1 domain family member 15 [Glycine soja]
Length=655

 Score =   317 bits (811),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM +ESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  471  ILFVMDNESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  530

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRYR KIIGE+M
Sbjct  531  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRYRGKIIGEQM  590

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLP ++   ++Q++
Sbjct  591  DFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTPPSLPHEDGSFYAQQE  650

Query  197  DD  192
             D
Sbjct  651  QD  652



>ref|XP_009624893.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis]
Length=649

 Score =   316 bits (810),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQKDC
Sbjct  465  ILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQKDC  524

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEFEKT+RLWEVLWT + +EHLHLYVCVAILKRYRSKII E+M
Sbjct  525  LNYFFCFRWVLIQFKREFEFEKTMRLWEVLWTHYRSEHLHLYVCVAILKRYRSKIIREEM  584

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ +  ++ Q+D
Sbjct  585  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPLDDASMYYQQD  644

Query  197  DD  192
            DD
Sbjct  645  DD  646



>dbj|BAA98077.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42472.1| unknown protein [Arabidopsis thaliana]
 gb|ABH11525.1| rabGAP [Arabidopsis thaliana]
Length=338

 Score =   306 bits (785),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  156  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKENDC  215

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR RSKI+GE+M
Sbjct  216  LNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRCRSKIMGEQM  275

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+ +  L+ QED
Sbjct  276  DFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLDDGTLYPQED  335

Query  197  D  195
            D
Sbjct  336  D  336



>ref|XP_009758337.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana sylvestris]
Length=649

 Score =   316 bits (810),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQKDC
Sbjct  465  ILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQKDC  524

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEFEKT+RLWEVLWT + +EHLHLYVCVAILKRYRSKII E+M
Sbjct  525  LNYFFCFRWVLIQFKREFEFEKTMRLWEVLWTHYRSEHLHLYVCVAILKRYRSKIIREEM  584

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ +  ++ Q+D
Sbjct  585  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPLDDASMYYQQD  644

Query  197  DD  192
            DD
Sbjct  645  DD  646



>ref|XP_010656459.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Vitis vinifera]
 emb|CBI28236.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  LHNYFKQ DC
Sbjct  502  ILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPLHNYFKQNDC  561

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  562  LNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  621

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI + LL  Q+D
Sbjct  622  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPIDSGLLCPQQD  681

Query  197  D  195
            D
Sbjct  682  D  682



>ref|XP_002864184.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40443.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
Length=674

 Score =   317 bits (811),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  492  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPLHNYFKQNDC  551

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR RSKI+GE+M
Sbjct  552  LNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRCRSKIMGEQM  611

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ +  L+ QED
Sbjct  612  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDDGTLYPQED  671

Query  197  D  195
            D
Sbjct  672  D  672



>ref|XP_010656458.1| PREDICTED: GTPase-activating protein GYP7 isoform X1 [Vitis vinifera]
Length=696

 Score =   317 bits (813),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  LHNYFKQ DC
Sbjct  514  ILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPLHNYFKQNDC  573

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  574  LNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  633

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI + LL  Q+D
Sbjct  634  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPIDSGLLCPQQD  693

Query  197  D  195
            D
Sbjct  694  D  694



>emb|CDY27056.1| BnaA02g10760D [Brassica napus]
Length=672

 Score =   317 bits (811),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  490  ILFVMEDESEAFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKQNDC  549

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWTQ+LTEH HLYVCVAILKR RS IIGE+M
Sbjct  550  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHFHLYVCVAILKRCRSTIIGEQM  609

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ + +++S +D
Sbjct  610  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDDGIVYSLDD  669

Query  197  D  195
            D
Sbjct  670  D  670



>ref|XP_006372159.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|ERP49956.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=630

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 167/186 (90%), Gaps = 2/186 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALM RLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  445  ILFVMEDESEAFWCFVALMARLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQNDC  504

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE M
Sbjct  505  LNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEHM  564

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQ  204
            DFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI  +N LL++Q
Sbjct  565  DFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIENENALLYTQ  624

Query  203  EDDDVM  186
            E+D+V+
Sbjct  625  EEDEVL  630



>ref|XP_009127224.1| PREDICTED: TBC1 domain family member 15 [Brassica rapa]
Length=672

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  490  ILFVMEDESEAFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKQNDC  549

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR RS I+GE+M
Sbjct  550  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRCRSTIMGEQM  609

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ + +++S +D
Sbjct  610  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDDGIVYSLDD  669

Query  197  D  195
            D
Sbjct  670  D  670



>ref|XP_002324638.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|EEF03203.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=661

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 167/186 (90%), Gaps = 2/186 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALM RLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  476  ILFVMEDESEAFWCFVALMARLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQNDC  535

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE M
Sbjct  536  LNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEHM  595

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQ  204
            DFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI  +N LL++Q
Sbjct  596  DFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIENENALLYTQ  655

Query  203  EDDDVM  186
            E+D+V+
Sbjct  656  EEDEVL  661



>ref|XP_010482625.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  496  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKENDC  555

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR RSKI+GE+M
Sbjct  556  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRCRSKIMGEQM  615

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+  ++L+  ED
Sbjct  616  DFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLDEVMLYPLED  675

Query  197  D  195
            D
Sbjct  676  D  676



>ref|XP_010482627.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Camelina 
sativa]
Length=679

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  497  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKENDC  556

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR RSKI+GE+M
Sbjct  557  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRCRSKIMGEQM  616

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+  ++L+  ED
Sbjct  617  DFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLDEVMLYPLED  676

Query  197  D  195
            D
Sbjct  677  D  677



>ref|XP_010482626.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  490  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKENDC  549

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR RSKI+GE+M
Sbjct  550  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRCRSKIMGEQM  609

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+  ++L+  ED
Sbjct  610  DFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLDEVMLYPLED  669

Query  197  D  195
            D
Sbjct  670  D  670



>ref|XP_010442797.1| PREDICTED: TBC1 domain family member 15-like [Camelina sativa]
Length=672

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  490  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKENDC  549

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR RSKI+GE+M
Sbjct  550  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRCRSKIMGEQM  609

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+  ++L+  ED
Sbjct  610  DFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLDEVMLYPLED  669

Query  197  D  195
            D
Sbjct  670  D  670



>gb|KCW80045.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=527

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  345  ILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDLPLHNYFKQNDC  404

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EK + LWEV WT HL+EHLHLYVCV+ILKRYR KI+GE+M
Sbjct  405  LNYFFCFRWLLIQFKREFEYEKVMSLWEVFWTHHLSEHLHLYVCVSILKRYRKKIMGEQM  464

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTPPSLPI++ LL+ Q+D
Sbjct  465  DFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTPPSLPIESSLLYPQQD  524

Query  197  D  195
            D
Sbjct  525  D  525



>ref|XP_010445073.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  490  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKENDC  549

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+ LWEVLWT +L+EHLHLYVCVAILKR RSKI+GE+M
Sbjct  550  LNYFFCFRWILIQFKREFEYEKTMELWEVLWTHYLSEHLHLYVCVAILKRCRSKIMGEQM  609

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+  ++L+  ED
Sbjct  610  DFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLDEVMLYPLED  669

Query  197  D  195
            D
Sbjct  670  D  670



>gb|KJB54007.1| hypothetical protein B456_009G016100 [Gossypium raimondii]
Length=657

 Score =   314 bits (805),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQKDC
Sbjct  473  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDAPLHNYFKQKDC  532

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWIL+QFKRE E+++T+RLWEVLWT HL+EHLHLYVCVA+LKRYR KIIGE+M
Sbjct  533  LNYFICFRWILLQFKRELEYDQTMRLWEVLWTHHLSEHLHLYVCVALLKRYRGKIIGEQM  592

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            +FDTLL+FINEL GHID++ TLRDAEALCLCAGE G+A IPPGTPPSLP ++  LF+ E 
Sbjct  593  EFDTLLKFINELSGHIDIDVTLRDAEALCLCAGENGSACIPPGTPPSLPREDGFLFNSEL  652

Query  197  DDVM  186
            DD +
Sbjct  653  DDTV  656



>ref|XP_003609386.1| TBC1 domain family member [Medicago truncatula]
 gb|AES91583.1| RabGAP/TBC domain protein [Medicago truncatula]
Length=666

 Score =   314 bits (805),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  483  ILFVMEDESEAFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  542

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVA+LKR R KIIGE+M
Sbjct  543  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAVLKRCRGKIIGEEM  602

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFD+LL+FINEL GHIDL+ TLRDAEAL +CAGE GAARIPPGTPPSLP+ +   + Q+D
Sbjct  603  DFDSLLKFINELSGHIDLDATLRDAEALSICAGEEGAARIPPGTPPSLPVDDGSFYYQQD  662

Query  197  DDVM  186
            D+V+
Sbjct  663  DEVL  666



>ref|XP_007013520.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY31139.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
Length=743

 Score =   316 bits (810),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  561  ILFVMEEESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKQNDC  620

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVA+LKRYR KI+GE+M
Sbjct  621  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAVLKRYRGKIMGEQM  680

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP+ N L +SQ+D
Sbjct  681  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSLPVDNGLFYSQQD  740

Query  197  D  195
            +
Sbjct  741  E  741



>gb|AIU48656.1| RabGAP/TBC domain-containing protein, partial [Glycine max]
Length=625

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  449  ILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  508

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRYR KIIGE+M
Sbjct  509  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRYRGKIIGEEM  568

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTPPSLP+++ 
Sbjct  569  DFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTPPSLPVESF  621



>ref|XP_010445069.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  496  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKENDC  555

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+ LWEVLWT +L+EHLHLYVCVAILKR RSKI+GE+M
Sbjct  556  LNYFFCFRWILIQFKREFEYEKTMELWEVLWTHYLSEHLHLYVCVAILKRCRSKIMGEQM  615

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+  ++L+  ED
Sbjct  616  DFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLDEVMLYPLED  675

Query  197  D  195
            D
Sbjct  676  D  676



>ref|XP_011017820.1| PREDICTED: TBC1 domain family member 17-like isoform X3 [Populus 
euphratica]
Length=637

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 166/186 (89%), Gaps = 2/186 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSK VELLD  LHNYFKQ DC
Sbjct  452  ILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKRVELLDSPLHNYFKQNDC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            L+Y  CFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE M
Sbjct  512  LSYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEHM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQ  204
            DFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTPPSLP   +N LL++Q
Sbjct  572  DFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTPPSLPTENENALLYTQ  631

Query  203  EDDDVM  186
            E+D+V+
Sbjct  632  EEDEVL  637



>gb|AIU48673.1| RabGAP/TBC domain-containing protein, partial [Phaseolus vulgaris]
Length=623

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  447  ILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  506

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLY+CVAILKRYR KI+GE M
Sbjct  507  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYLCVAILKRYRGKIVGEGM  566

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLPI ++
Sbjct  567  DFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTPPSLPIDSV  619



>ref|XP_010241556.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nelumbo nucifera]
Length=673

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 164/183 (90%), Gaps = 1/183 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQKDC
Sbjct  491  ILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQKDC  550

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EK + LWEVLWT +L+EHLHLYVCVAILKRYR KI+G++M
Sbjct  551  LNYFFCFRWVLIQFKREFEYEKIMLLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGDQM  610

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL-LLFSQE  201
            DFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTPPSLPI++   L+ Q+
Sbjct  611  DFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTPPSLPIEDTGSLYPQQ  670

Query  200  DDD  192
            DDD
Sbjct  671  DDD  673



>ref|XP_010047970.1| PREDICTED: TBC1 domain family member 15 [Eucalyptus grandis]
 gb|KCW80044.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=654

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  472  ILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDLPLHNYFKQNDC  531

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EK + LWEV WT HL+EHLHLYVCV+ILKRYR KI+GE+M
Sbjct  532  LNYFFCFRWLLIQFKREFEYEKVMSLWEVFWTHHLSEHLHLYVCVSILKRYRKKIMGEQM  591

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTPPSLPI++ LL+ Q+D
Sbjct  592  DFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTPPSLPIESSLLYPQQD  651

Query  197  D  195
            D
Sbjct  652  D  652



>ref|XP_010241554.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nelumbo nucifera]
Length=707

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 164/183 (90%), Gaps = 1/183 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQKDC
Sbjct  525  ILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQKDC  584

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EK + LWEVLWT +L+EHLHLYVCVAILKRYR KI+G++M
Sbjct  585  LNYFFCFRWVLIQFKREFEYEKIMLLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGDQM  644

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL-LLFSQE  201
            DFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTPPSLPI++   L+ Q+
Sbjct  645  DFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTPPSLPIEDTGSLYPQQ  704

Query  200  DDD  192
            DDD
Sbjct  705  DDD  707



>ref|XP_010241555.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nelumbo nucifera]
Length=700

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 164/183 (90%), Gaps = 1/183 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQKDC
Sbjct  518  ILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQKDC  577

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EK + LWEVLWT +L+EHLHLYVCVAILKRYR KI+G++M
Sbjct  578  LNYFFCFRWVLIQFKREFEYEKIMLLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGDQM  637

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL-LLFSQE  201
            DFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTPPSLPI++   L+ Q+
Sbjct  638  DFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTPPSLPIEDTGSLYPQQ  697

Query  200  DDD  192
            DDD
Sbjct  698  DDD  700



>ref|XP_008362894.1| PREDICTED: TBC1 domain family member 17-like [Malus domestica]
Length=659

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFV+LMERLGPNF  DQ+GM++QLFA++KLVELLD  LHN+F QKDC
Sbjct  475  ILYVMEDESESFWCFVSLMERLGPNFNRDQSGMHSQLFAITKLVELLDAPLHNHFTQKDC  534

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF+KT+RLWEVLWT + +EHLHLYVCVAILKR+RSKIIGE+M
Sbjct  535  LNYFFCFRWVLIQFKREFEFDKTMRLWEVLWTHYPSEHLHLYVCVAILKRHRSKIIGEQM  594

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFS-QE  201
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ ++LL+  QE
Sbjct  595  DFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAASIPPGTPPSLPVDDVLLYPXQE  654

Query  200  DDDVM  186
             DD++
Sbjct  655  LDDIL  659



>ref|XP_010323291.1| PREDICTED: GTPase-activating protein gyp7 [Solanum lycopersicum]
Length=678

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DES+SFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  LHNYF+QKDC
Sbjct  494  ILYVMGDESQSFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPLHNYFQQKDC  553

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF+FEKT+RLWEVLWT +L+EHLHLYVCVAIL+R+RSKIIGE+M
Sbjct  554  LNYFFCFRWVLIQFKREFDFEKTMRLWEVLWTHYLSEHLHLYVCVAILRRHRSKIIGEEM  613

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHI+L+ TLR+AEALC+CAGE G A IPPGTPPSLP +   +++Q+D
Sbjct  614  DFDTLLKFINELSGHINLDATLREAEALCICAGENGEACIPPGTPPSLPFEITSMYNQQD  673

Query  197  DD  192
            DD
Sbjct  674  DD  675



>ref|XP_011017818.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Populus 
euphratica]
Length=661

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 166/186 (89%), Gaps = 2/186 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSK VELLD  LHNYFKQ DC
Sbjct  476  ILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKRVELLDSPLHNYFKQNDC  535

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            L+Y  CFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE M
Sbjct  536  LSYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEHM  595

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQ  204
            DFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTPPSLP   +N LL++Q
Sbjct  596  DFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTPPSLPTENENALLYTQ  655

Query  203  EDDDVM  186
            E+D+V+
Sbjct  656  EEDEVL  661



>ref|XP_011017816.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011017817.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
Length=676

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 166/186 (89%), Gaps = 2/186 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSK VELLD  LHNYFKQ DC
Sbjct  491  ILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKRVELLDSPLHNYFKQNDC  550

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            L+Y  CFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE M
Sbjct  551  LSYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEHM  610

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQ  204
            DFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTPPSLP   +N LL++Q
Sbjct  611  DFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTPPSLPTENENALLYTQ  670

Query  203  EDDDVM  186
            E+D+V+
Sbjct  671  EEDEVL  676



>ref|XP_011084120.1| PREDICTED: TBC1 domain family member 15 [Sesamum indicum]
Length=654

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVMRDESESFWCFV+LMERLGPNF  DQ+GM+TQLFALSKLVELLD  LH+YF++ DC
Sbjct  471  ILYVMRDESESFWCFVSLMERLGPNFNRDQSGMHTQLFALSKLVELLDKPLHHYFERNDC  530

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEV+WT HL+EHLHLYVCVAILKR+RSKI+GE+M
Sbjct  531  LNYFFCFRWILIQFKREFEYEKTMRLWEVMWTHHLSEHLHLYVCVAILKRHRSKIMGEQM  590

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+ TLR+AEALC+CAGE G A IPPGTPPSLPI++ L++ Q +
Sbjct  591  DFDTLLKFINELSGQIELDATLREAEALCICAGENGEACIPPGTPPSLPIEDGLVYPQLE  650

Query  197  DDVM  186
            DD++
Sbjct  651  DDIL  654



>ref|XP_009363991.1| PREDICTED: TBC1 domain family member 15 [Pyrus x bretschneideri]
Length=658

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 167/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFV+LMERLGPNF  DQ+GM++QLFA++KLVELLD  LHN+F QKDC
Sbjct  474  ILYVMEDESESFWCFVSLMERLGPNFNRDQSGMHSQLFAVTKLVELLDVPLHNHFTQKDC  533

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF+KTLRLWE+LWT + +EHLHLYVCVAILKR+RSKIIGE+M
Sbjct  534  LNYFFCFRWVLIQFKREFEFDKTLRLWEILWTHYPSEHLHLYVCVAILKRHRSKIIGEQM  593

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ ++LL+ Q++
Sbjct  594  DFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAASIPPGTPPSLPVDDVLLYPQQE  653

Query  197  -DDVM  186
             DD++
Sbjct  654  LDDIL  658



>ref|NP_200071.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96237.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=673

 Score =   311 bits (798),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  491  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKENDC  550

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR RSKI+GE+M
Sbjct  551  LNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRCRSKIMGEQM  610

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+ +  L+ QED
Sbjct  611  DFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLDDGTLYPQED  670

Query  197  D  195
            D
Sbjct  671  D  671



>ref|XP_006358298.1| PREDICTED: GTPase-activating protein gyp7-like [Solanum tuberosum]
Length=678

 Score =   312 bits (799),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DE +SFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  LHNYF+QKDC
Sbjct  494  ILYVMGDEPQSFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPLHNYFQQKDC  553

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF+FEKT+RLWEVLWT +L+EHLHLYVCVAIL+R+RSKIIGE+M
Sbjct  554  LNYFFCFRWVLIQFKREFDFEKTMRLWEVLWTHYLSEHLHLYVCVAILRRHRSKIIGEEM  613

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE G A IPPGTPPSLP +   +++Q+D
Sbjct  614  DFDTLLKFINELSGHINLDATLRDAEALCICAGENGEACIPPGTPPSLPFEITSMYNQQD  673

Query  197  DD  192
            DD
Sbjct  674  DD  675



>emb|CDP10442.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   312 bits (799),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 165/190 (87%), Gaps = 6/190 (3%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DESESFWCFV+LM+RLGPNF  DQNGM++QLFALSKLVE+LD  LHNYF Q DC
Sbjct  503  ILFVMKDESESFWCFVSLMDRLGPNFNRDQNGMHSQLFALSKLVEILDSPLHNYFNQNDC  562

Query  557  LNYLXCFRWILIQFKR------EFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSK  396
            LNY  CFRWILIQFKR      E E+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYRSK
Sbjct  563  LNYFFCFRWILIQFKRQVRLFLELEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRSK  622

Query  395  IIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLL  216
            I+GE+MDFDTLL+FINEL GHIDL+  LRDAEALCLCAGE GAA IPPGTPPSLP++   
Sbjct  623  IMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCLCAGENGAACIPPGTPPSLPVEEAS  682

Query  215  LFSQEDDDVM  186
            ++ Q+DDD++
Sbjct  683  MYPQQDDDIL  692



>gb|AIU48680.1| RabGAP/TBC domain-containing protein, partial [Schrenkiella parvula]
Length=628

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  452  ILFVMGDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKQNDC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR RSKI+GE+M
Sbjct  512  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRCRSKIMGEQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+
Sbjct  572  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPL  621



>ref|XP_004251725.1| PREDICTED: TBC1 domain family member 17-like [Solanum lycopersicum]
Length=656

 Score =   311 bits (796),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL++M DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQKDC
Sbjct  471  ILFIMGDESETFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPLHNYFKQKDC  530

