BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004F05

Length=788
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFR66645.1|  MIP1.1a                                                 325   6e-106   Nicotiana benthamiana
ref|XP_006345881.1|  PREDICTED: dnaJ protein homolog                    324   1e-105   Solanum tuberosum [potatoes]
ref|XP_009760224.1|  PREDICTED: dnaJ protein homolog                    323   3e-105   Nicotiana sylvestris
ref|XP_009588725.1|  PREDICTED: dnaJ protein homolog                    323   3e-105   
gb|AGY48883.1|  MIP1.1b                                                 323   4e-105   Nicotiana benthamiana
emb|CAA63965.1|  DnaJ protein                                           322   9e-105   Solanum tuberosum [potatoes]
dbj|BAC53943.1|  DnaJ homolog                                           319   1e-104   Nicotiana tabacum [American tobacco]
gb|AAN87055.1|  tuber-induction protein                                 318   2e-104   Solanum tuberosum [potatoes]
ref|XP_004239737.1|  PREDICTED: dnaJ protein homolog                    321   3e-104   Solanum lycopersicum
gb|ABB16980.1|  DnaJ-like protein                                       318   6e-103   Solanum tuberosum [potatoes]
gb|AGY48885.1|  MIP1.3                                                  316   4e-102   Nicotiana benthamiana
ref|XP_009793842.1|  PREDICTED: dnaJ protein homolog isoform X2         315   4e-102   Nicotiana sylvestris
ref|XP_009793841.1|  PREDICTED: dnaJ protein homolog isoform X1         315   4e-102   Nicotiana sylvestris
ref|XP_004249937.1|  PREDICTED: dnaJ protein homolog                    315   5e-102   
ref|XP_009600920.1|  PREDICTED: dnaJ protein homolog                    315   5e-102   Nicotiana tomentosiformis
ref|XP_006365672.1|  PREDICTED: dnaJ protein homolog isoform X1         315   6e-102   
gb|KJB84159.1|  hypothetical protein B456_N007500                       315   6e-102   Gossypium raimondii
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         315   6e-102   
ref|XP_010907714.1|  PREDICTED: dnaJ protein homolog                    315   6e-102   Elaeis guineensis
gb|KDO48709.1|  hypothetical protein CISIN_1g015695mg                   312   2e-101   Citrus sinensis [apfelsine]
ref|XP_008787761.1|  PREDICTED: dnaJ protein homolog                    313   2e-101   Phoenix dactylifera
ref|XP_007010484.1|  DNAJ                                               313   3e-101   Theobroma cacao [chocolate]
gb|KDO48708.1|  hypothetical protein CISIN_1g015695mg                   312   4e-101   Citrus sinensis [apfelsine]
ref|XP_011032891.1|  PREDICTED: dnaJ protein homolog                    313   5e-101   Populus euphratica
gb|AAG24642.1|AF308737_1  J1P                                           313   6e-101   Daucus carota [carrots]
gb|KDO48711.1|  hypothetical protein CISIN_1g015695mg                   312   6e-101   Citrus sinensis [apfelsine]
gb|KDO48714.1|  hypothetical protein CISIN_1g015695mg                   310   7e-101   Citrus sinensis [apfelsine]
ref|XP_009398344.1|  PREDICTED: dnaJ protein homolog 2-like             312   8e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO48707.1|  hypothetical protein CISIN_1g015695mg                   311   1e-100   Citrus sinensis [apfelsine]
ref|XP_006485485.1|  PREDICTED: dnaJ protein homolog                    312   1e-100   Citrus sinensis [apfelsine]
ref|XP_009397426.1|  PREDICTED: dnaJ protein homolog                    311   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO48710.1|  hypothetical protein CISIN_1g015695mg                   311   2e-100   Citrus sinensis [apfelsine]
ref|XP_009623415.1|  PREDICTED: dnaJ protein homolog                    311   3e-100   Nicotiana tomentosiformis
dbj|BAA35121.1|  DnaJ homolog                                           311   3e-100   Salix gilgiana
gb|KJB60379.1|  hypothetical protein B456_009G302500                    310   4e-100   Gossypium raimondii
ref|XP_008345828.1|  PREDICTED: dnaJ protein homolog                    310   5e-100   Malus domestica [apple tree]
ref|XP_004306421.1|  PREDICTED: dnaJ protein homolog                    310   5e-100   Fragaria vesca subsp. vesca
ref|XP_007211787.1|  hypothetical protein PRUPE_ppa006330mg             310   6e-100   Prunus persica
ref|XP_010907982.1|  PREDICTED: dnaJ protein homolog                    310   6e-100   Elaeis guineensis
ref|XP_002310999.1|  DnaJ family protein                                310   9e-100   Populus trichocarpa [western balsam poplar]
ref|XP_008231805.1|  PREDICTED: dnaJ protein homolog                    309   2e-99    Prunus mume [ume]
gb|ABA46776.1|  DnaJ-like protein                                       310   2e-99    Solanum tuberosum [potatoes]
ref|XP_010319287.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    306   2e-99    Solanum lycopersicum
sp|P42824.1|DNJH2_ALLPO  RecName: Full=DnaJ protein homolog 2; Fl...    309   2e-99    Allium ampeloprasum
ref|XP_010090486.1|  DnaJ-like protein                                  308   3e-99    Morus notabilis
ref|XP_009766164.1|  PREDICTED: dnaJ protein homolog 2-like             308   3e-99    Nicotiana sylvestris
ref|XP_006445792.1|  hypothetical protein CICLE_v10015385mg             308   3e-99    Citrus clementina [clementine]
ref|XP_009341572.1|  PREDICTED: dnaJ protein homolog                    308   4e-99    Pyrus x bretschneideri [bai li]
ref|XP_010694477.1|  PREDICTED: dnaJ protein homolog                    308   5e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004236804.1|  PREDICTED: dnaJ protein homolog isoform X1         307   8e-99    Solanum lycopersicum
ref|XP_004166311.1|  PREDICTED: dnaJ protein homolog                    303   1e-98    
gb|AGY48886.1|  MIP1.4a                                                 306   1e-98    Nicotiana benthamiana
ref|XP_008375557.1|  PREDICTED: dnaJ protein homolog                    306   2e-98    
ref|XP_004982304.1|  PREDICTED: dnaJ protein homolog 2-like             306   2e-98    Setaria italica
gb|AGY48884.1|  MIP1.2                                                  306   3e-98    Nicotiana benthamiana
gb|KCW50581.1|  hypothetical protein EUGRSUZ_J00292                     301   3e-98    Eucalyptus grandis [rose gum]
ref|XP_002263156.1|  PREDICTED: dnaJ protein homolog                    306   3e-98    Vitis vinifera
ref|XP_002316479.1|  DnaJ family protein                                306   3e-98    Populus trichocarpa [western balsam poplar]
ref|XP_009789005.1|  PREDICTED: dnaJ protein homolog                    306   3e-98    Nicotiana sylvestris
ref|XP_010263054.1|  PREDICTED: dnaJ protein homolog                    305   3e-98    Nelumbo nucifera [Indian lotus]
ref|XP_002270362.1|  PREDICTED: dnaJ protein homolog isoform X1         305   4e-98    Vitis vinifera
emb|CAN82708.1|  hypothetical protein VITISV_000291                     305   5e-98    Vitis vinifera
ref|NP_001234241.1|  DnaJ-like protein                                  305   5e-98    
ref|XP_010263053.1|  PREDICTED: dnaJ protein homolog                    305   6e-98    Nelumbo nucifera [Indian lotus]
ref|XP_002514419.1|  Chaperone protein dnaJ, putative                   305   7e-98    
ref|XP_011084248.1|  PREDICTED: dnaJ protein homolog                    305   8e-98    Sesamum indicum [beniseed]
ref|XP_011024143.1|  PREDICTED: dnaJ protein homolog                    305   9e-98    Populus euphratica
ref|XP_010651845.1|  PREDICTED: dnaJ protein homolog isoform X2         304   9e-98    
ref|XP_006378828.1|  hypothetical protein POPTR_0010s24930g             305   1e-97    
gb|ABI83623.1|  DnaJ-like protein                                       304   1e-97    Setaria italica
ref|XP_004139085.1|  PREDICTED: dnaJ protein homolog                    303   3e-97    Cucumis sativus [cucumbers]
ref|XP_004169945.1|  PREDICTED: dnaJ protein homolog                    303   3e-97    
gb|ABX57881.1|  DnaJ                                                    303   4e-97    Viola baoshanensis
emb|CDO99946.1|  unnamed protein product                                303   4e-97    Coffea canephora [robusta coffee]
ref|XP_006367021.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    300   5e-97    Solanum tuberosum [potatoes]
ref|XP_007015641.1|  DNAJ isoform 2                                     302   5e-97    
ref|XP_008443634.1|  PREDICTED: dnaJ protein homolog                    302   5e-97    Cucumis melo [Oriental melon]