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEFE+T+RLWEVLWT + +EHLHLYVCVAILKR+RSKIIGE M
Sbjct  531  LNYFFCFRWVLIQFKREFEFEQTMRLWEVLWTHYGSEHLHLYVCVAILKRHRSKIIGEGM  590

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ +  ++ Q+D
Sbjct  591  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPVDDASMYYQQD  650

Query  197  DD  192
            DD
Sbjct  651  DD  652



>ref|NP_001190524.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96238.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=690

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  508  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKENDC  567

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR RSKI+GE+M
Sbjct  568  LNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRCRSKIMGEQM  627

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+ +  L+ QED
Sbjct  628  DFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLDDGTLYPQED  687

Query  197  D  195
            D
Sbjct  688  D  688



>gb|KFK26862.1| hypothetical protein AALP_AA8G303600 [Arabis alpina]
Length=675

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  493  ILFVMKDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDLPLHNYFKQNDC  552

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+ LWEVLWT +L+EHLHLYVCVAILKR RSKI+G++M
Sbjct  553  LNYFFCFRWILIQFKREFEYEKTMLLWEVLWTHYLSEHLHLYVCVAILKRCRSKIMGDQM  612

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+   +L+  +D
Sbjct  613  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDEEILYPLDD  672

Query  197  D  195
            D
Sbjct  673  D  673



>gb|EYU18249.1| hypothetical protein MIMGU_mgv1a002604mg [Erythranthe guttata]
Length=655

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVMRDES+SFWCFV+LMERLGPNF  DQ+GM++QLFALSKLVELLD  LH+YFKQ DC
Sbjct  472  ILYVMRDESKSFWCFVSLMERLGPNFNRDQSGMHSQLFALSKLVELLDLPLHDYFKQNDC  531

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE++KTL LWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  532  LNYFFCFRWILIQFKREFEYDKTLLLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  591

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLR+AEALC+CAGE G A IPPGTPPSLP+++  ++ Q D
Sbjct  592  DFDTLLKFINELSGQIDLDATLREAEALCICAGENGEASIPPGTPPSLPLEDASVYPQLD  651

Query  197  DDVM  186
            DDV+
Sbjct  652  DDVL  655



>ref|XP_006345222.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum]
Length=656

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYF+QKDC
Sbjct  472  ILFVMGDESETFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPLHNYFEQKDC  531

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEFE+T+RLWEVLWT + +EHLHLYVCVAILKR+RSKIIGE M
Sbjct  532  LNYFFCFRWVLIQFKREFEFEQTMRLWEVLWTHYGSEHLHLYVCVAILKRHRSKIIGEGM  591

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ +  ++ Q+D
Sbjct  592  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPVDDASMYYQQD  651

Query  197  DD  192
            DD
Sbjct  652  DD  653



>gb|AIU48681.1| RabGAP/TBC domain-containing protein, partial [Vitis vinifera]
Length=629

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  LHNYFKQ DC
Sbjct  453  ILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPLHNYFKQNDC  512

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  513  LNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  572

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI
Sbjct  573  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPI  622



>ref|XP_002527173.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35186.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLDG LHNYFKQ DC
Sbjct  461  ILFVMEDESKSFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDGPLHNYFKQNDC  520

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHL+ CV+ILKRYR+KI+GE+M
Sbjct  521  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLFACVSILKRYRNKIMGEQM  580

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL--LLFSQ  204
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++N   LL++Q
Sbjct  581  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACIPPGTPPSLPLENENGLLYAQ  640

Query  203  EDD  195
            +D+
Sbjct  641  QDE  643



>ref|XP_011020167.1| PREDICTED: TBC1 domain family member 15 [Populus euphratica]
Length=660

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  476  ILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKLVELLDCPLHNYFKQNDC  535

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  C RW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR KI+GE M
Sbjct  536  LNYFFCLRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGEHM  595

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQ  204
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAARIPPGTPPSLP   +N LL++Q
Sbjct  596  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAARIPPGTPPSLPTENENALLYAQ  655

Query  203  EDD  195
            +D+
Sbjct  656  DDE  658



>gb|AIU48654.1| RabGAP/TBC domain-containing protein, partial [Citrus sinensis]
Length=629

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  453  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  512

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  513  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  572

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI   LL+S++
Sbjct  573  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID--LLYSED  629



>gb|AIU48653.1| RabGAP/TBC domain-containing protein, partial [Capsella rubella]
Length=626

 Score =   307 bits (787),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  450  ILYVMENESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPLHNYFKQNDC  509

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEVLWT + +EHLHLYVCVAILKR RSKI+GE+M
Sbjct  510  LNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYHSEHLHLYVCVAILKRCRSKIMGEQM  569

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL GHIDLE+T+RDAEALC+CAGE GAA IPPGTPPSLP+  L
Sbjct  570  DFDTLLKFINELSGHIDLESTVRDAEALCICAGENGAASIPPGTPPSLPLDML  622



>gb|AIU48640.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis lyrata]
Length=627

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  451  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPLHNYFKQNDC  510

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR RSKI+GE+M
Sbjct  511  LNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRCRSKIMGEQM  570

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+  L
Sbjct  571  DFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLDTL  623



>gb|AIU48647.1| RabGAP/TBC domain-containing protein, partial [Theobroma cacao]
Length=603

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFKQ DC
Sbjct  427  ILFVMEEESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPLHNYFKQNDC  486

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVA+LKRYR KI+GE+M
Sbjct  487  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAVLKRYRGKIMGEQM  546

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP+   L +S E
Sbjct  547  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSLPVD--LFYSDE  603



>gb|AIU48650.1| RabGAP/TBC domain-containing protein, partial [Citrus clementina]
Length=629

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD   HNYFKQ DC
Sbjct  453  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPFHNYFKQNDC  512

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  513  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  572

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI   LL+S++
Sbjct  573  DFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID--LLYSED  629



>gb|AIU48658.1| RabGAP/TBC domain-containing protein, partial [Buxus sinica]
Length=629

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYF Q DC
Sbjct  453  ILFVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPLHNYFNQNDC  512

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRYR KI+GE+M
Sbjct  513  LNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGEQM  572

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLL  213
            DFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPS+PI+ L L
Sbjct  573  DFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSMPIELLYL  627



>gb|KJB64719.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=653

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LH YF+Q DC
Sbjct  470  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDRPLHKYFEQNDC  529

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKRE E+E+T+RLWEVLWT +L+EHLHLYVCVAILKRYR KI+GE+M
Sbjct  530  LNYFFCFRWILIQFKRELEYEQTMRLWEVLWTHYLSEHLHLYVCVAILKRYRGKIMGEQM  589

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGT PSLP+ N L +SQ+D
Sbjct  590  DFDTLLKFINELSGQIELDAILRDAEALCICAGENGAACIPPGTVPSLPVDNGLFYSQQD  649

Query  197  DDVM  186
            D+V+
Sbjct  650  DEVL  653



>ref|XP_009593351.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DE ESFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  LH+YFKQKDC
Sbjct  379  ILYVMEDEPESFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPLHDYFKQKDC  438

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RYRSKIIGE+M
Sbjct  439  LNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRYRSKIIGEEM  498

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IPPGTPPS P +   ++ Q+D
Sbjct  499  DFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIPPGTPPSFPFEGTSMYYQQD  558

Query  197  DD  192
            DD
Sbjct  559  DD  560



>gb|AIU48670.1| RabGAP/TBC domain-containing protein, partial [Populus trichocarpa]
Length=627

 Score =   305 bits (781),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFVALM RLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  451  ILFVMEDESEAFWCFVALMARLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQNDC  510

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE M
Sbjct  511  LNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEHM  570

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI+  LL++++
Sbjct  571  DFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIE--LLYTED  627



>ref|XP_004173869.1| PREDICTED: TBC1 domain family member 15-like, partial [Cucumis 
sativus]
Length=191

 Score =   291 bits (744),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQ GM+ QLFA+SKLVELLD  LHNYF Q DC
Sbjct  9    ILFVMGDESESFWCFVALMERLGPNFNRDQTGMHCQLFAISKLVELLDTPLHNYFSQHDC  68

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF +EK + LWEVLWT + +EHLHLY+CVA+LKRYR+KI+GE+M
Sbjct  69   LNYFFCFRWVLIQFKREFAYEKVMHLWEVLWTHYPSEHLHLYICVAVLKRYRNKIMGEQM  128

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ +   + Q+D
Sbjct  129  DFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTPPSLPLDDGSYYIQQD  188

Query  197  D  195
            +
Sbjct  189  E  189



>gb|AIU48666.1| RabGAP/TBC domain-containing protein, partial [Medicago truncatula]
Length=626

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ+DC
Sbjct  450  ILFVMEDESEAFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQRDC  509

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVA+LKR R KIIGE+M
Sbjct  510  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAVLKRCRGKIIGEEM  569

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFD+LL+FINEL GHIDL+ TLRDAEAL +CAGE GAARIPPGTPPSLP+ + 
Sbjct  570  DFDSLLKFINELSGHIDLDATLRDAEALSICAGEEGAARIPPGTPPSLPVDSF  622



>gb|AIU48682.1| RabGAP/TBC domain-containing protein, partial [Lactuca sativa]
Length=351

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL++M+DESE+FWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  175  ILFIMQDESEAFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFKQNDC  234

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE++KTLRLWEVLWT +L+EHLHLYVC+AILKR+R KI+GE+M
Sbjct  235  LNYFFCFRWILIQFKREFEYDKTLRLWEVLWTHYLSEHLHLYVCIAILKRHRGKIMGEEM  294

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGTPP+LPI ++
Sbjct  295  DFDTLLKFINELSGQIELDPVLRDAEALCVCAGENGAASIPPGTPPALPIPSI  347



>gb|AIU48675.1| RabGAP/TBC domain-containing protein, partial [Ricinus communis]
Length=610

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLDG LHNYFKQ DC
Sbjct  434  ILFVMEDESKSFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDGPLHNYFKQNDC  493

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHL+ CV+ILKRYR+KI+GE+M
Sbjct  494  LNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLFACVSILKRYRNKIMGEQM  553

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++  LL++ E
Sbjct  554  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACIPPGTPPSLPLE--LLYADE  610



>ref|XP_010911930.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Elaeis guineensis]
Length=532

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  LHNY KQ DC
Sbjct  349  ILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPLHNYLKQADC  408

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVAILKRYR KI+GE+M
Sbjct  409  LNYFFCFRWILIQFKREFEYLKVMHLWEVLWTHYLSEHFHLYMCVAILKRYRKKIMGEQM  468

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+ T+RDAEALC CAGE G A IPPGTPPSLP++  +    +D
Sbjct  469  DFDTLLKFINELSGHIDLDGTIRDAEALCACAGENGTACIPPGTPPSLPVETDMGLYPQD  528

Query  197  DDVM  186
            DDV+
Sbjct  529  DDVL  532



>ref|XP_009789610.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Nicotiana 
sylvestris]
Length=563

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM +E ESFWCFV LMERLGPNF  DQNG+++QLFALSKLVELLD  LH+YFKQKDC
Sbjct  379  ILYVMENEPESFWCFVVLMERLGPNFNRDQNGVHSQLFALSKLVELLDNPLHDYFKQKDC  438

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RYRSKIIGE+M
Sbjct  439  LNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRYRSKIIGEEM  498

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLL-FSQE  201
            DFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IPPGTPPS P +   + + Q+
Sbjct  499  DFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIPPGTPPSFPFEGTSMCYQQD  558

Query  200  DDDVM  186
            DDDV+
Sbjct  559  DDDVL  563



>ref|XP_008785780.1| PREDICTED: TBC1 domain family member 15 [Phoenix dactylifera]
Length=666

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 159/182 (87%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  LHNY KQ DC
Sbjct  483  ILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPLHNYLKQADC  542

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVA+LKRYR KI+GE+M
Sbjct  543  LNYFFCFRWILIQFKREFEYTKVMHLWEVLWTHYLSEHFHLYMCVAVLKRYRKKIMGEQM  602

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP++ ++ L+ QE
Sbjct  603  DFDTLLKFINELSGHIDLDGMIRDAEALCVCAGESGAACIPPGTPPSLPVETDMGLYPQE  662

Query  200  DD  195
            DD
Sbjct  663  DD  664



>gb|AIU48668.1| RabGAP/TBC domain-containing protein, partial [Manihot esculenta]
Length=627

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  451  ILFVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDSPLHNYFKQNDC  510

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+ KTL LWEVLWT +L+EHLHLY CVAILKRYR+KI+GE+M
Sbjct  511  LNYFFCFRWILIQFKREFEYGKTLCLWEVLWTHYLSEHLHLYACVAILKRYRNKIMGEQM  570

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++  LL+S E
Sbjct  571  DFDTLLKFINELSGHIDLDAVLRDAEALCICAGENGAAAIPPGTPPSLPLE--LLYSDE  627



>ref|XP_010911929.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Elaeis guineensis]
Length=667

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  LHNY KQ DC
Sbjct  484  ILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPLHNYLKQADC  543

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVAILKRYR KI+GE+M
Sbjct  544  LNYFFCFRWILIQFKREFEYLKVMHLWEVLWTHYLSEHFHLYMCVAILKRYRKKIMGEQM  603

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+ T+RDAEALC CAGE G A IPPGTPPSLP++  +    +D
Sbjct  604  DFDTLLKFINELSGHIDLDGTIRDAEALCACAGENGTACIPPGTPPSLPVETDMGLYPQD  663

Query  197  DDVM  186
            DDV+
Sbjct  664  DDVL  667



>ref|XP_009593349.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nicotiana 
tomentosiformis]
Length=676

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DE ESFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  LH+YFKQKDC
Sbjct  492  ILYVMEDEPESFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPLHDYFKQKDC  551

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RYRSKIIGE+M
Sbjct  552  LNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRYRSKIIGEEM  611

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IPPGTPPS P +   ++ Q+D
Sbjct  612  DFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIPPGTPPSFPFEGTSMYYQQD  671

Query  197  DD  192
            DD
Sbjct  672  DD  673



>gb|AIU48641.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis thaliana]
Length=626

 Score =   303 bits (775),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  LHNYFK+ DC
Sbjct  450  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPLHNYFKENDC  509

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR RSKI+GE+M
Sbjct  510  LNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRCRSKIMGEQM  569

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+  L
Sbjct  570  DFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLDTL  622



>gb|KJB27077.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=639

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALME LGPNF  DQ+G+++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  457  ILFVMEDESESFWCFVALMECLGPNFNRDQSGLHSQLFALSKLVELLDNPLHNYFKQNDC  516

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKRE E+EKT+RLWEVLWT +L+EH+HLYV VAILKRYR KIIG++M
Sbjct  517  LNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHIHLYVSVAILKRYRGKIIGDQM  576

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ N LL+SQ+D
Sbjct  577  DFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTPPSLPVDNGLLYSQQD  636

Query  197  D  195
            +
Sbjct  637  E  637



>gb|KJB27078.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=656

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALME LGPNF  DQ+G+++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  474  ILFVMEDESESFWCFVALMECLGPNFNRDQSGLHSQLFALSKLVELLDNPLHNYFKQNDC  533

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKRE E+EKT+RLWEVLWT +L+EH+HLYV VAILKRYR KIIG++M
Sbjct  534  LNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHIHLYVSVAILKRYRGKIIGDQM  593

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ N LL+SQ+D
Sbjct  594  DFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTPPSLPVDNGLLYSQQD  653

Query  197  D  195
            +
Sbjct  654  E  654



>ref|XP_007204093.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
 gb|EMJ05292.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
Length=622

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 166/187 (89%), Gaps = 3/187 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES++FWCFV+LMERLGPNF  DQNGM++QLFA++KLVELLD  LHN+F Q+DC
Sbjct  436  ILFVMEDESDTFWCFVSLMERLGPNFNRDQNGMHSQLFAITKLVELLDIPLHNHFTQRDC  495

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF+KT+RLWEVLW  + +EHLHLYVCVAILKR+RSKIIGE+M
Sbjct  496  LNYFFCFRWVLIQFKREFEFDKTMRLWEVLWAHYPSEHLHLYVCVAILKRHRSKIIGEQM  555

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN--LLLFSQ  204
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ +  LLL+ Q
Sbjct  556  DFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTPPSLPVDDYGLLLYPQ  615

Query  203  ED-DDVM  186
            ++ DDV+
Sbjct  616  QELDDVL  622



>gb|KJB27079.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=683

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALME LGPNF  DQ+G+++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  501  ILFVMEDESESFWCFVALMECLGPNFNRDQSGLHSQLFALSKLVELLDNPLHNYFKQNDC  560

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKRE E+EKT+RLWEVLWT +L+EH+HLYV VAILKRYR KIIG++M
Sbjct  561  LNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHIHLYVSVAILKRYRGKIIGDQM  620

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ N LL+SQ+D
Sbjct  621  DFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTPPSLPVDNGLLYSQQD  680

Query  197  D  195
            +
Sbjct  681  E  681



>ref|XP_004287286.1| PREDICTED: TBC1 domain family member 15 [Fragaria vesca subsp. 
vesca]
Length=659

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFV LMERLGPNF  DQNGM++QLFA++KLVE+LD  LHNYF Q+DC
Sbjct  475  ILFVMGDESESFWCFVKLMERLGPNFNRDQNGMHSQLFAITKLVEMLDSPLHNYFTQRDC  534

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF KTLRLWEVLWT + +EHLHLYVCVAILKRYRSKIIGE+M
Sbjct  535  LNYFFCFRWVLIQFKREFEFNKTLRLWEVLWTHYPSEHLHLYVCVAILKRYRSKIIGEQM  594

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  +RDAEALC+CAGE G A IPPGTPPSLP+ + LL+ Q++
Sbjct  595  DFDTLLKFINELSGQINLDAVVRDAEALCICAGENGDACIPPGTPPSLPVDDGLLYPQQE  654

Query  197  -DDVM  186
             D+V+
Sbjct  655  LDEVL  659



>gb|AIU48639.1| RabGAP/TBC domain-containing protein, partial [Aquilegia coerulea]
Length=625

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DESESFWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYF+Q DC
Sbjct  449  ILFVMKDESESFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYFRQNDC  508

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF++EK +RLWEVLWT +L+EH HLYVCVAILK++R+KI+GE+M
Sbjct  509  LNYFFCFRWVLIQFKREFDYEKMMRLWEVLWTHYLSEHFHLYVCVAILKKHRAKIMGEQM  568

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAA IPPGTP SLPI+  LL+  E
Sbjct  569  DFDTLLKFINELSGHIDLDVTLRDAEALCVCAGENGAACIPPGTPASLPIE--LLYPDE  625



>gb|AIU48649.1| RabGAP/TBC domain-containing protein, partial [Sarcandra glabra]
Length=355

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNY KQ DC
Sbjct  179  ILFVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYLKQADC  238

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+ LWEVLWT +L+EH HLY+C+AILKRYR KI+ E+M
Sbjct  239  LNYFFCFRWILIQFKREFEYEKTMYLWEVLWTHYLSEHFHLYICIAILKRYRKKIVDEEM  298

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL G IDL+  LRDAEALC+ AGE GAA IPPGTPPSLP++  LL+S +
Sbjct  299  DFDTLLKFINELSGQIDLDAALRDAEALCIVAGENGAACIPPGTPPSLPVE--LLYSDD  355



>gb|AIU48669.1| RabGAP/TBC domain-containing protein, partial [Erythranthe guttata]
Length=624

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVMRDES+SFWCFV+LMERLGPNF  DQ+GM++QLFALSKLVELLD  LH+YFKQ DC
Sbjct  448  ILYVMRDESKSFWCFVSLMERLGPNFNRDQSGMHSQLFALSKLVELLDLPLHDYFKQNDC  507

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE++KTL LWEVLWT +L+EHLHLYVCVAILKRYR+KI+GE+M
Sbjct  508  LNYFFCFRWILIQFKREFEYDKTLLLWEVLWTHYLSEHLHLYVCVAILKRYRNKIMGEQM  567

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL G IDL+ TLR+AEALC+CAGE G A IPPGTPPSLP++++
Sbjct  568  DFDTLLKFINELSGQIDLDATLREAEALCICAGENGEASIPPGTPPSLPLESV  620



>gb|AIU48655.1| RabGAP/TBC domain-containing protein, partial [Eucalyptus grandis]
Length=624

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  449  ILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDLPLHNYFKQNDC  508

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EK + LWEV WT HL+EHLHLYVCV+ILKRYR KI+GE+M
Sbjct  509  LNYFFCFRWLLIQFKREFEYEKVMSLWEVFWTHHLSEHLHLYVCVSILKRYRKKIMGEQM  568