gb|AFK48086.1|  unknown                                                 296   5e-97    Medicago truncatula
gb|AGY48887.1|  MIP1.4b                                                 302   6e-97    Nicotiana benthamiana
gb|AAX95135.1|  DnaJ protein, putative                                  302   6e-97    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050779.1|  Os03g0648400                                       302   6e-97    
ref|NP_001238341.1|  seed maturation protein PM37                       302   8e-97    Glycine max [soybeans]
ref|XP_009418972.1|  PREDICTED: dnaJ protein homolog isoform X2         301   9e-97    
ref|XP_009418971.1|  PREDICTED: dnaJ protein homolog isoform X1         301   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001267695.1|  dnaJ protein homolog                               301   1e-96    Cucumis sativus [cucumbers]
ref|XP_008446732.1|  PREDICTED: dnaJ protein homolog                    301   1e-96    Cucumis melo [Oriental melon]
gb|AFW68139.1|  putative dnaJ chaperone family protein                  298   2e-96    
gb|KCW50936.1|  hypothetical protein EUGRSUZ_J00583                     298   2e-96    Eucalyptus grandis [rose gum]
ref|XP_006367020.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    301   2e-96    Solanum tuberosum [potatoes]
ref|XP_004981504.1|  PREDICTED: dnaJ protein homolog                    300   4e-96    Setaria italica
ref|XP_010031575.1|  PREDICTED: dnaJ protein homolog                    300   4e-96    Eucalyptus grandis [rose gum]
gb|ADK35105.1|  DnaJ-like protein 1                                     293   5e-96    Astragalus sinicus
gb|KCW50580.1|  hypothetical protein EUGRSUZ_J00292                     298   6e-96    Eucalyptus grandis [rose gum]
ref|NP_001146715.1|  uncharacterized protein LOC100280317               300   8e-96    
ref|NP_001168650.1|  putative dnaJ chaperone family protein             299   8e-96    Zea mays [maize]
gb|AFW68140.1|  putative dnaJ chaperone family protein isoform 1        300   8e-96    
ref|XP_010031320.1|  PREDICTED: dnaJ protein homolog                    299   9e-96    Eucalyptus grandis [rose gum]
ref|XP_009592511.1|  PREDICTED: dnaJ protein homolog                    299   1e-95    Nicotiana tomentosiformis
gb|KJB09149.1|  hypothetical protein B456_001G126200                    299   1e-95    Gossypium raimondii
ref|XP_003561819.1|  PREDICTED: dnaJ protein homolog                    299   1e-95    Brachypodium distachyon [annual false brome]
emb|CDP15561.1|  unnamed protein product                                298   2e-95    Coffea canephora [robusta coffee]
gb|KHG17902.1|  Chaperone dnaJ 3 -like protein                          298   2e-95    Gossypium arboreum [tree cotton]
gb|EMT20603.1|  DnaJ protein-like protein                               298   2e-95    
ref|XP_003596917.1|  DnaJ                                               293   2e-95    
gb|KJB35426.1|  hypothetical protein B456_006G117100                    298   2e-95    Gossypium raimondii
ref|NP_001149958.1|  dnaJ protein                                       295   2e-95    
ref|XP_006650350.1|  PREDICTED: dnaJ protein homolog 2-like             298   2e-95    
ref|XP_004506241.1|  PREDICTED: dnaJ protein homolog ANJ1-like          298   4e-95    Cicer arietinum [garbanzo]
ref|XP_006826444.1|  hypothetical protein AMTR_s00004p00172570          297   5e-95    Amborella trichopoda
gb|AHA84223.1|  seed maturation protein PM37                            297   6e-95    Phaseolus vulgaris [French bean]
gb|AFK38714.1|  unknown                                                 291   6e-95    Lotus japonicus
ref|XP_007132506.1|  hypothetical protein PHAVU_011G100000g             297   6e-95    Phaseolus vulgaris [French bean]
ref|XP_006650701.1|  PREDICTED: dnaJ protein homolog 2-like             297   6e-95    Oryza brachyantha
ref|NP_001051497.1|  Os03g0787300                                       297   6e-95    
gb|EAY92107.1|  hypothetical protein OsI_13813                          297   6e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_010089798.1|  DnaJ-like protein                                  298   7e-95    
ref|NP_001130317.1|  chaperone DNA J2                                   297   8e-95    Zea mays [maize]