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  225
            DFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  569  DFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTPPSLPIE  619



>ref|XP_009789608.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Nicotiana 
sylvestris]
Length=676

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM +E ESFWCFV LMERLGPNF  DQNG+++QLFALSKLVELLD  LH+YFKQKDC
Sbjct  492  ILYVMENEPESFWCFVVLMERLGPNFNRDQNGVHSQLFALSKLVELLDNPLHDYFKQKDC  551

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RYRSKIIGE+M
Sbjct  552  LNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRYRSKIIGEEM  611

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL-LLFSQE  201
            DFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IPPGTPPS P +   + + Q+
Sbjct  612  DFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIPPGTPPSFPFEGTSMCYQQD  671

Query  200  DDDVM  186
            DDDV+
Sbjct  672  DDDVL  676



>gb|AIU48652.1| RabGAP/TBC domain-containing protein, partial [Carica papaya]
Length=628

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFV LMERLGPNF  DQNGM+TQLFA+SKLVELLD  LHNYFKQ DC
Sbjct  452  ILFVMEDESESFWCFVKLMERLGPNFNRDQNGMHTQLFAVSKLVELLDIPLHNYFKQNDC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+ KT+ LWEVLWT +L+EHLHLYVCVAILKRYR  I+GE+M
Sbjct  512  LNYFFCFRWILIQFKREFEYGKTMLLWEVLWTHYLSEHLHLYVCVAILKRYRGMIMGEQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL  219
            DFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE G+A IPPGTPPSLPI +L
Sbjct  572  DFDTLLKFINELSGHIDLDATLRDAEALCICAGENGSACIPPGTPPSLPIDSL  624



>gb|KHG01737.1| TBC1 domain family member 15 [Gossypium arboreum]
Length=683

 Score =   301 bits (771),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL VM DESESFWCFVALME LGPNF  DQ+GM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  501  ILLVMEDESESFWCFVALMECLGPNFNRDQSGMHSQLFALSKLVELLDNPLHNYFKQNDC  560

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKRE E+EKT+RLWEVLWT +L+EHLHLY+ VAILKRYR KIIGE+M
Sbjct  561  LNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHLHLYLSVAILKRYRGKIIGEQM  620

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTL+ FINEL G IDL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ N LL+SQ+D
Sbjct  621  DFDTLIRFINELSGWIDLDATLRDAEALCICAGERGADCIPPGTPPSLPVDNGLLYSQQD  680

Query  197  D  195
            +
Sbjct  681  E  681



>ref|XP_008242808.1| PREDICTED: TBC1 domain family member 17 [Prunus mume]
Length=661

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 165/187 (88%), Gaps = 3/187 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES++FWCFV+LMERLGPNF  DQNGM++QLFA++KLVELLD  LHN+F Q DC
Sbjct  475  ILFVMEDESDTFWCFVSLMERLGPNFNRDQNGMHSQLFAITKLVELLDIPLHNHFTQHDC  534

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF+KT+RLWEVLW  + +EHLHLYVCVAILKR+RSKIIGE+M
Sbjct  535  LNYFFCFRWVLIQFKREFEFDKTMRLWEVLWAHYPSEHLHLYVCVAILKRHRSKIIGEQM  594

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN--LLLFSQ  204
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ +  LLL+ Q
Sbjct  595  DFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTPPSLPVDDYGLLLYPQ  654

Query  203  ED-DDVM  186
            ++ DDV+
Sbjct  655  QELDDVL  661



>gb|AIU48667.1| RabGAP/TBC domain-containing protein, partial [Canna indica]
Length=628

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVE+LD  LHNYFKQ DC
Sbjct  452  ILYVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVEILDSPLHNYFKQADC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+++ + LWEVLWT HL+EHLHLY+CVAILKR+R KI+GE+M
Sbjct  512  LNYFFCFRWILIQFKREFEYDQIMHLWEVLWTHHLSEHLHLYMCVAILKRHRKKIMGEQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  225
            DFDTLL+FINEL GHIDL+ T+R+AEALC CAGE GAA IPPGTPPSLPI+
Sbjct  572  DFDTLLKFINELSGHIDLDWTIREAEALCTCAGENGAACIPPGTPPSLPIE  622



>ref|XP_008377303.1| PREDICTED: TBC1 domain family member 17 [Malus domestica]
Length=660

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFV+LMERLGPNF  DQ+GM++QLFA+ KLVELLD  LHN+F QKDC
Sbjct  476  ILYVMEDESESFWCFVSLMERLGPNFNRDQSGMHSQLFAIMKLVELLDAPLHNHFTQKDC  535

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF+KT+RLWE+LWT +  EHLHLYV VAILKR+RSKIIGE+M
Sbjct  536  LNYFFCFRWVLIQFKREFEFDKTMRLWELLWTHYPAEHLHLYVXVAILKRHRSKIIGEQM  595

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL  HIDL+  +RDAEALC+ AGE GAA IPPGTPPSLP+ ++LL+ Q++
Sbjct  596  DFDTLLKFINELSXHIDLDAVVRDAEALCIXAGENGAASIPPGTPPSLPVDDVLLYPQQE  655

Query  197  -DDVM  186
             DD++
Sbjct  656  LDDIL  660



>gb|AIU48644.1| RabGAP/TBC domain-containing protein, partial [Musa acuminata]
Length=319

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DE+ESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVE+LD  LHNYFKQ DC
Sbjct  143  ILYVMKDEAESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVEILDSPLHNYFKQTDC  202

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+++ + LWEVLWT +L+EHLHLY+CVAILK +R KI+GE+M
Sbjct  203  LNYFFCFRWILIQFKREFEYDQVMHLWEVLWTHYLSEHLHLYMCVAILKSHRKKIMGEQM  262

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  225
            DFDTLL+FINEL G+IDL+ T+R+AEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  263  DFDTLLKFINELSGNIDLDWTIREAEALCICAGENGAACIPPGTPPSLPIE  313



>gb|AIU48691.1| RabGAP/TBC domain-containing protein, partial [Cabomba caroliniana]
Length=409

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  LHNY KQ DC
Sbjct  239  ILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDLPLHNYLKQADC  298

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EK + LWEVLWT +L+EH HLYVCVAILKRYR KII E+M
Sbjct  299  LNYFFCFRWILIQFKREFEYEKIMHLWEVLWTHYLSEHFHLYVCVAILKRYRRKIIDEQM  358

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  225
            DFDTLL+FINEL  HI L++TLRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  359  DFDTLLKFINELSCHIHLDSTLRDAEALCVCAGENGAALIPPGTPPSLPVE  409



>gb|AIU48671.1| RabGAP/TBC domain-containing protein, partial [Prunus persica]
Length=589

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES++FWCFV+LMERLGPNF  DQNGM++QLFA++KLVELLD  LHN+F Q+DC
Sbjct  413  ILFVMEDESDTFWCFVSLMERLGPNFNRDQNGMHSQLFAITKLVELLDIPLHNHFTQRDC  472

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF+KT+RLWEVLW  + +EHLHLYVCVAILKR+RSKIIGE+M
Sbjct  473  LNYFFCFRWVLIQFKREFEFDKTMRLWEVLWAHYPSEHLHLYVCVAILKRHRSKIIGEQM  532

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+
Sbjct  533  DFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTPPSLPV  582



>ref|XP_008456989.1| PREDICTED: TBC1 domain family member 15 [Cucumis melo]
Length=655

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQ GM+ QLFA+SKLVELLD  LHNYF Q DC
Sbjct  473  ILFVMGDESESFWCFVALMERLGPNFNRDQTGMHCQLFAISKLVELLDTPLHNYFSQHDC  532

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+EK + LWEVLWT + +EHLHLY+CVA+LKRYR+KI+GE+M
Sbjct  533  LNYFFCFRWVLIQFKREFEYEKVMHLWEVLWTHYPSEHLHLYICVAVLKRYRNKIMGEQM  592

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ +   + Q D
Sbjct  593  DFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTPPSLPLDDGSYYIQHD  652

Query  197  D  195
            +
Sbjct  653  E  653



>ref|XP_009420718.1| PREDICTED: TBC1 domain family member 15 [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DE+ESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVE+LD  LHNYFKQ DC
Sbjct  484  ILYVMKDEAESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVEILDSPLHNYFKQTDC  543

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+++ + LWEVLWT +L+EHLHLY+CVAILK +R KI+GE+M
Sbjct  544  LNYFFCFRWILIQFKREFEYDQVMHLWEVLWTHYLSEHLHLYMCVAILKSHRKKIMGEQM  603

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G+IDL+ T+R+AEALC+CAGE GAA IPPGTPPSLPI+ ++ L+ QE
Sbjct  604  DFDTLLKFINELSGNIDLDWTIREAEALCICAGENGAACIPPGTPPSLPIEPDMGLYPQE  663

Query  200  DD  195
            D+
Sbjct  664  DE  665



>gb|AIU48662.1| RabGAP/TBC domain-containing protein, partial [Chimonanthus praecox]
Length=627

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 4/181 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFV+LMERLGPNF  DQNGM++QLFALSKLV+LLD  LHNY KQ DC
Sbjct  451  ILFVMEDESQSFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVQLLDSPLHNYLKQADC  510

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EK + LWEVLWT +L+EH HLYVCVAILKR+  +IIGE+M
Sbjct  511  LNYFFCFRWILIQFKREFEYEKIMHLWEVLWTHYLSEHFHLYVCVAILKRFCKRIIGEQM  570

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP++    FS  D
Sbjct  571  DFDTLLKFINELSGHIDLDRTLRDAEALCICAGENGAACIPPGTPPSLPVE----FSYPD  626

Query  197  D  195
            D
Sbjct  627  D  627



>ref|XP_004139297.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
 gb|KGN60701.1| hypothetical protein Csa_2G007450 [Cucumis sativus]
Length=655

 Score =   295 bits (756),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQ GM+ QLFA+SKLVELLD  LHNYF Q DC
Sbjct  473  ILFVMGDESESFWCFVALMERLGPNFNRDQTGMHCQLFAISKLVELLDTPLHNYFSQHDC  532

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF +EK + LWEVLWT + +EHLHLY+CVA+LKRYR+KI+GE+M
Sbjct  533  LNYFFCFRWVLIQFKREFAYEKVMHLWEVLWTHYPSEHLHLYICVAVLKRYRNKIMGEQM  592

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ +   + Q+D
Sbjct  593  DFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTPPSLPLDDGSYYIQQD  652

Query  197  D  195
            +
Sbjct  653  E  653



>gb|AIU48648.1| RabGAP/TBC domain-containing protein, partial [Acorus calamus]
Length=550

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FW FVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNY KQ DC
Sbjct  374  ILFVMEDESEAFWSFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPLHNYLKQADC  433

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+E+ + LWEV WT +L+EH HLYVCVAILKRY  KIIGE+M
Sbjct  434  LNYFFCFRWILIQFKREFEYEQVMYLWEVFWTHYLSEHFHLYVCVAILKRYSKKIIGEQM  493

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLL  213
            DFDTLL+FINEL GHIDL+  +RDAEALC+CAGE G A IPPGTPPSLPI+++ L
Sbjct  494  DFDTLLKFINELSGHIDLDGIIRDAEALCVCAGENGEACIPPGTPPSLPIESMYL  548



>gb|AIU48690.1| RabGAP/TBC domain-containing protein, partial [Trachycarpus fortunei]
Length=627

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  LHNY KQ DC
Sbjct  451  ILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPLHNYLKQADC  510

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVAILKRYR KI+GE+M
Sbjct  511  LNYFFCFRWILIQFKREFEYTKIMHLWEVLWTHYLSEHFHLYMCVAILKRYRKKIMGEQM  570

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  225
            DFDTLL+FINEL GHI+L+ T+RDAEALC+CAGE GAA IPPGTP SLP++
Sbjct  571  DFDTLLKFINELSGHINLDGTIRDAEALCVCAGENGAACIPPGTPASLPVE  621



>gb|AIU48645.1| RabGAP/TBC domain-containing protein, partial [Pinellia ternata]
Length=624

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 158/179 (88%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DE ESFWCFV LMERLGPNF  DQ+GM+ QLFALSKLVE+LD  LHNY +Q DC
Sbjct  448  ILFVMGDEPESFWCFVELMERLGPNFNRDQSGMHAQLFALSKLVEILDCPLHNYLRQADC  507

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EK +RLWEVLWT++L+EHLHLYVCVA+LKRYR KI+GE+M
Sbjct  508  LNYFFCFRWILIQFKREFEYEKVMRLWEVLWTRYLSEHLHLYVCVAVLKRYRKKIMGEQM  567

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL GHI+L+  LRDAEALC+CAGE GAA IPPGTPPSLP++  LL+S++
Sbjct  568  DFDTLLKFINELSGHINLDDILRDAEALCICAGENGAACIPPGTPPSLPME--LLYSEQ  624



>gb|AIU48651.1| RabGAP/TBC domain-containing protein, partial [Gossypium raimondii]
Length=624

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LH YF+Q DC
Sbjct  448  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDRPLHKYFEQNDC  507

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKRE E+E+T+RLWEVLWT +L+EHLHLYVCVAILKRYR KI+GE+M
Sbjct  508  LNYFFCFRWILIQFKRELEYEQTMRLWEVLWTHYLSEHLHLYVCVAILKRYRGKIMGEQM  567

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGT PSLP+    LF  +D
Sbjct  568  DFDTLLKFINELSGQIELDAILRDAEALCICAGENGAACIPPGTVPSLPVD---LFYSDD  624



>gb|AIU48660.1| RabGAP/TBC domain-containing protein, partial [Chloranthus japonicus]
Length=627

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DE+ESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNY KQ DC
Sbjct  451  ILFVMNDEAESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDVPLHNYLKQADC  510

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+ LWEVLWT +L+EH HLY+C+AILKRY  KI+ E+M
Sbjct  511  LNYFFCFRWILIQFKREFEYEKTMYLWEVLWTHYLSEHFHLYICIAILKRYHKKIMDEEM  570

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQE  201
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++  LL+S +
Sbjct  571  DFDTLLKFINELSGRIDLDAALRDAEALCICAGENGAACIPPGTPPSLPVE--LLYSDD  627



>ref|XP_011469988.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+V+ DESESFWCFV LMERLGPNF LDQNGM+ QLFA++KLVE+LD  LH+YF Q+DC
Sbjct  450  ILFVLGDESESFWCFVKLMERLGPNFNLDQNGMHFQLFAITKLVEMLDKPLHSYFTQRDC  509

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFEF+KTLRLWEVLWT + +EHLHLYVCVAILKRY SKIIGE+M
Sbjct  510  LNYFFCFRWVLIQFKREFEFDKTLRLWEVLWTHYPSEHLHLYVCVAILKRYGSKIIGEQM  569

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  +RDAEALC+CAGE G A IPP TPPSLP+ + LL+ Q++
Sbjct  570  DFDTLLKFINELSGQINLDAVVRDAEALCICAGENGDACIPPETPPSLPVDDGLLYPQQE  629

Query  197  DD  192
             D
Sbjct  630  VD  631



>gb|AIU48664.1| RabGAP/TBC domain-containing protein, partial [Asparagus officinalis]
Length=625

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNY +QKDC
Sbjct  451  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDQPLHNYLRQKDC  510

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EK + LWEVLWT +L+EH HLY+CVAILK+YR +I+GE+M
Sbjct  511  LNYFFCFRWILIQFKREFEYEKIMHLWEVLWTYYLSEHFHLYMCVAILKKYRQRIVGEQM  570

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN  222
            DFDTLL+FINEL GHI+L+  +RDAEALC CAGE GAA IPPGTPPS+P+++
Sbjct  571  DFDTLLKFINELSGHINLDDIIRDAEALCNCAGEQGAACIPPGTPPSMPLED  622



>gb|AIU48677.1| RabGAP/TBC domain-containing protein, partial [Yucca filamentosa]
Length=624

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNY +QKDC
Sbjct  450  ILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDQPLHNYLRQKDC  509

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EK + LWEVLWT +L+EH HLY+CVAILK+YR KIIGE+M
Sbjct  510  LNYFFCFRWILIQFKREFEYEKIMHLWEVLWTYYLSEHFHLYMCVAILKKYRKKIIGEQM  569

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN  222
            DFDTLL++INEL G I+L+  +RDAEALCLCAGE GAA IPPGTPPS+P+++
Sbjct  570  DFDTLLKYINELSGRINLDEIIRDAEALCLCAGENGAACIPPGTPPSMPLED  621



>gb|AIU48657.1| RabGAP/TBC domain-containing protein, partial [Illicium henryi]
Length=619

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVE+LDG L++Y  Q DC
Sbjct  449  ILFVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVEILDGPLNSYLTQADC  508

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EK +RLWEVLWT +L+EH HLYVCVAILKRY  KI+ E+M
Sbjct  509  LNYFFCFRWILIQFKREFEYEKIMRLWEVLWTHYLSEHFHLYVCVAILKRYHKKIMDEQM  568

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL G I+LE TLRDAEALC+CAGE GAA IPPGTPPSLP+
Sbjct  569  DFDTLLKFINELSGRIELEGTLRDAEALCICAGENGAACIPPGTPPSLPL  618



>gb|AIU48687.1| RabGAP/TBC domain-containing protein, partial [Houttuynia cordata]
Length=622

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DE+ESFWCF ALMERLG NF  DQ+GM++QLFALSKLVELLDG LHNY KQ DC
Sbjct  446  ILFVMEDETESFWCFAALMERLGANFNRDQSGMHSQLFALSKLVELLDGPLHNYLKQADC  505

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+E  +R+WEVLWT HL+EH HLY+CVAILKR+R KI+GE+M
Sbjct  506  LNYFFCFRWILIQFKREFEYEMLMRMWEVLWTHHLSEHFHLYICVAILKRHRKKIMGEQM  565

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLP  231
            DFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLP
Sbjct  566  DFDTLLKFINELSGQIDLDGILRDAEALCICAGENGAACIPPGTPPSLP  614



>gb|AIU48686.1| RabGAP/TBC domain-containing protein, partial [Ginkgo biloba]
Length=617

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL++M DESE+FWCFVALMERLGPNF  DQNGM++QL ALSKLVE LDG LHNYF+Q DC
Sbjct  448  ILFIMEDESEAFWCFVALMERLGPNFDRDQNGMHSQLLALSKLVEFLDGPLHNYFRQADC  507

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREF++EK +RLWEVLWT +L+EH HLY+CVA+LKR+R KII EKM
Sbjct  508  LNYFFCFRWILIQFKREFDYEKVMRLWEVLWTHYLSEHFHLYMCVALLKRHRKKIIDEKM  567

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL  HIDLE TLRDAEALC+CAG+ G+A IP GTPPSLPI
Sbjct  568  DFDTLLKFINELSCHIDLEATLRDAEALCICAGDTGSACIPQGTPPSLPI  617



>gb|AIU48684.1| RabGAP/TBC domain-containing protein, partial [Cinnamomum camphora]
Length=561

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM  ESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNY KQ DC
Sbjct  385  ILFVMEGESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPLHNYLKQADC  444

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKRE E+  T+RLWEVLWT +L+EH HLY+ VAILKR+R KIIGE+M
Sbjct  445  LNYFFCFRWILIQFKRELEYGMTMRLWEVLWTHYLSEHFHLYLSVAILKRHRKKIIGEQM  504

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL GH+DL++ LRDAEALC+CAGE GAA IPPGTPPSLP++    F+ +D
Sbjct  505  DFDTLLKFINELSGHLDLDSALRDAEALCICAGENGAACIPPGTPPSLPVE---FFNSDD  561



>ref|XP_010687933.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L+VM DE E FWCF ALMER+GPNF  DQ+GM+ QLFALSKLVEL D  LHNY KQ DC
Sbjct  439  LLFVMEDEFEVFWCFAALMERVGPNFNRDQSGMHAQLFALSKLVELSDSPLHNYLKQNDC  498

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKRE  +E+T+RLWEVLWT +L+EHLHLYVCVAILKR R+KIIGE+M
Sbjct  499  LNYFFCFRWILIQFKRELRYEETMRLWEVLWTHYLSEHLHLYVCVAILKRCRNKIIGEQM  558

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FIN L GHIDL+  LRDAEALC+C+GE GAA IPPGTPPSLP++N  L SQ +
Sbjct  559  DFDTLLKFINGLSGHIDLDAILRDAEALCICSGETGAACIPPGTPPSLPMENGPLSSQLE  618

Query  197  DDVM  186
            D+++
Sbjct  619  DEIL  622



>ref|XP_010687932.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L+VM DE E FWCF ALMER+GPNF  DQ+GM+ QLFALSKLVEL D  LHNY KQ DC
Sbjct  473  LLFVMEDEFEVFWCFAALMERVGPNFNRDQSGMHAQLFALSKLVELSDSPLHNYLKQNDC  532

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKRE  +E+T+RLWEVLWT +L+EHLHLYVCVAILKR R+KIIGE+M
Sbjct  533  LNYFFCFRWILIQFKRELRYEETMRLWEVLWTHYLSEHLHLYVCVAILKRCRNKIIGEQM  592

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FIN L GHIDL+  LRDAEALC+C+GE GAA IPPGTPPSLP++N  L SQ +
Sbjct  593  DFDTLLKFINGLSGHIDLDAILRDAEALCICSGETGAACIPPGTPPSLPMENGPLSSQLE  652

Query  197  DDVM  186
            D+++
Sbjct  653  DEIL  656



>gb|AIU48665.1| RabGAP/TBC domain-containing protein, partial [Aristolochia tagala]
Length=616

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VMRDE ESFWCFV+LMERLGPNF  DQ+GM++QLFALSKLVE+LD  LHNYFKQ DC
Sbjct  440  ILFVMRDEVESFWCFVSLMERLGPNFNRDQSGMHSQLFALSKLVEILDSPLHNYFKQADC  499

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREF ++  LR+WEVLWT +L+EH  LYVCVAILKRYR KIIGE+M
Sbjct  500  LNYFFCFRWILIQFKREFSYDSILRMWEVLWTYYLSEHFQLYVCVAILKRYRKKIIGEQM  559

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN  222
            DFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGTPPSLP ++
Sbjct  560  DFDTLLKFINELSGSIELDGILRDAEALCICAGENGAACIPPGTPPSLPFES  611



>gb|AIU48676.1| RabGAP/TBC domain-containing protein, partial [Dioscorea oppositifolia]
Length=625

 Score =   287 bits (734),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DE+E+FWCF ALMERLGPNF  DQNGM++QLFAL+KLVE+LD  LHNY +Q DC
Sbjct  449  ILFVMEDEAEAFWCFAALMERLGPNFNRDQNGMHSQLFALAKLVEVLDSPLHNYLRQADC  508

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EK ++LWEVLWT +L+EH HLY+CVAILK+YR KII E+M
Sbjct  509  LNYFFCFRWILIQFKREFEYEKVMQLWEVLWTHYLSEHFHLYICVAILKKYRKKIIDEQM  568

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  225
            DFDTLL+FINEL G IDL++ ++DAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  569  DFDTLLKFINELSGQIDLDSIIKDAEALCICAGENGAACIPPGTPPSLPLE  619



>gb|AIU48642.1| RabGAP/TBC domain-containing protein, partial [Lilium brownii]
Length=620

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMER+GPNF  DQNGM+ QLFALSKLVELLD  LHNYFKQ DC
Sbjct  444  ILFVMEDESESFWCFVALMERMGPNFNRDQNGMHAQLFALSKLVELLDYPLHNYFKQADC  503

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREF +EK + LWEVLWT +L+EH HLY+CVAILK+YR KI+ E+M
Sbjct  504  LNYFFCFRWILIQFKREFPYEKIMLLWEVLWTHYLSEHFHLYMCVAILKQYRRKIMDEQM  563

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL  HIDL+ T+R+AEALC+ AGE GAA IPPGTPPSLPI
Sbjct  564  DFDTLLKFINELSDHIDLDRTIREAEALCVLAGENGAASIPPGTPPSLPI  613



>gb|AIU48683.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=615

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFV+LMERLGPNF  DQ+GM++QLFAL+KLVELLD  LHNY KQ DC
Sbjct  446  ILFVMGDESESFWCFVSLMERLGPNFNRDQSGMHSQLFALTKLVELLDSTLHNYLKQADC  505

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+++ L LWEV WT +L+EH HLYVCVAILKRY  KI+ EKM
Sbjct  506  LNYFFCFRWLLIQFKREFEYDRILYLWEVFWTHYLSEHFHLYVCVAILKRYAKKIVNEKM  565

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL GHI+L+  LRDAEALC+CAGE G A IPPGTPPSLPI
Sbjct  566  DFDTLLKFINELSGHINLDEALRDAEALCVCAGENGEACIPPGTPPSLPI  615



>gb|AIU48661.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
demersum]
Length=615

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFV+LMERLGPNF  DQ+GM++QLFAL+KLVELLD  LHNY KQ DC
Sbjct  446  ILFVMGDESESFWCFVSLMERLGPNFNRDQSGMHSQLFALTKLVELLDSTLHNYLKQADC  505

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREFE+++ L LWEV WT +L+EH HLYVCVAILKRY  KI+ EKM
Sbjct  506  LNYFFCFRWLLIQFKREFEYDRILYLWEVFWTHYLSEHFHLYVCVAILKRYAKKIVNEKM  565

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  228
            DFDTLL+FINEL GHI+L+  LRDAEALC+CAGE G A IPPGTPPSLPI
Sbjct  566  DFDTLLKFINELSGHINLDEALRDAEALCVCAGENGEACIPPGTPPSLPI  615



>gb|AIU48689.1| RabGAP/TBC domain-containing protein, partial [Alisma plantago-aquatica]
Length=628

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L+VM DESESFWCFVALMERLGPNF  DQ+GM++QLF LSKLVELLD  LHNY KQ DC
Sbjct  452  LLFVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFGLSKLVELLDLPLHNYLKQADC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREF+F + +RLWEVLWT++ +EHLHLY+ VAILKRYR KI+GE+M
Sbjct  512  LNYFFCFRWILIQFKREFDFNQVMRLWEVLWTRYPSEHLHLYLSVAILKRYRKKIMGEQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN  222
            DFDTLL+FINEL G +DL++ +RDAEALC+CAGE G A IPPGTPPSLP+++
Sbjct  572  DFDTLLKFINELSGRVDLDSIIRDAEALCICAGENGEACIPPGTPPSLPLES  623



>ref|XP_006647781.1| PREDICTED: TBC1 domain family member 15-like [Oryza brachyantha]
Length=635

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF  LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  452  ILYVMEDESESFWCFAILMERLGANFNRDQNGMHAQLLALSKLVELLDPALHNYFRQNDC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ L LWEVLWT +L+EH HLY+CVAILKRYRS+IIGE+M
Sbjct  512  LNYFFCFRWVLIQFKREFSFDQILLLWEVLWTHYLSEHFHLYLCVAILKRYRSRIIGEQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G I+L+  ++DAEALC+ AGE GAA IPPGTPPS+PI+ +  L+ Q+
Sbjct  572  DFDTLLKFINELSGEINLDRAIQDAEALCVIAGEKGAACIPPGTPPSMPIETDGGLYVQQ  631

Query  200  DD  195
            D+
Sbjct  632  DE  633



>gb|AIU48688.1| RabGAP/TBC domain-containing protein, partial [Zea mays]
Length=450

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  274  ILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPSLHNYFRQNDC  333

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLW+ +L+EH HLY+CVAILK+YR +IIGE+M
Sbjct  334  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWSHYLSEHFHLYLCVAILKKYRQRIIGEQM  393

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+P++   ++ QED
Sbjct  394  DFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPVE---MYVQED  450



>gb|KDP30256.1| hypothetical protein JCGZ_17038 [Jatropha curcas]
Length=687

 Score =   280 bits (717),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  503  ILFVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDSPLHNYFKQNDC  562

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+RLWEVLWT +L EHLHLY CVAILKRYR+KI+GE+M
Sbjct  563  LNYFFCFRWILIQFKREFEYEKTIRLWEVLWTHYLCEHLHLYACVAILKRYRNKIMGEQM  622

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNL--LLFSQ  204
            DFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA +PPGTPPSLP +N   LL++Q
Sbjct  623  DFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACVPPGTPPSLPPENENGLLYTQ  682

Query  203  EDD  195
            +D+
Sbjct  683  QDE  685



>gb|AIU48659.1| RabGAP/TBC domain-containing protein, partial [Iris japonica]
Length=629

 Score =   279 bits (713),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVMRDESE+FW FVALM+RLGPNF  DQ+GM++QLFALSKLVELLD  LHNYF+Q DC
Sbjct  453  ILYVMRDESEAFWSFVALMDRLGPNFNRDQSGMHSQLFALSKLVELLDHSLHNYFRQADC  512

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+E+ +RLWEVLWT + +EHLHLY+CVAILK ++ KI+ E+M
Sbjct  513  LNYFFCFRWILIQFKREFEYEEVMRLWEVLWTHYPSEHLHLYLCVAILKSHKKKIMEEQM  572

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLP  231
            DFDTLL+FINEL   IDL++ +RDAEALC+CAGE GAA IPPGTPPS P
Sbjct  573  DFDTLLKFINELSNQIDLDSIIRDAEALCICAGENGAACIPPGTPPSCP  621



>gb|AIU48672.1| RabGAP/TBC domain-containing protein, partial [Panicum virgatum]
Length=628

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  452  ILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPLHNYFRQNDC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILKRYR +IIGE+M
Sbjct  512  LNYFFCFRWVLIQFKREFSFDQVMLLWEVLWTHYLSEHFHLYLCVAILKRYRQRIIGEQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+PI+   L+ QED
Sbjct  572  DFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPIE---LYVQED  628



>ref|XP_004953647.1| PREDICTED: TBC1 domain family member 15-like [Setaria italica]
Length=672

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  489  ILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPLHNYFRQNDC  548

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILKRYR +IIGE+M
Sbjct  549  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKRYRQRIIGEQM  608

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G I+L+  L+DAEALC  AGE GA+ IPPGTPPS+PI+ +  L+ Q+
Sbjct  609  DFDTLLKFINELSGQINLDRALQDAEALCTIAGENGASCIPPGTPPSMPIETDGGLYVQQ  668

Query  200  DD  195
            DD
Sbjct  669  DD  670



>gb|AIU48679.1| RabGAP/TBC domain-containing protein, partial [Sorghum bicolor]
Length=616

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  440  ILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPLHNYFRQNDC  499

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILK+YR +IIGE+M
Sbjct  500  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKKYRQRIIGEQM  559

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+PI+   L+ QED
Sbjct  560  DFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPIE---LYVQED  616



>gb|AIU48678.1| RabGAP/TBC domain-containing protein, partial [Setaria italica]
Length=628

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  452  ILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPLHNYFRQNDC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILKRYR +IIGE+M
Sbjct  512  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKRYRQRIIGEQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  L+DAEALC  AGE GA+ IPPGTPPS+PI+   L+ Q+D
Sbjct  572  DFDTLLKFINELSGQINLDRALQDAEALCTIAGENGASCIPPGTPPSMPIE---LYVQQD  628



>ref|XP_002452666.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
 gb|EES05642.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
Length=661

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  478  ILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPLHNYFRQNDC  537

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILK+YR +IIGE+M
Sbjct  538  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKKYRQRIIGEQM  597

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+PI+ +  L+ QE
Sbjct  598  DFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPIETDGGLYVQE  657

Query  200  DD  195
            D+
Sbjct  658  DE  659



>ref|XP_003570212.1| PREDICTED: TBC1 domain family member 15 [Brachypodium distachyon]
Length=677

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  494  ILHVMEDESESFWCFASLMERLGGNFNRDQNGMHAQLLALSKLVELLDPPLHNYFRQNDC  553

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWTQ+L+EH HLY+CVAILKRYR +IIGE M
Sbjct  554  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTQYLSEHFHLYLCVAILKRYRQRIIGEGM  613

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G I+++  ++DAEALC  AG+ GAA IPPGTPPSLP++ +  L+ QE
Sbjct  614  DFDTLLKFINELSGQINIDQAIQDAEALCTIAGDNGAACIPPGTPPSLPVETDGGLYLQE  673

Query  200  DD  195
            DD
Sbjct  674  DD  675



>gb|AIU48646.1| RabGAP/TBC domain-containing protein, partial [Brachypodium distachyon]
Length=628

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  452  ILHVMEDESESFWCFASLMERLGGNFNRDQNGMHAQLLALSKLVELLDPPLHNYFRQNDC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWTQ+L+EH HLY+CVAILKRYR +IIGE M
Sbjct  512  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTQYLSEHFHLYLCVAILKRYRQRIIGEGM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+++  ++DAEALC  AG+ GAA IPPGTPPSLP++   L+ QED
Sbjct  572  DFDTLLKFINELSGQINIDQAIQDAEALCTIAGDNGAACIPPGTPPSLPVE---LYLQED  628



>ref|NP_001168835.1| uncharacterized protein LOC100382640 [Zea mays]
 gb|ACN30830.1| unknown [Zea mays]
 gb|AFW63576.2| hypothetical protein ZEAMMB73_375304 [Zea mays]
Length=671

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF+Q DC
Sbjct  488  ILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPSLHNYFRQNDC  547

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLW+ +L+EH HLY+CVAILK+YR +IIGE+M
Sbjct  548  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWSHYLSEHFHLYLCVAILKKYRQRIIGEQM  607

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+P++ +  ++ QE
Sbjct  608  DFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPVETDGGMYVQE  667

Query  200  DD  195
            D+
Sbjct  668  DE  669



>ref|XP_006855176.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
 gb|ERN16643.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
Length=688

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DESE+FWCFV+LMERLGPNF  DQNGM++QL ALSKLVE LD  LH Y +Q DC
Sbjct  513  ILFVMEDESEAFWCFVSLMERLGPNFNRDQNGMHSQLLALSKLVEFLDSPLHCYLRQADC  572

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LN+  CFRWILIQFKREF +EKT+RLWEVLWT +L+EH HLY+CVAILK++R KII E+M
Sbjct  573  LNFFFCFRWILIQFKREFVYEKTMRLWEVLWTHYLSEHFHLYMCVAILKKHRKKIIEERM  632

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLL  213
            DFDTLL+FINEL  HI LE TL+DAEALC+ AGE  AA IPPGTPPSLP++  LL
Sbjct  633  DFDTLLKFINELSCHITLEATLKDAEALCIIAGENKAACIPPGTPPSLPVEGGLL  687



>gb|AIU48643.1| RabGAP/TBC domain-containing protein, partial [Magnolia denudata]
Length=622

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM +ESESFWCFVALMERLGPNF  DQNGM++QL AL KLVELLD  LHNY KQ DC
Sbjct  452  ILFVMGNESESFWCFVALMERLGPNFDRDQNGMHSQLLALLKLVELLDSPLHNYLKQADC  511

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREFE+EKT+ LWEVLWT +L+EH HLYVCVAILKRYR KI+G++M
Sbjct  512  LNYFFCFRWILIQFKREFEYEKTMLLWEVLWTHYLSEHFHLYVCVAILKRYRQKIMGDQM  571

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  225
            DFDTLL+FINEL GHIDL   +RD EALC+CAGE G+A IPPGTPPSLPI 
Sbjct  572  DFDTLLKFINELSGHIDLNGAIRDGEALCICAGENGSACIPPGTPPSLPIN  622



>ref|NP_001047892.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAD72476.1| GTPase activating protein-like [Oryza sativa Japonica Group]
 dbj|BAF09806.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAG91061.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57667.1| hypothetical protein OsJ_08107 [Oryza sativa Japonica Group]
Length=679

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF  LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF++ DC
Sbjct  496  ILYVMEDESESFWCFAILMERLGANFNRDQNGMHAQLLALSKLVELLDPQLHNYFRKNDC  555

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWT + +EH HLY+CVAILKRYRS+IIGE+M
Sbjct  556  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYWSEHFHLYLCVAILKRYRSRIIGEQM  615

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
            DFDTLL+FINEL G I+L+  ++DAEALC  AG  GAA IPPGTPPS+PI+       ++
Sbjct  616  DFDTLLKFINELSGEINLDRAIQDAEALCDQAGPNGAACIPPGTPPSMPIETDGGLYVQE  675

Query  197  DDVM  186
            D+VM
Sbjct  676  DEVM  679



>ref|XP_001783529.1| predicted protein [Physcomitrella patens]
 gb|EDQ51665.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+V+ +ESE+FWCF ALMER+ PNF  DQ GM  QL A+SKLV+LLD  LH+YFKQ DC
Sbjct  306  ILHVVVEESEAFWCFAALMERMAPNFHRDQAGMQAQLSAVSKLVQLLDNPLHDYFKQNDC  365

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILI FKREF++   LRLWEVLW+ +L+EH HLY+CVAILKR+R KI+ E+M
Sbjct  366  LNYFFCFRWILICFKREFDYNDVLRLWEVLWSHYLSEHFHLYMCVAILKRHRRKIMDEQM  425

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLF  210
            +FDTLL+FINEL GHI+LE+TLRD EALCL AGE G A IPPGTPPSLP+  +  F
Sbjct  426  EFDTLLKFINELSGHIELESTLRDTEALCLFAGEKGTACIPPGTPPSLPVVEVDAF  481



>dbj|BAK05291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=680

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESE+FWCF +LMERLG NF  DQNGM+ QL  LSKLVELLD  LHNYF+Q DC
Sbjct  497  ILYVMEDESEAFWCFASLMERLGGNFNRDQNGMHAQLLGLSKLVELLDPSLHNYFRQNDC  556

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQ KREF F++ + LWEVLWT + +EH HLY+CV IL+RYR +IIGE M
Sbjct  557  LNYFFCFRWVLIQCKREFSFDQIMLLWEVLWTHYFSEHFHLYLCVGILRRYRLRIIGEGM  616

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTPPS+PI+ +  L+ QE
Sbjct  617  DFDTLLKFINELSGQINIDRAIQDAEALCTIAGERGADCIPPGTPPSMPIETDGGLYLQE  676

Query  200  DD  195
            DD
Sbjct  677  DD  678



>ref|XP_002972350.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
 gb|EFJ26436.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
Length=337

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VMRDE E+FW F +LMERLGPNF  DQNGM++QL ALSKLV+LLD  L  YF Q +C
Sbjct  145  ILFVMRDEEEAFWSFASLMERLGPNFHRDQNGMHSQLLALSKLVQLLDPPLQEYFGQVEC  204

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREF ++  L LWEVLWT+H++EH HLY+CVA+LKR+R KI+ E M
Sbjct  205  LNYFFCFRWILIQFKREFVYDDVLALWEVLWTRHMSEHFHLYICVALLKRHRRKIMDEHM  264

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSL  234
             FDTLL+FINEL GHI+L +TL  AE LC  AG+ GAA IPPGTPP+L
Sbjct  265  VFDTLLKFINELSGHINLVSTLHGAETLCRLAGDAGAACIPPGTPPAL  312



>ref|XP_002971826.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
 gb|EFJ26743.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
Length=351

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VMRDE E+FW F +LMERLGPNF  DQNGM++QL ALSKLV+LLD  L  YF Q +C
Sbjct  159  ILFVMRDEEEAFWSFASLMERLGPNFHRDQNGMHSQLLALSKLVQLLDPPLQEYFGQVEC  218

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRWILIQFKREF ++  L LWEVLWT+H++EH HLY+CVA+LKR+R KI+ E M
Sbjct  219  LNYFFCFRWILIQFKREFVYDDVLALWEVLWTRHMSEHFHLYICVALLKRHRRKIMDEHM  278

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSL  234
             FDTLL+FINEL GHI+L +TL  AE LC  AG+ GAA IPPGTPP+L
Sbjct  279  VFDTLLKFINELSGHINLVSTLHGAETLCRLAGDAGAACIPPGTPPAL  326



>ref|XP_010112474.1| TBC1 domain family member 15 [Morus notabilis]
 gb|EXC33718.1| TBC1 domain family member 15 [Morus notabilis]
Length=517

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 155/236 (66%), Gaps = 55/236 (23%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALME----------------------------------------  678
            IL+VM DESESFWCFV+LME                                        
Sbjct  280  ILFVMGDESESFWCFVSLMERLGPNFNRDQNGMHTQLFAISKFSGNISLAYGGSLGSEER  339

Query  677  -----------RLGPNFQ-LDQNGMNTQLFALS--KLVELLDGLLHNYFKQKDCLNYLXC  540
                       RL  N Q +D++  N++       +LVELLD  LH+YFKQ DCLNY  C
Sbjct  340  KLYKRGKRREKRLSGNKQKVDKSWNNSKQGRKQTLELVELLDSPLHSYFKQHDCLNYFFC  399

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLY+CVAILKR R+KII E+MDFDTLL
Sbjct  400  FRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYLCVAILKRQRNKIISEQMDFDTLL  459

Query  359  EFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-QNLLLFSQEDD  195
            +FINEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI  N LL+ QEDD
Sbjct  460  KFINELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIADNGLLYPQEDD  515



>gb|EMT03185.1| TBC1 domain family member 15 [Aegilops tauschii]
Length=591

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 133/182 (73%), Gaps = 18/182 (10%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESE+FWCF +LMERLG NF  DQNGM+ QL  LSKLVELLD  LHNYF+Q DC
Sbjct  425  ILYVMEDESEAFWCFASLMERLGGNFNRDQNGMHAQLLGLSKLVELLDPSLHNYFRQNDC  484

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKR F                  EH HLY+CV ILKRYR +IIGE M
Sbjct  485  LNYFFCFRWVLIQFKRFF-----------------AEHFHLYLCVGILKRYRLRIIGEGM  527

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ-NLLLFSQE  201
            DFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTPPS+PI+ +  L+ QE
Sbjct  528  DFDTLLKFINELSGQINIDRAIQDAEALCTIAGEAGADCIPPGTPPSMPIETDGGLYLQE  587

Query  200  DD  195
            DD
Sbjct  588  DD  589



>ref|XP_009789609.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Nicotiana 
sylvestris]
Length=626

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  614  KLVELLDGLLHNYFKQKDCLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHL  435
            +LVELLD  LH+YFKQKDCLNY  CFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHL
Sbjct  483  QLVELLDNPLHDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHL  542

Query  434  YVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  255
            YVCVAIL+RYRSKIIGE+MDFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IP
Sbjct  543  YVCVAILRRYRSKIIGEEMDFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIP  602

Query  254  PGTPPSLPIQNLLL-FSQEDDDVM  186
            PGTPPS P +   + + Q+DDDV+
Sbjct  603  PGTPPSFPFEGTSMCYQQDDDDVL  626



>ref|XP_009593350.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -3

Query  614  KLVELLDGLLHNYFKQKDCLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHL  435
            +LVELLD  LH+YFKQKDCLNY  CFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHL
Sbjct  483  QLVELLDNPLHDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHL  542

Query  434  YVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  255
            YVCVAIL+RYRSKIIGE+MDFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IP
Sbjct  543  YVCVAILRRYRSKIIGEEMDFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIP  602

Query  254  PGTPPSLPIQNLLLFSQEDDD  192
            PGTPPS P +   ++ Q+DDD
Sbjct  603  PGTPPSFPFEGTSMYYQQDDD  623



>gb|EEC73873.1| hypothetical protein OsI_08649 [Oryza sativa Indica Group]
Length=682

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESESFWCF  LMERLG NF  DQNGM+ QL ALSKLVELLD  LHNYF++ DC
Sbjct  494  ILYVMEDESESFWCFAILMERLGANFNRDQNGMHAQLLALSKLVELLDPQLHNYFRKNDC  553

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQFKREF F++ + LWEVLWT + +EH HLY+CVAILKRYRS+IIGE+M
Sbjct  554  LNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYWSEHFHLYLCVAILKRYRSRIIGEQM  613

Query  377  DFDTLLEFINELGGHIDLETTLR  309
            DFDTLL+FINEL G I+L+  ++
Sbjct  614  DFDTLLKFINELSGEINLDRAIQ  636



>gb|EMS58117.1| TBC1 domain family member 15 [Triticum urartu]
Length=583

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 118/183 (64%), Gaps = 36/183 (20%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DESE+FWCF +LMERLG NF  DQNGM+ QL  LSKLVELLD  LHNYF+Q DC
Sbjct  392  ILYVMEDESEAFWCFASLMERLGGNFNRDQNGMHAQLLGLSKLVELLDPSLHNYFRQNDC  451

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LNY  CFRW+LIQF                                  KRYR +IIGE M
Sbjct  452  LNYFFCFRWVLIQF----------------------------------KRYRLRIIGEGM  477

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ--NLLLFSQ  204
            DFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTPPS+PI+    LL S 
Sbjct  478  DFDTLLKFINELSGQINIDRAIQDAEALCSIAGEAGADCIPPGTPPSMPIETDGGLLQSP  537

Query  203  EDD  195
            E D
Sbjct  538  ESD  540



>emb|CBI28233.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  518  FKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELG  339
            + REFE+EKT+RLWE+LWT +L++HLHLYVCVAILK YR  I+GE+M FDTLL+FINEL 
Sbjct  43   YDREFEYEKTMRLWEMLWTHYLSKHLHLYVCVAILKGYRDNIMGEQMSFDTLLKFINELR  102

Query  338  GHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQEDD  195
            G IDL+  LRDA+ALC+CAGE GAA IPPGTPPSLPI + LL+ Q+DD
Sbjct  103  GQIDLDAILRDAQALCICAGENGAASIPPGTPPSLPIDSGLLYPQQDD  150



>gb|ABK92630.1| unknown [Populus trichocarpa]
Length=102

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 2/100 (2%)
 Frame = -3

Query  488  LRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLR  309
            +RLWEVLWT +L+EHLHLYVCVAILKRYR KI+GE MDFDTLL+FINEL GHIDL+  LR
Sbjct  1    MRLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGEHMDFDTLLKFINELSGHIDLDAILR  60

Query  308  DAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQEDD  195
            DAEALC+CAGE GAA IPPGTPPSLP   +N LL++Q+D+
Sbjct  61   DAEALCICAGENGAAHIPPGTPPSLPTENENALLYAQDDE  100



>gb|EPS74110.1| hypothetical protein M569_00644 [Genlisea aurea]
Length=202

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 99/139 (71%), Gaps = 20/139 (14%)
 Frame = -3

Query  614  KLVELLDGLLHNYFKQKDCLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHL  435
            +LVELLD  LH Y +                   R F+++ T+RLW+VLWT + +EHLHL
Sbjct  71   QLVELLDRQLHKYLES------------------RNFDYDSTMRLWKVLWTHYPSEHLHL  112

Query  434  YVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  255
            YVCVAILK++RSKII E+M FDTLL+FINEL G + ++  LRDAEALC+CAGE GAA IP
Sbjct  113  YVCVAILKKHRSKIIREEMSFDTLLKFINELSGQMKVDEILRDAEALCICAGENGAASIP  172

Query  254  PGTPPSLPIQN--LLLFSQ  204
            PGTPPSLPI +   LL+SQ
Sbjct  173  PGTPPSLPIDDDSSLLYSQ  191



>ref|XP_010656460.1| PREDICTED: GTPase-activating protein GYP7-like [Vitis vinifera]
Length=100

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  488  LRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLR  309
            +RLWE+LWT +L++HLHLYVCVAILK YR  I+GE+M FDTLL+FINEL G IDL+  LR
Sbjct  1    MRLWEMLWTHYLSKHLHLYVCVAILKGYRDNIMGEQMSFDTLLKFINELRGQIDLDAILR  60

Query  308  DAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQEDD  195
            DA+ALC+CAGE GAA IPPGTPPSLPI + LL+ Q+DD
Sbjct  61   DAQALCICAGENGAASIPPGTPPSLPIDSGLLYPQQDD  98



>emb|CAN75817.1| hypothetical protein VITISV_033040 [Vitis vinifera]
Length=100

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -3

Query  488  LRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLR  309
            +RLWE LWT +L++HLHLYVCVAILK YR  I+GE+M FDTLL+FINEL G IDL+  LR
Sbjct  1    MRLWEXLWTHYLSKHLHLYVCVAILKGYRDNIMGEQMSFDTLLKFINELRGQIDLDAILR  60

Query  308  DAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQEDD  195
            DA+ALC+CAGE GAA IPPGTPPSLPI + LL+ Q+DD
Sbjct  61   DAQALCICAGENGAASIPPGTPPSLPIDSGLLYPQQDD  98



>ref|XP_005649420.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
 gb|EIE24876.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
Length=656

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 104/157 (66%), Gaps = 1/157 (1%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM DE+E+FWCF  LME+L  NF  D  GM +QL ALS L+ +LD  L ++ + K+ 
Sbjct  490  ILYVMHDEAEAFWCFACLMEKLEANFHTDCRGMQSQLVALSSLMSILDPQLTSFLESKEA  549

Query  557  LNYLXCFRWILIQFKREF-EFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             NY  C+RW+LI FKREF  +E+ LRLWE LW++H++ H H+++C  +L  +R  I+   
Sbjct  550  TNYYFCYRWLLILFKREFSSYEEVLRLWEALWSRHISPHFHIFMCAGVLGLHRRAIMDAD  609

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYG  270
            +DFD +L +  +L G +DL   LR AE L L AG  G
Sbjct  610  LDFDGILRYCIQLSGKLDLHQVLRCAEKLALLAGTAG  646



>gb|EPS72188.1| hypothetical protein M569_02568, partial [Genlisea aurea]
Length=112

 Score =   150 bits (379),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  686  LMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXCFRWILIQFKRE  507
            LMERLGPNF  DQ+GM++Q FALSKLVELLD  LH Y + +DCLNY  CFRWILIQFKRE
Sbjct  1    LMERLGPNFNRDQSGMHSQFFALSKLVELLDRQLHKYLEARDCLNYFFCFRWILIQFKRE  60

Query  506  FEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFI  351
            F+++  +RL   ++      HLH YVCVAILK++RSKII E+M FDTLL+FI
Sbjct  61   FDYDSMMRLSGDVYVCVQKCHLHFYVCVAILKKHRSKIIKEEMSFDTLLKFI  112



>ref|XP_001692974.1| RabGAP/TBC protein [Chlamydomonas reinhardtii]
 gb|EDP03543.1| RabGAP/TBC protein [Chlamydomonas reinhardtii]
Length=302

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L VMRDE+E+FW   ALMER GP F  D  GM+ QL AL +LV+LLD  LH   + +DC
Sbjct  139  LLVVMRDEAEAFWALAALMERHGPCFAADLAGMSGQLAALRQLVQLLDPPLHAALEARDC  198

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            L+Y   FRW+LI FKREF+F+  L LWE  W    T HLHLY+  A+L  +R  I+   +
Sbjct  199  LSYYFAFRWLLIHFKREFKFDDVLSLWESCWACRRTRHLHLYLAAAVLIHHRRLILASDL  258

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYG  270
            DFD +L F   L G +DL   L  AEAL    GE G
Sbjct  259  DFDGMLRFCIGLEGKMDLRPLLDIAEALVGYGGEAG  294



>emb|CEG81743.1| hypothetical protein RMATCC62417_15905 [Rhizopus microsporus]
Length=794

 Score =   154 bits (390),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 68/148 (46%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +LH  F++ D 
Sbjct  592  LFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVLHKRFEEIDI  651

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREF++E  +RLWE LWT HLT+ + L++ +A++  +R KI+ E  
Sbjct  652  SNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLTKKMILFIALAVIDTHREKILNELS  711

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L +IN+L G+IDL  TL  AE L
Sbjct  712  QFDEVLRYINDLTGNIDLNRTLERAEVL  739



>gb|KIO13611.1| hypothetical protein M404DRAFT_993164 [Pisolithus tinctorius 
Marx 270]
Length=844

 Score =   153 bits (386),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVMRDESE--SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+ D  E  +FWCFV +M R+G NF  DQ+GM  QL  L +L+ ++D  L+ +F++ D
Sbjct  632  LYVVMDTEEELTFWCFVKVMNRMGENFLRDQSGMKKQLLTLQELISVMDPELYRHFEKTD  691

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEVLWT + + +  L+V +A+L+ +R  I+   
Sbjct  692  GLNLFFCFRWVLIAFKREFVFDDVLRLWEVLWTDYYSNNFVLFVALAVLESHRDMILRYL  751

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  752  VEFDEVLKYCNELSMTIELDSTLAQAEVLFL  782



>ref|XP_009542802.1| hypothetical protein HETIRDRAFT_471290 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86015.1| hypothetical protein HETIRDRAFT_471290 [Heterobasidion irregulare 
TC 32-1]
Length=833

 Score =   152 bits (385),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFVA+M R+  NF  DQ+GM  QL  L +L+E++D  L  + ++ D LN   C
Sbjct  633  DEPSTFWCFVAVMNRMKQNFLRDQSGMKKQLSTLQQLIEVMDPELFRHLEKTDGLNLFFC  692

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + T+   L+V +A+L+ +R  II   ++FD +L
Sbjct  693  FRWVLIAFKREFPFDDVLRLWEVLWTDYYTKSFVLFVALAVLESHREVIIRYLVEFDEIL  752

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L+TTL  AE L L
Sbjct  753  KYCNELSMTIELDTTLAQAEVLFL  776



>emb|CEG74578.1| hypothetical protein RMATCC62417_09764 [Rhizopus microsporus]
Length=776

 Score =   152 bits (383),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +LH  F++ D 
Sbjct  574  LFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVLHKRFEEIDI  633

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREF++E  +RLWE LWT HL + + L++ +A++  +R KI+ E  
Sbjct  634  SNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLAKKMILFIALAVIDTHREKILNELN  693

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L +IN+L G+IDL  TL  AE L
Sbjct  694  QFDEVLRYINDLTGNIDLNHTLERAEVL  721



>emb|CEG74577.1| hypothetical protein RMATCC62417_09764 [Rhizopus microsporus]
Length=794

 Score =   152 bits (383),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +LH  F++ D 
Sbjct  592  LFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVLHKRFEEIDI  651

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREF++E  +RLWE LWT HL + + L++ +A++  +R KI+ E  
Sbjct  652  SNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLAKKMILFIALAVIDTHREKILNELN  711

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L +IN+L G+IDL  TL  AE L
Sbjct  712  QFDEVLRYINDLTGNIDLNHTLERAEVL  739



>gb|KIM49181.1| hypothetical protein M413DRAFT_438347 [Hebeloma cylindrosporum 
h7]
Length=843

 Score =   152 bits (384),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE+ +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  L  + ++ D LN   C
Sbjct  642  DENLTFWCFVEVMNRMKQNFLRDQSGMKKQLSTLQQLIEVMDPELFRHLEKTDALNLFFC  701

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF FE  LRLWEVLWT + T    L+V +A+L+ +R  I+   ++FD +L
Sbjct  702  FRWVLIAFKREFPFEDVLRLWEVLWTDYYTSEFVLFVALAVLESHRDMILRYLVEFDEIL  761

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L+TTL  AE L L
Sbjct  762  KYCNELSMTIELDTTLNQAEVLFL  785



>gb|KIP09589.1| hypothetical protein PHLGIDRAFT_67361 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=815

 Score =   151 bits (382),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 70/144 (49%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  SFWCFVA+M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   C
Sbjct  616  DEELSFWCFVAIMARMKQNFLRDQSGMKRQLSTLQQLIHVMDPDLYRHLEKADALNLFFC  675

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRWILI FKREF FE  LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  676  FRWILIAFKREFPFEDVLRLWEVLWTDYYSNSFVLFVALAVLESHRDVIMRYLVEFDEIL  735

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L+TTL  AE L L
Sbjct  736  KYCNELSMTIELDTTLAQAEVLFL  759



>emb|CEI91235.1| hypothetical protein RMCBS344292_05533 [Rhizopus microsporus]
Length=838

 Score =   151 bits (382),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +LH  F++ D 
Sbjct  636  LFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVLHKRFEEIDI  695

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREF++E  +RLWE LWT HL + + L++ +A++  +R KI+ E  
Sbjct  696  SNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLAKKMILFIALAVIDTHREKILNELN  755

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L +IN+L G+IDL  TL  AE L
Sbjct  756  QFDEVLRYINDLTGNIDLNHTLERAEVL  783



>ref|XP_007345802.1| RabGAP/TBC [Auricularia delicata TFB-10046 SS5]
 gb|EJD46165.1| RabGAP/TBC [Auricularia delicata TFB-10046 SS5]
Length=807

 Score =   151 bits (381),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 65/144 (45%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE+ +FWCFV +M R+ PNF  DQ+GM  QL  L +L+ ++D  ++ + ++ D LN   C
Sbjct  593  DEALTFWCFVEVMNRMKPNFARDQSGMKKQLLTLQQLIAVMDPEIYRHLEKIDGLNLFFC  652

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+++ +R  I+   ++FD +L
Sbjct  653  FRWVLIAFKREFGFDDVLRLWEVLWTDYYSNQFVLFVALAVIESHRDVILRYLVEFDEIL  712

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL G I+L++TL  AE L L
Sbjct  713  KYCNELSGTIELDSTLAQAEVLFL  736



>ref|XP_007764671.1| GTPase-activating protein gyp7 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW85062.1| GTPase-activating protein gyp7 [Coniophora puteana RWD-64-598 
SS2]
Length=817

 Score =   151 bits (381),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 71/151 (47%), Positives = 101/151 (67%), Gaps = 1/151 (1%)
 Frame = -3

Query  737  ILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            I  VM  DE  +FWCFV +M+R+  NF  DQ+GM  QL AL +L+ ++D  L+ +F+Q D
Sbjct  609  IFVVMGSDEELTFWCFVEVMKRMKQNFLRDQSGMKRQLSALQELIGMMDPELYRHFEQAD  668

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEV WT + + +  L+V +AIL+ +R  I+   
Sbjct  669  GLNLFFCFRWVLIAFKREFSFDDVLRLWEVFWTDYYSNNFVLFVALAILESHRDMILRYL  728

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  729  VEFDEILKYCNELSMTIELDSTLAQAEVLFL  759



>gb|EPT06212.1| hypothetical protein FOMPIDRAFT_1110507 [Fomitopsis pinicola 
FP-58527 SS1]
Length=816

 Score =   151 bits (381),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 67/144 (47%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M+R+  NF  DQ+GM  QL  L +L+ ++D  L+ +F++ D LN   C
Sbjct  614  DEELTFWCFVEIMDRMKQNFLRDQSGMRKQLSTLQQLISVMDPELYRHFEKTDALNLFFC  673

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRWILI FKREF FE  LRLWEVLWT + + +  L+V +A+L+ +R  ++   ++FD +L
Sbjct  674  FRWILIAFKREFPFEDVLRLWEVLWTDYYSNNFVLFVALAVLESHRDVVLRYLVEFDEIL  733

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  734  KYCNELSMTIELDSTLAQAEVLFL  757



>ref|XP_002609518.1| hypothetical protein BRAFLDRAFT_95612 [Branchiostoma floridae]
 gb|EEN65528.1| hypothetical protein BRAFLDRAFT_95612 [Branchiostoma floridae]
Length=445

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 108/181 (60%), Gaps = 8/181 (4%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL VM +E ++FWC V  M+R+  NF+ DQ GM TQL  L  LV  LD  ++ Y + K+ 
Sbjct  238  ILMVMENEVDAFWCLVGFMDRVHHNFETDQQGMKTQLIQLQTLVHFLDPQMYTYLESKES  297

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+LIQFKREF F   +RLWEV WT +L ++ HL +C+AIL   +S ++   +
Sbjct  298  ANMYFCFRWLLIQFKREFSFPDIMRLWEVHWTDYLCQNFHLLLCMAILDTEKSAMMDNYL  357

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQED  198
             F+ +L+ IN+L  HID+E  ++ AE + +   E     IP       PI+++L    E 
Sbjct  358  GFNEILKHINDLSLHIDVEDIMKKAEGIYIQIAE--CRDIPK------PIRDILAIKSER  409

Query  197  D  195
            D
Sbjct  410  D  410



>gb|EMD38374.1| hypothetical protein CERSUDRAFT_113536 [Ceriporiopsis subvermispora 
B]
Length=814

 Score =   150 bits (379),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 70/158 (44%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  734  LYVMRDESE--SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            +YV+ D  E  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D
Sbjct  603  IYVVMDADEELTFWCFVEVMNRMKQNFSRDQSGMKKQLSTLQQLISVMDPELYRHLEKSD  662

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRWILI FKREF FE  LRLWE+LWT + T    L+V +A+L+ +R  I+   
Sbjct  663  GLNLFFCFRWILIAFKREFPFEDVLRLWEILWTNYYTNSFVLFVALAVLESHRDVILRYL  722

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGA  267
            ++FD +L++ NEL   I+L++TL  AE L L   ++ A
Sbjct  723  VEFDEILKYCNELSMTIELDSTLAQAEVLFLSFAQFVA  760



>gb|KIK30947.1| hypothetical protein PISMIDRAFT_86279 [Pisolithus microcarpus 
441]
Length=824

 Score =   150 bits (379),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 70/158 (44%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  734  LYVMRDESE--SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+ D  E  +FWCFV +M R+G NF  DQ+GM  QL  L  L+ ++D  L+ +F++ D
Sbjct  612  LYVVMDMEEELTFWCFVQVMNRVGQNFLRDQSGMKKQLLTLQDLISVMDPELYRHFEKAD  671

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEVLWT + + +  L+V +A+L+ +R  I+   
Sbjct  672  GLNLFFCFRWVLIAFKREFAFDDVLRLWEVLWTDYYSNNFVLFVALAVLESHRDPILRYL  731

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGA  267
             +FD +L++ N+L   I+L++TL  AE L L   +  A
Sbjct  732  PEFDEILKYCNDLSMTIELDSTLAQAEVLFLSYAQLAA  769



>gb|KDR81554.1| hypothetical protein GALMADRAFT_221417 [Galerina marginata CBS 
339.88]
Length=825

 Score =   150 bits (378),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVMR--DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   +E  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  L  + ++ D
Sbjct  616  LYVVMAGNEEMTFWCFVEVMNRMKQNFMRDQSGMKKQLSTLQQLIEVMDPELFRHLEKTD  675

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF FE  L+LWEVLWT++ T    L+V +A+L+ +R  I+   
Sbjct  676  ALNLFFCFRWVLISFKREFPFEDVLQLWEVLWTEYYTSGFVLFVALAVLESHRDMILRYL  735

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  736  VEFDEILKYCNELSMTIELDTTLSQAEVLFL  766



>gb|KIM62089.1| hypothetical protein SCLCIDRAFT_1178195 [Scleroderma citrinum 
Foug A]
Length=840

 Score =   150 bits (378),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 69/151 (46%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   +E  +FWCFV +M R+G NF  DQ+GM  QL  L +L+ +LD  L+ + ++ D
Sbjct  630  LYVVMGTEEELTFWCFVEVMHRMGQNFLRDQSGMKKQLLTLQELISVLDPELYRHLEKTD  689

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEV WT + + +  L+V +A+L+ +R  II   
Sbjct  690  GLNLFFCFRWVLIAFKREFAFDDVLRLWEVFWTDYYSNNFVLFVALAVLESHRDMIIRYL  749

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  750  LEFDEILKYCNELSMTIELDSTLAQAEVLFL  780



>gb|KII88599.1| hypothetical protein PLICRDRAFT_41787 [Plicaturopsis crispa FD-325 
SS-3]
Length=831

 Score =   150 bits (378),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 67/144 (47%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  L+ + ++ D LN   C
Sbjct  626  DEELTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLIEVMDPELYRHLEKTDGLNLFFC  685

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  686  FRWVLIAFKREFPFDDVLRLWEVLWTDYYSNDFVLFVALAVLESHRDMILRYLVEFDEIL  745

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L+TTL  AE L L
Sbjct  746  KYCNELSMTIELDTTLAQAEVLFL  769



>gb|KIM21739.1| hypothetical protein M408DRAFT_29311 [Serendipita vermifera MAFF 
305830]
Length=830

 Score =   149 bits (377),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = -3

Query  737  ILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            I  +M+ DE  +FWCF ALMER+  NF  DQ+GM  QL  L +LV ++D  L+ +F+  D
Sbjct  615  IYVIMKGDEVMTFWCFAALMERMKKNFLRDQSGMKRQLATLQQLVAVMDPELYKHFENTD  674

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  L LWEVLWT H +    L+V +A+L+ +R  I+   
Sbjct  675  SLNLFFCFRWVLIAFKREFPFDDVLSLWEVLWTDHYSNEFLLFVALAVLESHREPILRYL  734

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            + FD +L++ N+L   I+L++TL  AE L L
Sbjct  735  VGFDEVLKYCNQLSMTIELDSTLAQAEVLFL  765



>emb|CEP17529.1| hypothetical protein [Parasitella parasitica]
Length=813

 Score =   149 bits (376),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 65/148 (44%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +   M DE+ +FW F A M+R+  NF +DQ+GM+ QL  L  L+  +D  LH   ++ + 
Sbjct  598  LFVAMGDEALAFWAFTAFMDRVQSNFYMDQSGMHGQLKTLDSLIHFMDPELHKRLEETET  657

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREFE+E  +RLWEVLWT HL++ + L++ +A++  +R  I+ E  
Sbjct  658  SNLFFCFRWLLVWFKREFEWEDVIRLWEVLWTDHLSDKMILFIALAVIDAHRKTILEELN  717

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++IN+L G+I LE TL  AE L
Sbjct  718  QFDEILKYINDLTGNIPLEPTLERAEVL  745



>emb|CCA66945.1| probable GTPase activating protein [Piriformospora indica DSM 
11827]
Length=792

 Score =   149 bits (375),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = -3

Query  737  ILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            I  VM+ DE  +FWCF ALM+R+  NF  DQ+GM  QL  L +LV ++D  L+ +F++ D
Sbjct  582  IYVVMKGDEVMTFWCFAALMDRMKQNFLRDQSGMKRQLATLQQLVAVMDPELYKHFEKCD  641

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  L LWEVLWT H +    L+V +A+L+ +R  I+   
Sbjct  642  SLNLFFCFRWVLIAFKREFPFDDVLGLWEVLWTNHYSSQFLLFVALAVLESHRDSILRYL  701

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ N L   I+L++TL  AE L L
Sbjct  702  VEFDEILKYCNHLSMTIELDSTLAQAEVLFL  732



>ref|XP_007361169.1| RabGAP/TBC [Dichomitus squalens LYAD-421 SS1]
 gb|EJF65907.1| RabGAP/TBC [Dichomitus squalens LYAD-421 SS1]
Length=818

 Score =   149 bits (375),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 67/144 (47%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M+R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   C
Sbjct  614  DEEMTFWCFVQIMDRMKQNFLRDQSGMKKQLSTLQQLISVMDPELYRHLEKTDGLNLFFC  673

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRWILI FKREF FE  LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  674  FRWILISFKREFPFEDVLRLWEVLWTDYYSTQFVLFVALAVLESHRDVILRYLVEFDEIL  733

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  734  KYCNELSMSIELDSTLAQAEVLFL  757



>gb|KEP45951.1| GTPase-activating protein Gyp7 [Rhizoctonia solani 123E]
Length=845

 Score =   149 bits (376),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 67/144 (47%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE ++FWCFV +ME +  NF  DQ+GM  QL AL +L+ ++D  L+ + ++ D LN   C
Sbjct  633  DEVKTFWCFVEVMEHMKQNFLRDQSGMKKQLSALQQLLSVMDPELYRHLEKADALNLFFC  692

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ +R  II   ++FD +L
Sbjct  693  FRWVLISFKREFPFDDVLRLWEVLWTNYYTNQFVLFVALAVLESHRDVIIRYLIEFDEIL  752

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ N+L   I+L++TL  AE L L
Sbjct  753  KYCNDLSMTIELDSTLAQAEVLFL  776



>gb|KDQ60762.1| hypothetical protein JAAARDRAFT_204574 [Jaapia argillacea MUCL 
33604]
Length=849

 Score =   149 bits (376),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 71/151 (47%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = -3

Query  737  ILYVMRDESES-FWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            +  VM  E ES FWCFV +M R+  NF  DQ+GM  QL  L +L+ L+D  L+ + ++ D
Sbjct  632  VYVVMGAEEESTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLIGLMDPELYRHLEKTD  691

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ +R  I+   
Sbjct  692  GLNLFFCFRWVLIAFKREFAFDDVLRLWEVLWTDYYTNEFVLFVALAVLESHRDVILRYL  751

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  752  VEFDEILKYCNELSMTIELDTTLAQAEVLFL  782



>emb|CEI91236.1| hypothetical protein RMCBS344292_05534 [Rhizopus microsporus]
Length=414

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +LH  F++ D 
Sbjct  212  LFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVLHKRFEEIDI  271

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREF++E  ++LWE LWT HLT+ + L++ +A++  +R KI+ E  
Sbjct  272  SNLFFCFRWLLVWFKREFDWEDIIKLWENLWTDHLTKKMILFIALAVIDTHREKILNELN  331

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L +IN+L G+IDL  TL  AE L
Sbjct  332  QFDEVLRYINDLTGNIDLNHTLERAEVL  359



>ref|XP_007385727.1| RabGAP/TBC [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN07434.1| RabGAP/TBC [Punctularia strigosozonata HHB-11173 SS5]
Length=853

 Score =   149 bits (375),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 68/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   C
Sbjct  646  DEELTFWCFVEVMNRMKRNFLRDQSGMKQQLSTLQQLIAVMDPELYRHLEKTDALNLFFC  705

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRWILI FKREF FE  LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  706  FRWILITFKREFPFEDVLRLWEVLWTDYYSNEFVLFVALAVLESHRDVILRYLVEFDEIL  765

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+LE+TL  AE L L
Sbjct  766  KYCNELSMTIELESTLAQAEVLFL  789



>ref|XP_008045239.1| RabGAP/TBC [Trametes versicolor FP-101664 SS1]
 gb|EIW51710.1| RabGAP/TBC [Trametes versicolor FP-101664 SS1]
Length=812

 Score =   149 bits (375),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 67/144 (47%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +MER+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   C
Sbjct  613  DEEMTFWCFVEIMERMKHNFLRDQSGMKKQLSTLQQLISVMDPELYRHLEKTDGLNLFFC  672

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRWILI FKREF F+  LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  673  FRWILITFKREFPFDDVLRLWEVLWTDYYSTQFVLFVALAVLESHRDVILRYLVEFDEIL  732

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  733  KYCNELSMSIELDSTLAQAEVLFL  756



>emb|CEI91237.1| hypothetical protein RMCBS344292_05534 [Rhizopus microsporus]
Length=432

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +LH  F++ D 
Sbjct  230  LFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVLHKRFEEIDI  289

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREF++E  ++LWE LWT HLT+ + L++ +A++  +R KI+ E  
Sbjct  290  SNLFFCFRWLLVWFKREFDWEDIIKLWENLWTDHLTKKMILFIALAVIDTHREKILNELN  349

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L +IN+L G+IDL  TL  AE L
Sbjct  350  QFDEVLRYINDLTGNIDLNHTLERAEVL  377



>gb|EUC67275.1| GTPase-activating protein GYP7, partial [Rhizoctonia solani AG-3 
Rhs1AP]
Length=762

 Score =   148 bits (373),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 74/183 (40%), Positives = 107/183 (58%), Gaps = 20/183 (11%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE ++FWCFV +ME +  NF  DQ+GM  QL AL +L+ ++D  L+ + ++ D LN   C
Sbjct  552  DEVKTFWCFVEVMEHMKQNFLRDQSGMKKQLSALQQLLSVMDPELYRHLEKADALNLFFC  611

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ +R  I+   ++FD +L
Sbjct  612  FRWVLISFKREFPFDDVLRLWEVLWTNYYTNQFVLFVALAVLESHRDVIMRYLIEFDEIL  671

Query  359  EFINELGGHIDLETTLRDAEALCLC---------AGEYGAARIP-----------PGTPP  240
            ++ N+L   I+L++TL  AE L L            E G +  P           P +P 
Sbjct  672  KYCNDLSMTIELDSTLAQAEVLFLSFQQTDIDRRQTEQGLSSSPGGLRRRRGDSRPNSPT  731

Query  239  SLP  231
            SLP
Sbjct  732  SLP  734



>gb|KIO32502.1| hypothetical protein M407DRAFT_241400 [Tulasnella calospora MUT 
4182]
Length=784

 Score =   148 bits (373),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DE ESFWCFVA M+R   NF  DQ+GM  QL  L  L+ ++D  L+ +F++  
Sbjct  573  LYVVCGGDEVESFWCFVAFMQRTKSNFLRDQSGMRKQLSTLQNLLSVMDPELYRHFEKSG  632

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   C+RWILI FKREF FE  + LWE +WT + +   HL+V +AIL+ +R  I+   
Sbjct  633  ALNLFFCYRWILILFKREFPFENVVNLWECIWTDYYSTKFHLFVALAILESHRDVILRYL  692

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ N+L   IDL++TL  AE L L
Sbjct  693  VEFDEVLKYCNDLSMTIDLDSTLAQAEVLFL  723



>gb|EJU05764.1| RabGAP/TBC [Dacryopinax sp. DJM-731 SS1]
Length=795

 Score =   147 bits (372),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DES +FWCF   MER+ PNF  DQ+GM  QL  L +L+ ++D  L+ +F++ +
Sbjct  585  LYVVFEGDESMTFWCFTRFMERMKPNFLRDQSGMKKQLLTLQQLIAVMDPELYRHFEKTE  644

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRWILI FKREF F++ + LWE+LWT   +    L+V +A+L+ +R+ I+   
Sbjct  645  SLNLFFCFRWILIIFKREFSFDEVMSLWEILWTDCYSTQFVLFVALAVLESHRNVILRYL  704

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ N+L   IDL++TL  AE L L
Sbjct  705  VEFDEILKYCNDLSMTIDLDSTLAQAEVLFL  735



>ref|XP_006458178.1| hypothetical protein AGABI2DRAFT_183265 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV50132.1| hypothetical protein AGABI2DRAFT_183265 [Agaricus bisporus var. 
bisporus H97]
Length=1244

 Score =   149 bits (375),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -3

Query  734   LYVMRDESE--SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
             +YV+ D  E  +FWCFV  MER+  NF  DQ+GM  QL  L +L+E++D  L  +  + D
Sbjct  1036  IYVVMDADEEMTFWCFVYFMERMKKNFLRDQSGMKQQLSTLQQLIEVMDPELFRHLDKTD  1095

Query  560   CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
              LN   CFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ +R  I+   
Sbjct  1096  GLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSTQFVLFVALAVLESHRDVILRYL  1155

Query  380   MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
             ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  1156  VEFDEILKYCNELSMTIELDTTLAQAEVLFL  1186



>ref|XP_007326252.1| hypothetical protein AGABI1DRAFT_68626 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82732.1| hypothetical protein AGABI1DRAFT_68626 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=1282

 Score =   149 bits (375),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -3

Query  734   LYVMRDESE--SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
             +YV+ D  E  +FWCFV  MER+  NF  DQ+GM  QL  L +L+E++D  L  +  + D
Sbjct  1074  IYVVMDADEEMTFWCFVYFMERMKKNFLRDQSGMKQQLSTLQQLIEVMDPELFRHLDKTD  1133

Query  560   CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
              LN   CFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ +R  I+   
Sbjct  1134  GLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSTQFVLFVALAVLESHRDVILRYL  1193

Query  380   MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
             ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  1194  VEFDEILKYCNELSMTIELDTTLAQAEVLFL  1224



>gb|KJA20210.1| hypothetical protein HYPSUDRAFT_167151 [Hypholoma sublateritium 
FD-334 SS-4]
Length=846

 Score =   147 bits (372),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 69/151 (46%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVMR--DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LY++   +E  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  L  + ++ D
Sbjct  636  LYIVMAGNEEMTFWCFVEVMNRMKQNFLRDQSGMKRQLSTLQQLIEIMDPELFRHLEKTD  695

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ +R  I+   
Sbjct  696  ALNLFFCFRWVLITFKREFPFDDVLRLWEVLWTDNYTSGFVLFVALAVLESHRDMILRYL  755

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  756  VEFDEILKYCNELSMTIELDTTLSQAEVLYL  786



>ref|XP_007300987.1| RabGAP/TBC [Stereum hirsutum FP-91666 SS1]
 gb|EIM89902.1| RabGAP/TBC [Stereum hirsutum FP-91666 SS1]
Length=828

 Score =   147 bits (372),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  L+ + ++ D LN   C
Sbjct  619  DEGLTFWCFVEVMNRMKKNFLRDQSGMKKQLSTLQQLIEMMDPELYRHLEKTDGLNLFFC  678

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF FE  L LWEVLWT + T    L+V +A+L+ +R  I+   ++FD +L
Sbjct  679  FRWVLISFKREFPFEDVLSLWEVLWTDYYTADFVLFVALAVLESHRDVILRYLVEFDEIL  738

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  739  KYCNELSMTIELDSTLAQAEVLFL  762



>ref|XP_007862850.1| RabGAP/TBC, partial [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58177.1| RabGAP/TBC, partial [Gloeophyllum trabeum ATCC 11539]
Length=897

 Score =   148 bits (373),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 66/144 (46%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   C
Sbjct  693  DEEMTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQELIAMMDPELYRHLEKTDGLNLFFC  752

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + + +  L+V +AIL+ +R  I+   ++FD +L
Sbjct  753  FRWVLITFKREFPFDDVLRLWEVLWTDYYSNNFVLFVALAILESHRDVILRYLIEFDEIL  812

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  813  KYCNELSMTIELDSTLAQAEVLFL  836



>gb|KDN51536.1| hypothetical protein RSAG8_00081, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=813

 Score =   147 bits (371),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 74/185 (40%), Positives = 107/185 (58%), Gaps = 22/185 (12%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE ++FWCFV +ME +  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   C
Sbjct  601  DEVKTFWCFVEVMEHMKQNFLRDQSGMKKQLSTLQQLLSVMDPELYRHLEKTDALNLFFC  660

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ +R  I+   ++FD +L
Sbjct  661  FRWVLIAFKREFPFDDVLRLWEVLWTNYYTNQFVLFVALAVLESHRDVILRYLLEFDEIL  720

Query  359  EFINELGGHIDLETTLRDAEALCLC-----------AGEYGAARIP-----------PGT  246
            ++ N+L   I+L++TL  AE L L              E G +  P           PG+
Sbjct  721  KYCNDLSMTIELDSTLAQAEVLFLSFQQIVVDIDRRQAEQGLSSSPGTLRRRRGDSRPGS  780

Query  245  PPSLP  231
            P SLP
Sbjct  781  PVSLP  785



>ref|XP_003848770.1| hypothetical protein MYCGRDRAFT_76044, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP83746.1| hypothetical protein MYCGRDRAFT_76044 [Zymoseptoria tritici IPO323]
Length=852

 Score =   147 bits (371),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 68/148 (46%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  + +D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+LLD  L+ +  + D 
Sbjct  585  IYAIQQDDAVAFWGFTKFMERMERNFLRDQSGMRLQLTTLDQLVQLLDPKLYEHLAKVDS  644

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ FKREFEFE  LRLWE LWT +L+ + HL+   AIL+++R  I+G   
Sbjct  645  TNFFFFFRMLLVWFKREFEFEDILRLWEGLWTDYLSANFHLFFAAAILEKHRDVIMGHLK  704

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G IDL++T+  AEAL
Sbjct  705  GFDEVLKYVNELSGRIDLQSTVVRAEAL  732



>ref|XP_007805043.1| hypothetical protein EPUS_03989 [Endocarpon pusillum Z07020]
 gb|ERF69285.1| hypothetical protein EPUS_03989 [Endocarpon pusillum Z07020]
Length=1267

 Score =   148 bits (373),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737   ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
             I  VM+D++ +FW FV  M R+  NF  DQ+GM TQL  L +LV+LLD  L+ + +  D 
Sbjct  1002  IYAVMQDDAIAFWAFVGFMRRMSRNFVRDQSGMRTQLTTLDQLVQLLDPKLYLHLQSADS  1061

Query  557   LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
              N+   FR +L+ +KREFE+   LRLWE LWT +L+   HL++ VAIL+++R  I+G   
Sbjct  1062  TNFFFFFRMLLVWYKREFEWVDILRLWEGLWTDYLSSQFHLFIAVAILEKHRDVIMGHLK  1121

Query  377   DFDTLLEFINELGGHIDLETTLRDAEAL  294
              FD +L+++NEL G IDL +TL  AE L
Sbjct  1122  HFDEVLKYVNELSGTIDLPSTLVRAEGL  1149



>ref|XP_001875369.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR14810.1| predicted protein [Laccaria bicolor S238N-H82]
Length=821

 Score =   147 bits (370),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 69/151 (46%), Positives = 97/151 (64%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DE  +FWCFV  M R+  NF  DQ+GM  QL  L +L+E++D  L  + ++ D
Sbjct  613  LYVVMASDEELTFWCFVEFMNRMKQNFLRDQSGMKQQLSTLQQLIEIMDPELFRHLEKTD  672

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F   LRLWEVLWT + +    L+V +A+L+ +R  I+   
Sbjct  673  ALNLFFCFRWVLIAFKREFAFGDVLRLWEVLWTDYYSREFVLFVALAVLESHRDMILRYL  732

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  733  VEFDEILKYCNELSMTIELDSTLAQAEVLFL  763



>gb|KIK08687.1| hypothetical protein K443DRAFT_84333 [Laccaria amethystina LaAM-08-1]
Length=818

 Score =   147 bits (370),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 69/151 (46%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DE  +FWCFV  M+R+  NF  DQ+GM  QL  L +L+E++D  L  + ++ D
Sbjct  610  LYVVMGSDEELTFWCFVQFMDRMKQNFLRDQSGMKQQLSTLQQLIEIMDPELFRHLEKTD  669

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F   LRLWEVLWT + +    L+V +A+L+ +R  I+   
Sbjct  670  GLNLFFCFRWVLIAFKREFAFGDVLRLWEVLWTDYYSREFVLFVALAVLESHRDMILRYL  729

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  730  VEFDEILKYCNELSMTIELDSTLAQAEVLFL  760



>ref|XP_006633652.1| PREDICTED: TBC1 domain family member 15-like [Lepisosteus oculatus]
Length=641

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            ILYVM +E ++FWCFV+ ME++  NF+    GM TQL  LS L+ LLD    NY + +D 
Sbjct  417  ILYVMENEVDAFWCFVSFMEQMHQNFEEQMQGMKTQLIQLSTLLRLLDITFWNYLESQDS  476

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
                 CFRW+LI FKREF F+  LRLWEV+WT    ++ HL VC AIL   + KI+ E  
Sbjct  477  GYLYFCFRWLLICFKREFSFQDVLRLWEVMWTGLPCQNFHLLVCCAILDSEKQKIMDEHY  536

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCL  288
             F+ +L+ INEL   +D+E  L+ AEA+CL
Sbjct  537  GFNEILKHINELSMKLDVEEVLQKAEAICL  566



>gb|KFH67583.1| hypothetical protein MVEG_06315 [Mortierella verticillata NRRL 
6337]
Length=856

 Score =   147 bits (370),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 68/148 (46%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +  VM DE   FW FV LME+   NF  DQ GM +QL  L KL++ LD  L+ + ++ + 
Sbjct  658  VFAVMGDEVMGFWAFVGLMEKTKKNFYRDQVGMQSQLETLGKLIQTLDPKLYKHLEKCEA  717

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            LN   CFRW LI FKREFE+   +RLWEVL++ HL+   HL+V +AIL ++R  ++    
Sbjct  718  LNLFFCFRWFLIWFKREFEWVDIMRLWEVLFSDHLSTQFHLFVAMAILDKHRDVMMDHLQ  777

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++N+L   I+LE TL+DAE L
Sbjct  778  GFDEILKYVNDLSMTINLEETLQDAEIL  805



>ref|XP_002950778.1| hypothetical protein VOLCADRAFT_60703 [Volvox carteri f. nagariensis]
 gb|EFJ48093.1| hypothetical protein VOLCADRAFT_60703 [Volvox carteri f. nagariensis]
Length=321

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 102/156 (65%), Gaps = 0/156 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L VMRDE+E+FW F ALMERLG NF  D  GM  QL AL +LV+L+D  LH Y +++DC
Sbjct  158  LLVVMRDEAEAFWAFAALMERLGCNFHTDLQGMTLQLGALRQLVQLVDPPLHAYLERRDC  217

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
            L+Y   FRW+LI FKREF+F++ L LWE  W    T HLHLY+  A+L  +R  I+   +
Sbjct  218  LSYYFAFRWLLILFKREFKFDEVLSLWEACWACRRTRHLHLYLAAAVLVHHRRVILSSDL  277

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYG  270
            DFD LL     L G ++L+  L  AEAL   AGE G
Sbjct  278  DFDGLLRLSIALAGRLELQPLLETAEALVGYAGEAG  313



>emb|CCX13007.1| Similar to GTPase-activating protein GYP7; acc. no. P09379 [Pyronema 
omphalodes CBS 100304]
Length=798

 Score =   146 bits (368),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 69/148 (47%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  MER   NF  DQ+GM  QL AL  LV+L+D  L+ + +  D 
Sbjct  557  IYAVMQDDAVAFWAFVGFMERTERNFLRDQSGMRAQLVALDHLVQLMDPKLYAHLESADS  616

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ FKREF+++  LRLWEVLWT  L+   HL++ +AIL R+R+ I+    
Sbjct  617  TNFFFFFRMLLVWFKREFKWDDVLRLWEVLWTNFLSSQYHLFIALAILDRHRTVIMDHLR  676

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL   IDL+ TL  AEAL
Sbjct  677  QFDEVLKYVNELSNTIDLKLTLIRAEAL  704



>gb|KIL69693.1| hypothetical protein M378DRAFT_1048890 [Amanita muscaria Koide 
BX008]
Length=813

 Score =   146 bits (368),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 73/180 (41%), Positives = 105/180 (58%), Gaps = 18/180 (10%)
 Frame = -3

Query  719  DESESFWCFVALMERL-GPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLX  543
            DE  +FWCFV  MER+   NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   
Sbjct  616  DEELTFWCFVQFMERMVKQNFLRDQSGMKKQLSTLQQLINVMDPELYRHLEKSDALNLFF  675

Query  542  CFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTL  363
            CFRW+LI FKREF FE  LRLWEVLWT + + +  L+V +A+L+ +R  I+   ++FD +
Sbjct  676  CFRWVLIAFKREFSFEDVLRLWEVLWTNYYSHNFTLFVALAVLESHRDVILRYLVEFDEI  735

Query  362  LEFINELGGHIDLETTLRDAEALCLCAGEYGA-----------------ARIPPGTPPSL  234
            L++ NEL   I+L++TL  AE L L   +  A                  R  PG PP++
Sbjct  736  LKYCNELSMTIELDSTLAQAEVLFLSFAQLMADIDRKAAEAQVENLRNLRRRVPGNPPTV  795



>gb|EWC44833.1| hypothetical protein DRE_06471 [Drechslerella stenobrocha 248]
Length=804

 Score =   146 bits (368),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 68/148 (46%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V +D++ +FW FV  MER+  NF  DQ+GM  QL AL++LV L+D LL  +  + + 
Sbjct  562  IYAVFQDDAMAFWAFVGFMERMERNFLRDQSGMRAQLVALNQLVMLMDPLLWKHLDKAES  621

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREF++   LRLWE LWT +L+   HL++ +AIL+R+R+ I+    
Sbjct  622  TNFFFFFRMILVWYKREFDWSDVLRLWEALWTNYLSGQFHLFIALAILERHRTVIMDHLE  681

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++INEL G I+L +TL  AEAL
Sbjct  682  HFDEVLKYINELSGTIELNSTLVRAEAL  709



>gb|EPB92968.1| hypothetical protein HMPREF1544_00042 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=830

 Score =   146 bits (368),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 64/148 (43%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +   M DE+ +FW F A M+R+  NF +DQ+GM+ QL  L  L+  +D  L+   +  + 
Sbjct  608  LFVAMGDEAMAFWAFTAFMDRVQSNFFMDQSGMHGQLKTLDSLIHFMDPELYKRLEDTET  667

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREFE+E  +RLWEVLWT HL++ + L++ +A++  +R  I+ E  
Sbjct  668  SNLFFCFRWLLVWFKREFEWEDVIRLWEVLWTDHLSDKMILFIALAVIDAHRKTILEELN  727

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++IN+L G+I LE TL  AE L
Sbjct  728  QFDEILKYINDLTGNIPLEPTLERAEVL  755



>dbj|GAN09723.1| GTPase activating protein (Gyp7) [Mucor ambiguus]
Length=828

 Score =   145 bits (367),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 64/148 (43%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +   M DE+ +FW F A M+R+  NF +DQ+GM+ QL  L  L+  +D  L+   +  + 
Sbjct  606  LFVAMGDEAMAFWAFTAFMDRVQSNFFMDQSGMHGQLKTLDSLIHFMDPELYKRLEDTET  665

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+L+ FKREFE+E  +RLWEVLWT HL++ + L++ +A++  +R  I+ E  
Sbjct  666  SNLFFCFRWLLVWFKREFEWEDVIRLWEVLWTDHLSDKMILFIALAVIDAHRKTILEELN  725

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++IN+L G+I LE TL  AE L
Sbjct  726  QFDEILKYINDLTGNIPLEPTLERAEVL  753



>gb|KDQ18528.1| hypothetical protein BOTBODRAFT_127404 [Botryobasidium botryosum 
FD-172 SS1]
Length=815

 Score =   145 bits (367),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 64/142 (45%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE+ +FWCFV+LM+R+  NF  DQ+GM  QL  L +L+ ++D  L+ +F++ + L+   C
Sbjct  616  DEALTFWCFVSLMDRMTRNFLRDQSGMKKQLLTLQQLIAVMDPELYKHFEKTESLHLFFC  675

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + +    L+V +AIL+ +R  I+    +FD +L
Sbjct  676  FRWVLIAFKREFPFDDILRLWEVLWTDYYSNQFVLFVALAILESHRDVILRYLEEFDEIL  735

Query  359  EFINELGGHIDLETTLRDAEAL  294
            ++ N+L   I+L++TL  AE L
Sbjct  736  KYCNDLSMTIELDSTLAQAEVL  757



>gb|KIJ69240.1| hypothetical protein HYDPIDRAFT_105840 [Hydnomerulius pinastri 
MD-312]
Length=852

 Score =   145 bits (367),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 67/151 (44%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVMRDESE--SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+ +  E  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D
Sbjct  639  LYVIMEAEEELTFWCFVEVMNRMSQNFLRDQSGMKKQLSTLQELISVMDPELYRHLEKTD  698

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF FE  LRLWEVLWT + +    L+V +A+L+ +R  I+   
Sbjct  699  GLNLFFCFRWVLIAFKREFPFEDVLRLWEVLWTDYYSNSFVLFVALAVLESHRDMILRYL  758

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  +E L L
Sbjct  759  VEFDEILKYCNELSMTIELDSTLAQSEVLFL  789



>ref|XP_007776922.1| hypothetical protein W97_00820 [Coniosporium apollinis CBS 100218]
 gb|EON61605.1| hypothetical protein W97_00820 [Coniosporium apollinis CBS 100218]
Length=825

 Score =   145 bits (366),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  MER+  NF  DQ+GM  QL  L  LV+L+D  L+ + +  D 
Sbjct  576  IYAVMQDDAVAFWAFVNFMERMERNFLRDQSGMRLQLLTLDHLVQLMDPKLYLHLQSADS  635

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ FKREFE+   LRLWE LWT  L+ + HL++ +AIL+++R  I+    
Sbjct  636  TNFFFFFRMLLVWFKREFEWLDVLRLWEGLWTDWLSSNFHLFIALAILEKHRDVIMEHLQ  695

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G IDL+TTL  AEAL
Sbjct  696  RFDEVLKYVNELSGTIDLQTTLVRAEAL  723



>gb|KIY69995.1| RabGAP/TBC [Cylindrobasidium torrendii FP15055 ss-10]
Length=864

 Score =   145 bits (367),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 65/144 (45%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV  M+R+  NF  DQ+GM  QL +L +L+ ++D  L+ + ++ D LN   C
Sbjct  661  DEEMTFWCFVEQMKRMKQNFLRDQSGMKKQLLSLQELIGVMDPELYRHLEKTDGLNLFFC  720

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  LRLWEVLWT + ++   L+V +A+L+ +R  I+   ++FD +L
Sbjct  721  FRWVLIAFKREFPFDDVLRLWEVLWTDYYSKDFVLFVSLAVLESHRDMILRYLVEFDEIL  780

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  781  KYCNELSMTIELDSTLAQAEVLFL  804



>ref|XP_011111334.1| hypothetical protein H072_5454 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40684.1| hypothetical protein H072_5454 [Dactylellina haptotyla CBS 200.50]
Length=805

 Score =   145 bits (366),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V +D++ +FW FV  MER+  NF  DQ+GM  QL  L +LV+L+D +L  + ++ + 
Sbjct  564  IYAVFQDDAVAFWAFVGFMERMERNFLRDQSGMRAQLVTLDQLVQLMDPVLWKHLEKAES  623

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREFE++  LRLWE LWT +L+   HL+V +A+L+R+R+ I+    
Sbjct  624  TNFFFFFRMILVWYKREFEWDDVLRLWEGLWTNYLSGQFHLFVALAVLERHRAVIMDHLQ  683

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++INEL G I+L +TL  AEAL
Sbjct  684  HFDEVLKYINELSGTIELNSTLIRAEAL  711



>ref|XP_007395913.1| hypothetical protein PHACADRAFT_173743 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55590.1| hypothetical protein PHACADRAFT_173743 [Phanerochaete carnosa 
HHB-10118-sp]
Length=812

 Score =   145 bits (366),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 69/151 (46%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVMRDESE--SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            +YV+ D  E  +FWCFV++M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D
Sbjct  607  VYVVMDADEELTFWCFVSVMTRMKHNFLRDQSGMKKQLSTLQQLIGVMDPELYRHLEKTD  666

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRWILI FKREF FE  LRLWEVLWT   + +  L+V +A+L+ +R  I+   
Sbjct  667  ALNLFFCFRWILIAFKREFSFEDVLRLWEVLWTDCYSRNFVLFVSLAMLESHRDVIMRYL  726

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  727  VEFDEILKYCNELSMTIELDSTLAQAEVLFL  757



>gb|EKG21073.1| hypothetical protein MPH_01617 [Macrophomina phaseolina MS6]
Length=857

 Score =   145 bits (366),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  MER+  NF  DQ+GM  QL  L  LV+L+D  L+ + +  D 
Sbjct  581  IYAVMQDDAVAFWGFVGFMERMERNFLRDQSGMRKQLLTLDHLVQLIDPKLYLHLQSADS  640

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE++  LRLWE LWT +L+ + HL++ +AIL+R+R  I+    
Sbjct  641  TNFFFFFRMLLVWYKREFEWQDVLRLWEGLWTDYLSGNFHLFIALAILERHRDVIMEHLK  700

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G IDL++TL  AE L
Sbjct  701  AFDEVLKYVNELSGTIDLQSTLVRAEGL  728



>ref|XP_007267802.1| RabGAP/TBC [Fomitiporia mediterranea MF3/22]
 gb|EJD02386.1| RabGAP/TBC [Fomitiporia mediterranea MF3/22]
Length=888

 Score =   145 bits (366),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE   FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D LN   C
Sbjct  661  DEEMIFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLISVMDPELYRHLEKTDGLNLFFC  720

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  L+LWEVLWT + + +  L+V +AIL+ +R  I+   ++FD +L
Sbjct  721  FRWVLIAFKREFPFDDVLKLWEVLWTDYYSANFVLFVALAILESHRDVILRYLIEFDEIL  780

Query  359  EFINELGGHIDLETTLRDAEAL  294
            ++ NEL   I+L+TTL  AE L
Sbjct  781  KYCNELSMTIELDTTLAQAEVL  802



>gb|KIK49290.1| hypothetical protein CY34DRAFT_797241 [Suillus luteus UH-Slu-Lm8-n1]
Length=840

 Score =   145 bits (365),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D
Sbjct  631  LYVVMGSDEELTFWCFVEVMNRMIQNFLRDQSGMKKQLSTLQELISVMDPDLYRHLEKTD  690

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ +R  I+   
Sbjct  691  GLNLFFCFRWVLITFKREFPFDDVLRLWEVLWTDYYSNEFVLFVALAVLESHRDMILRYL  750

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  751  VEFDEILKYCNELSMTIELDSTLAQAEVLFL  781



>gb|KIM87015.1| hypothetical protein PILCRDRAFT_95906 [Piloderma croceum F 1598]
Length=824

 Score =   145 bits (365),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 65/144 (45%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ + LN   C
Sbjct  620  DEELTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLISVMDPELYRHLEKTEGLNLFFC  679

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF FE  LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  680  FRWVLIAFKREFPFEDILRLWEVLWTDYYSNEFVLFVALAVLESHRDVILRYLVEFDEIL  739

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  740  KYCNELSMTIELDSTLAQAEVLFL  763



>emb|CCM02409.1| predicted protein [Fibroporia radiculosa]
Length=846

 Score =   145 bits (365),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/144 (46%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ + LN   C
Sbjct  641  DEEMTFWCFVEIMTRMKQNFLRDQSGMRKQLSTLQQLISVMDPELYRHLEKTESLNLFFC  700

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRWILI FKREF F+  LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  701  FRWILIHFKREFPFKDVLRLWEVLWTDYYSNDFVLFVALAVLESHRDVILRYLVEFDEIL  760

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L+TTL  AE L L
Sbjct  761  KYCNELSMTIELDTTLAQAEVLFL  784



>ref|XP_007321851.1| hypothetical protein SERLADRAFT_452033 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO20894.1| hypothetical protein SERLADRAFT_452033 [Serpula lacrymans var. 
lacrymans S7.9]
Length=810

 Score =   144 bits (364),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DE  +FWCFV +M+ +  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D
Sbjct  597  LYVVLGSDEELTFWCFVEVMDGMKQNFLRDQSGMKRQLTMLQELISVMDPELYRHLEKTD  656

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEVLWT + + +  L+V +A+L+ +R  I+   
Sbjct  657  GLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTNYYSNNFVLFVALAVLESHRDMILRYL  716

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD LL++ NEL   I+L++TL  AE L L
Sbjct  717  VEFDELLKYCNELSMTIELDSTLAQAEVLFL  747



>dbj|GAM83758.1| hypothetical protein ANO11243_017480 [fungal sp. No.11243]
Length=815

 Score =   144 bits (364),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 68/145 (47%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = -3

Query  728  VMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNY  549
            +M D++ +FW FV  MER+  NF  DQ+GM  QL  L  LV+LLD  L+ + +  D  N+
Sbjct  577  IMLDDAIAFWAFVGFMERMERNFLRDQSGMRLQLMTLDHLVQLLDPKLYLHLQSVDSTNF  636

Query  548  LXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFD  369
               FR +L+ +KREFE+   LRLWE LWT +L+ + HL++ +AIL+++R+ II     FD
Sbjct  637  FFFFRMLLVWYKREFEWNDVLRLWEGLWTDYLSSNFHLFIAMAILEKHRNVIIDHLKGFD  696

Query  368  TLLEFINELGGHIDLETTLRDAEAL  294
             +L++INEL   IDLE+TL  AEAL
Sbjct  697  EVLKYINELSNTIDLESTLIRAEAL  721



>gb|EGN95360.1| hypothetical protein SERLA73DRAFT_162269 [Serpula lacrymans var. 
lacrymans S7.3]
Length=840

 Score =   144 bits (364),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DE  +FWCFV +M+ +  NF  DQ+GM  QL  L +L+ ++D  L+ + ++ D
Sbjct  627  LYVVLGSDEELTFWCFVEVMDGMKQNFLRDQSGMKRQLTMLQELISVMDPELYRHLEKTD  686

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F+  LRLWEVLWT + + +  L+V +A+L+ +R  I+   
Sbjct  687  GLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTNYYSNNFVLFVALAVLESHRDMILRYL  746

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD LL++ NEL   I+L++TL  AE L L
Sbjct  747  VEFDELLKYCNELSMTIELDSTLAQAEVLFL  777



>ref|XP_009063579.1| hypothetical protein LOTGIDRAFT_221303 [Lottia gigantea]
 gb|ESO85851.1| hypothetical protein LOTGIDRAFT_221303 [Lottia gigantea]
Length=649

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL +M +E ++FWCF  LMERL  NF++DQNGM  QL  + KL+++ D  L +Y +  D 
Sbjct  415  ILVIMENEVDAFWCFAGLMERLCGNFEMDQNGMKVQLSQIHKLMQVYDPELCHYLESHDS  474

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+  CFRWILI FKREF F++T RLWEV+WT    ++ HL + +AIL   +S +I  + 
Sbjct  475  GNFYFCFRWILIMFKREFHFQETQRLWEVMWTDKPCKNFHLIITLAILDNEKSTLIENQF  534

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  255
             F  +L+ IN++   I LE TL+ AE + L    Y     P
Sbjct  535  GFTEILKHINDISLAIPLEDTLKKAEGIFLQLKNYKKLPKP  575



>ref|XP_011448760.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Crassostrea 
gigas]
Length=653

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L VM +E ++FWCF  LMER+  NF++DQ GM TQL  + KL++ +D  L +Y +  D 
Sbjct  422  VLVVMENEVDAFWCFAGLMERVCDNFEMDQAGMKTQLSQIHKLMQFVDPELCSYLESHDS  481

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+  CFRW+LI FKREF F   +R WEVLWT    ++ HL +C+A+L   +S ++  K 
Sbjct  482  GNFYFCFRWLLILFKREFSFNDVMRFWEVLWTDRPCKNFHLLICLAVLDTEKSTLMENKF  541

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             F  +L+ IN++ G I LE TL+ AE +
Sbjct  542  GFTEILKHINDMSGAIHLEDTLKKAEGI  569



>dbj|GAN03755.1| GTPase-activating protein GYP7 [Mucor ambiguus]
Length=760

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 62/145 (43%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = -3

Query  728  VMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNY  549
            ++ +E  SFW F   MER+  NF  DQ+GM+ QL  +  L++ +D  L+ +F++ D  N+
Sbjct  546  IIGEEPLSFWAFAGFMERMKSNFYTDQSGMHKQLLTMDLLLQFMDPSLYKHFQRTDSTNF  605

Query  548  LXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFD  369
              CFRW+L+ +KREF ++  L LWEVLWT +LT+  HL++ ++IL ++R  II    +FD
Sbjct  606  FFCFRWLLVWYKREFPWKDMLSLWEVLWTDYLTDRFHLFIALSILDQHRDVIIEYLKNFD  665

Query  368  TLLEFINELGGHIDLETTLRDAEAL  294
             +L++IN+L   I+LE TL+ AE L
Sbjct  666  EILKYINDLSMTINLEETLQRAEIL  690



>ref|XP_011448761.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Crassostrea 
gigas]
 gb|EKC19529.1| TBC1 domain family member 15 [Crassostrea gigas]
Length=649

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L VM +E ++FWCF  LMER+  NF++DQ GM TQL  + KL++ +D  L +Y +  D 
Sbjct  418  VLVVMENEVDAFWCFAGLMERVCDNFEMDQAGMKTQLSQIHKLMQFVDPELCSYLESHDS  477

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+  CFRW+LI FKREF F   +R WEVLWT    ++ HL +C+A+L   +S ++  K 
Sbjct  478  GNFYFCFRWLLILFKREFSFNDVMRFWEVLWTDRPCKNFHLLICLAVLDTEKSTLMENKF  537

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             F  +L+ IN++ G I LE TL+ AE +
Sbjct  538  GFTEILKHINDMSGAIHLEDTLKKAEGI  565



>ref|XP_007684557.1| hypothetical protein COCMIDRAFT_85923 [Bipolaris oryzae ATCC 
44560]
 gb|EUC48959.1| hypothetical protein COCMIDRAFT_85923 [Bipolaris oryzae ATCC 
44560]
Length=808

 Score =   144 bits (362),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 64/148 (43%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L+ + +  D 
Sbjct  566  IYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKLYLHLQSADS  625

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++R  I+    
Sbjct  626  TNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKHREIIMAHLK  685

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G +DLE+TL  AE+L
Sbjct  686  HFDEVLKYVNELSGTMDLESTLVRAESL  713



>ref|XP_002911878.1| GTPase-activating protein gyp7 [Coprinopsis cinerea okayama7#130]
 gb|EFI28384.1| GTPase-activating protein gyp7 [Coprinopsis cinerea okayama7#130]
Length=815

 Score =   144 bits (362),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -3

Query  734  LYVMR--DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            LYV+   DE+ +FWCFV  M R+  NF  DQ+GM  QL  L +L+ ++D  L  + ++ D
Sbjct  608  LYVVMAGDEAMTFWCFVHYMTRMKKNFLRDQSGMKQQLSTLQQLIGVMDPELFRHLEKTD  667

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             +N   CFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ +R  I+   
Sbjct  668  GMNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSTSFVLFVALAVLESHRDMILRYL  727

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  728  VEFDEILKYCNELSMTIELDTTLAQAEVLFL  758



>emb|CEG04196.1| unnamed protein product [Fusarium sp. FIESC_5 CS3069]
Length=826

 Score =   144 bits (362),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 65/148 (44%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V++D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+ +D +L N+ ++ D 
Sbjct  586  IYAVIQDDAVAFWGFQKFMERMERNFLRDQSGMRNQLLTLDQLVQFMDPVLWNHLQKADS  645

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE+   LRLWE LWT +++ + HL++ +AIL+R+R  I+    
Sbjct  646  TNFFFFFRMLLVWYKREFEWLDVLRLWEGLWTDYMSANFHLFIALAILERHRDVIMEHLQ  705

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G IDLE TL  AE+L
Sbjct  706  HFDEVLKYVNELSGTIDLEATLIRAESL  733



>gb|KIK59737.1| hypothetical protein GYMLUDRAFT_44173 [Gymnopus luxurians FD-317 
M1]
Length=827

 Score =   144 bits (362),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 67/151 (44%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = -3

Query  737  ILYVMRDESE-SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKD  561
            +  VM+ E E +FWCF  +M+R+  NF  DQ+GM  QL  L +L+E++D  L+ + ++ D
Sbjct  621  VYVVMQAEEEMTFWCFTEIMDRMKQNFLRDQSGMKKQLSTLQQLIEVMDPDLYRHLEKTD  680

Query  560  CLNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEK  381
             LN   CFRW+LI FKREF F   L+LWEVLWT + +    L+V +AIL+ +R  I+   
Sbjct  681  GLNLFFCFRWVLIAFKREFPFNDVLKLWEVLWTDYYSNDFVLFVALAILESHRDIILRYL  740

Query  380  MDFDTLLEFINELGGHIDLETTLRDAEALCL  288
            ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  741  VEFDEILKYCNELSMTIELDSTLAQAEVLFL  771



>emb|CDO69529.1| hypothetical protein BN946_scf184785.g34 [Trametes cinnabarina]
Length=837

 Score =   144 bits (362),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 68/144 (47%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCF  +M+R+ PNF  DQ+GM  QL  L +L+ ++D  L+ +F++ D LN   C
Sbjct  635  DEEMTFWCFAKVMDRMKPNFLRDQSGMKQQLLILQQLISVMDPELYRHFEKSDALNLFFC  694

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRWILI FKREF FE+ LRLWEVLWT + +    L+V +A+L+ +R  I+   ++FD +L
Sbjct  695  FRWILIAFKREFPFEEVLRLWEVLWTDYYSTQFVLFVALAVLESHRDVILRYLVEFDEIL  754

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ NEL   I+L++TL  AE L L
Sbjct  755  KYCNELSMSIELDSTLAQAEVLFL  778



>gb|EIE81059.1| hypothetical protein RO3G_05764 [Rhizopus delemar RA 99-880]
Length=724

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L VM DE  +FW F   M R+  NF +DQ+GM+ QL  L+ L+E +D +L+  F++ + 
Sbjct  518  LLVVMDDEPMAFWAFAHFMNRVQTNFYMDQSGMHAQLKTLNCLIEFMDPVLYKRFQEIEI  577

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             +   CFRW+L+ FKREFE++  L+LWEVLWT  LT+ + L++ +A++  +R KI+ E  
Sbjct  578  TDLFFCFRWLLVWFKREFEWDDVLQLWEVLWTDWLTDKMVLFIVLAVIDTHRDKIMNELN  637

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD  L +IN+L GHIDL++TL  AE L
Sbjct  638  QFDETLRYINDLSGHIDLKSTLERAEVL  665



>ref|XP_007847684.1| gtpase-activating protein gyp7 [Moniliophthora roreri MCA 2997]
 gb|ESK93046.1| gtpase-activating protein gyp7 [Moniliophthora roreri MCA 2997]
Length=846

 Score =   143 bits (361),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 63/144 (44%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLXC  540
            DE  +FWCFV LM R+  NF  DQ+GM   L  L +L+ ++D  L+ + ++ D LN   C
Sbjct  645  DEETTFWCFVELMHRMKQNFLRDQSGMKKHLLTLQQLIGVMDPELYRHLEKTDALNLFFC  704

Query  539  FRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLL  360
            FRW+LI FKREF F+  L LWEVLWT + + +  L++ +A+L+ +R  I+   ++FD +L
Sbjct  705  FRWVLIAFKREFPFDDVLSLWEVLWTDYYSSNFVLFIALAVLESHRDVIMRYLVEFDEIL  764

Query  359  EFINELGGHIDLETTLRDAEALCL  288
            ++ N+L   I+L+TTL  AE L L
Sbjct  765  KYCNDLSMTIELDTTLAQAEVLFL  788



>ref|XP_011121238.1| hypothetical protein AOL_s00076g384 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX50033.1| hypothetical protein AOL_s00076g384 [Arthrobotrys oligospora 
ATCC 24927]
Length=808

 Score =   143 bits (361),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 66/148 (45%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V +D++ +FW FV  MER+  NF  DQ+GM  QL  L +LV L+D +L  + ++ + 
Sbjct  564  IYAVFQDDAVAFWAFVGFMERMERNFLRDQSGMRAQLVTLDQLVMLMDPVLWKHLEKAES  623

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREFE+   LRLWE +WT +L+   HL+V +A+L+R+R+ I+    
Sbjct  624  TNFFFFFRMILVWYKREFEWNDVLRLWESMWTNYLSGQFHLFVTLAVLERHRAVIMDHLQ  683

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++INEL G I+L +TL  AEAL
Sbjct  684  HFDEVLKYINELSGTIELNSTLIRAEAL  711



>ref|XP_005833659.1| hypothetical protein GUITHDRAFT_70335, partial [Guillardia theta 
CCMP2712]
 gb|EKX46679.1| hypothetical protein GUITHDRAFT_70335, partial [Guillardia theta 
CCMP2712]
Length=357

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L VM DE E+FWCF  LM+ + PNF  DQNGM+TQL  ++ L + L+  L+++ ++KDC
Sbjct  133  LLVVMEDEVEAFWCFQKLMDLMEPNFHKDQNGMHTQLQTINTLCKDLEPELYDHLERKDC  192

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+  CFRW+LI +KREF  +   RLWE  W++   + LHL+V +AIL+++++ II E M
Sbjct  193  SNFYFCFRWLLIIYKREFGLQDVFRLWEAFWSRVRGQDLHLFVALAILRKHKANIIEEDM  252

Query  377  DFDTLLEFINELG  339
            +FD++L+F+N+L 
Sbjct  253  EFDSVLKFVNDLS  265



>gb|KDO80161.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  475  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  534

Query  557  LNYLXCFRWILIQFKRE  507
            LNY  CFRW+LIQFKR 
Sbjct  535  LNYFFCFRWVLIQFKRS  551



>gb|KDO80160.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            IL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  LHNYFKQ DC
Sbjct  475  ILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPLHNYFKQNDC  534

Query  557  LNYLXCFRWILIQFKR  510
            LNY  CFRW+LIQFKR
Sbjct  535  LNYFFCFRWVLIQFKR  550



>gb|EME47991.1| hypothetical protein DOTSEDRAFT_69807 [Dothistroma septosporum 
NZE10]
Length=849

 Score =   142 bits (359),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 66/148 (45%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  + +D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+LLD  L+ +  + D 
Sbjct  581  IYAIEQDDAVAFWGFTKFMERMERNFLRDQSGMRLQLLTLDQLVQLLDPKLYEHLAKVDS  640

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ FKREFEFE  LR+WE LWT + + + HL++  AIL+++R+ I+    
Sbjct  641  TNFFFFFRMLLVWFKREFEFEDILRMWEGLWTDYYSSNFHLFLAAAILEKHRNVIMEHLK  700

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G IDL +TL  AEAL
Sbjct  701  GFDEVLKYVNELSGTIDLNSTLIRAEAL  728



>gb|KFA60970.1| hypothetical protein S40285_02773 [Stachybotrys chlorohalonata 
IBT 40285]
Length=824

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 65/148 (44%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V++D++ +FW F   M+R+  NF  DQ+GM +QL AL +LV  +D  L+N+ +  D 
Sbjct  591  IYAVIQDDAMAFWAFQKFMDRMERNFLRDQSGMRSQLLALDQLVNFMDPKLYNHLQSADS  650

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREF++   LRLWE LWT +L+ + HL+V +AIL+++R  I+    
Sbjct  651  TNFFFFFRMILVWYKREFQWMDVLRLWEGLWTDYLSANFHLFVALAILEKHRDVIMTHLK  710

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL   +DLE+TL  AEAL
Sbjct  711  HFDEVLKYVNELSNTMDLESTLIRAEAL  738



>gb|KFA46459.1| hypothetical protein S40293_04279 [Stachybotrys chartarum IBT 
40293]
Length=824

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 65/148 (44%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V++D++ +FW F   M+R+  NF  DQ+GM +QL AL +LV  +D  L+N+ +  D 
Sbjct  589  IYAVIQDDAMAFWAFQKFMDRMERNFLRDQSGMRSQLLALDQLVNFMDPKLYNHLQSADS  648

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREF++   LRLWE LWT +L+ + HL+V +AIL+++R  I+    
Sbjct  649  TNFFFFFRMILVWYKREFQWMDVLRLWEGLWTDYLSANFHLFVALAILEKHRDVIMTHLK  708

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL   +DLE+TL  AEAL
Sbjct  709  HFDEVLKYVNELSNTMDLESTLIRAEAL  736



>gb|KEY73259.1| hypothetical protein S7711_01380 [Stachybotrys chartarum IBT 
7711]
 gb|KFA77831.1| hypothetical protein S40288_00496 [Stachybotrys chartarum IBT 
40288]
Length=826

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 65/148 (44%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V++D++ +FW F   M+R+  NF  DQ+GM +QL AL +LV  +D  L+N+ +  D 
Sbjct  589  IYAVIQDDAMAFWAFQKFMDRMERNFLRDQSGMRSQLLALDQLVNFMDPKLYNHLQSADS  648

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREF++   LRLWE LWT +L+ + HL+V +AIL+++R  I+    
Sbjct  649  TNFFFFFRMILVWYKREFQWMDVLRLWEGLWTDYLSANFHLFVALAILEKHRDVIMTHLK  708

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL   +DLE+TL  AEAL
Sbjct  709  HFDEVLKYVNELSNTMDLESTLIRAEAL  736



>ref|XP_011323699.1| GTPase-activating protein GYP7 [Fusarium graminearum PH-1]
 gb|ESU11123.1| GTPase-activating protein GYP7 [Fusarium graminearum PH-1]
 gb|EYB29944.1| hypothetical protein FG05_05191 [Fusarium graminearum]
 emb|CEF86170.1| unnamed protein product [Fusarium graminearum]
Length=830

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 66/148 (45%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V++D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+ +D +L N+ ++ D 
Sbjct  586  IYAVIQDDAVAFWGFQKFMERMERNFLRDQSGMRNQLLTLDQLVQFMDPVLWNHLQKADS  645

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREFE+   LRLWE LWT +++ + HL++ +AIL+R+R  I+    
Sbjct  646  TNFFFFFRMILVWYKREFEWLDVLRLWEGLWTDYMSANFHLFIALAILERHRDVIMEHLQ  705

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++INEL   IDLE TL  AE+L
Sbjct  706  HFDEVLKYINELSTTIDLEATLIRAESL  733



>ref|XP_009258695.1| hypothetical protein FPSE_07302 [Fusarium pseudograminearum CS3096]
 gb|EKJ72665.1| hypothetical protein FPSE_07302 [Fusarium pseudograminearum CS3096]
Length=835

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 66/148 (45%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  V++D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+ +D +L N+ ++ D 
Sbjct  586  IYAVIQDDAVAFWGFQKFMERMERNFLRDQSGMRNQLLTLDQLVQFMDPVLWNHLQKADS  645

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR IL+ +KREFE+   LRLWE LWT +++ + HL++ +AIL+R+R  I+    
Sbjct  646  TNFFFFFRMILVWYKREFEWLDVLRLWEGLWTDYMSANFHLFIALAILERHRDVIMEHLQ  705

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++INEL   IDLE TL  AE+L
Sbjct  706  HFDEVLKYINELSTTIDLEATLIRAESL  733



>gb|EUN32280.1| hypothetical protein COCVIDRAFT_22116 [Bipolaris victoriae FI3]
Length=808

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/148 (43%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L+ + +  + 
Sbjct  566  IYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKLYLHLQSAES  625

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++R  I+    
Sbjct  626  TNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKHREIIMAHLK  685

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G +DLE+TL  AE+L
Sbjct  686  HFDEVLKYVNELSGTMDLESTLVRAESL  713



>ref|XP_007707138.1| hypothetical protein COCCADRAFT_772 [Bipolaris zeicola 26-R-13]
 gb|EUC38491.1| hypothetical protein COCCADRAFT_772 [Bipolaris zeicola 26-R-13]
Length=808

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/148 (43%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L+ + +  + 
Sbjct  566  IYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKLYLHLQSAES  625

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++R  I+    
Sbjct  626  TNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKHREIIMAHLK  685

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G +DLE+TL  AE+L
Sbjct  686  HFDEVLKYVNELSGTMDLESTLVRAESL  713



>ref|XP_007705031.1| hypothetical protein COCSADRAFT_127796 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD59269.1| hypothetical protein COCSADRAFT_127796 [Bipolaris sorokiniana 
ND90Pr]
Length=808

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/148 (43%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L+ + +  + 
Sbjct  566  IYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKLYLHLQSAES  625

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++R  I+    
Sbjct  626  TNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKHREIIMAHLK  685

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G +DLE+TL  AE+L
Sbjct  686  HFDEVLKYVNELSGTMDLESTLVRAESL  713



>ref|XP_008153766.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15 
[Eptesicus fuscus]
Length=765

 Score =   142 bits (357),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 66/150 (44%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +LYVM +E ++FWCF + M+++  NF+    GM TQL  LS L+ LLD    +Y + +D 
Sbjct  537  LLYVMENEVDAFWCFASYMDQMHQNFEEQMQGMKTQLIQLSTLLRLLDSGFCSYLESQDS  596

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
                 CFRW+LI+FKREF F   LRLWEV+WT+   ++ HL +C AIL+  + +I+ +  
Sbjct  597  GYLYFCFRWLLIRFKREFSFPDILRLWEVMWTELPCKNFHLLLCCAILESEKQQIMEKHY  656

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALCL  288
             F+ +L+ INEL   ID+E  L  AEA+ L
Sbjct  657  GFNEILKHINELSMKIDVEDVLCKAEAISL  686



>ref|XP_001642096.1| predicted protein [Nematostella vectensis]
 gb|EDO50033.1| predicted protein, partial [Nematostella vectensis]
Length=491

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 98/149 (66%), Gaps = 0/149 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            +L+++ +E ++FWCFV LME++  NF  +Q GM  QL  L  L++ +D   + Y ++ D 
Sbjct  315  VLFLVENEVDAFWCFVGLMEKMAHNFDENQEGMKMQLHQLGVLLKFVDPGFYTYLEKHDS  374

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N   CFRW+LI FKREF F+  + LWE  WTQ+L+ + HL VC+AIL R+R  I+  + 
Sbjct  375  GNLYFCFRWLLICFKREFSFDDIMTLWEAFWTQNLSPNFHLIVCLAILDRHRQVIMECQF  434

Query  377  DFDTLLEFINELGGHIDLETTLRDAEALC  291
             F+ +L+++NEL   ID++ TL  +E LC
Sbjct  435  GFNEILKYVNELAYQIDVQETLIKSETLC  463



>gb|ENI06740.1| hypothetical protein COCC4DRAFT_192817 [Bipolaris maydis ATCC 
48331]
Length=808

 Score =   142 bits (357),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/148 (43%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L+ + +  + 
Sbjct  566  IYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKLYLHLQSAES  625

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++R  I+    
Sbjct  626  TNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKHREIIMAHLK  685

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L+++NEL G +DLE+TL  AE+L
Sbjct  686  HFDEVLKYVNELSGTMDLESTLVRAESL  713



>gb|KIV99936.1| hypothetical protein PV09_08456 [Verruconis gallopava]
Length=833

 Score =   142 bits (357),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  737  ILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDC  558
            I  VM+D++ +FW FV  M R+  NF  DQ+GM TQL  L  LV+LLD +L+ + ++ D 
Sbjct  575  IYAVMQDDAVAFWGFVEFMNRMERNFLRDQSGMRTQLLTLDHLVQLLDPVLYAHLQKCDS  634

Query  557  LNYLXCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKM  378
             N+   FR +L+ +KREFE+   LRLWE +WT  L+ + HL+V +AIL+++R+ I+    
Sbjct  635  TNFFFFFRMLLVWYKREFEWMDVLRLWECMWTDFLSSNFHLFVALAILEKHRNVIMEHLR  694

Query  377  DFDTLLEFINELGGHIDLETTLRDAEAL  294
             FD +L++INEL   IDL +TL  AE L
Sbjct  695  GFDEVLKYINELSNSIDLTSTLVRAEQL  722



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515