sp|Q03363.1|DNJH1_ALLPO  RecName: Full=DnaJ protein homolog 1; Sh...    296   9e-95    Allium ampeloprasum
ref|XP_008385581.1|  PREDICTED: dnaJ protein homolog                    296   1e-94    
gb|KDO48966.1|  hypothetical protein CISIN_1g014903mg                   293   1e-94    Citrus sinensis [apfelsine]
ref|XP_002466747.1|  hypothetical protein SORBIDRAFT_01g013390          296   1e-94    Sorghum bicolor [broomcorn]
gb|ABI18985.1|  molecular chaperone DjA2                                296   1e-94    Allium ampeloprasum
ref|NP_001242510.1|  uncharacterized protein LOC100808604               296   1e-94    
emb|CBI28261.3|  unnamed protein product                                295   1e-94    Vitis vinifera
ref|XP_006590333.1|  PREDICTED: uncharacterized protein LOC100808...    296   2e-94    
ref|XP_003605981.1|  DnaJ                                               296   2e-94    
gb|AAF64454.1|AF239932_1  DnaJ protein                                  296   2e-94    Euphorbia esula [wolf's milk]
ref|XP_003605980.1|  DnaJ                                               296   2e-94    Medicago truncatula
ref|XP_008359180.1|  PREDICTED: dnaJ protein homolog                    296   2e-94    
gb|EYU36023.1|  hypothetical protein MIMGU_mgv1a007093mg                295   3e-94    Erythranthe guttata [common monkey flower]
ref|XP_002313505.1|  seed maturation protein PM37                       295   4e-94    Populus trichocarpa [western balsam poplar]
ref|XP_006424068.1|  hypothetical protein CICLE_v10028531mg             295   6e-94    Citrus clementina [clementine]
ref|XP_009406563.1|  PREDICTED: dnaJ protein homolog                    294   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011090296.1|  PREDICTED: dnaJ protein homolog                    294   1e-93    Sesamum indicum [beniseed]
ref|XP_003596916.1|  DnaJ                                               294   1e-93    Medicago truncatula
gb|AFK37703.1|  unknown                                                 293   2e-93    Medicago truncatula
ref|XP_009368443.1|  PREDICTED: dnaJ protein homolog                    293   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_006340319.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    291   2e-93    Solanum tuberosum [potatoes]
ref|XP_009408521.1|  PREDICTED: dnaJ protein homolog isoform X2         293   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84348.1|  unknown                                                 288   2e-93    Medicago truncatula
ref|XP_006340318.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    293   3e-93    Solanum tuberosum [potatoes]
ref|XP_009408520.1|  PREDICTED: dnaJ protein homolog isoform X1         292   4e-93    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW67420.1|  putative dnaJ chaperone family protein                  292   6e-93    
gb|AFW67421.1|  putative dnaJ chaperone family protein                  292   7e-93    
ref|XP_011008852.1|  PREDICTED: dnaJ protein homolog isoform X1         291   9e-93    Populus euphratica
ref|XP_011008853.1|  PREDICTED: dnaJ protein homolog isoform X2         291   1e-92    Populus euphratica
gb|AHA84264.1|  seed maturation protein PM37                            291   1e-92    Phaseolus vulgaris [French bean]
gb|AFK46626.1|  unknown                                                 286   1e-92    Medicago truncatula
ref|XP_008361658.1|  PREDICTED: dnaJ protein homolog                    291   1e-92    
gb|EYU36024.1|  hypothetical protein MIMGU_mgv1a007013mg                291   2e-92    Erythranthe guttata [common monkey flower]
ref|NP_001240264.1|  uncharacterized protein LOC100818805               291   2e-92    Glycine max [soybeans]
gb|ACJ83716.1|  unknown                                                 281   3e-92    Medicago truncatula
ref|XP_004291531.1|  PREDICTED: dnaJ protein homolog                    290   3e-92    Fragaria vesca subsp. vesca
gb|KDP42967.1|  hypothetical protein JCGZ_23909                         290   3e-92    Jatropha curcas
ref|XP_007015640.1|  DNAJ isoform 1                                     290   5e-92    
ref|NP_001275059.1|  DnaJ-like protein                                  290   7e-92    Solanum tuberosum [potatoes]
gb|EYU37228.1|  hypothetical protein MIMGU_mgv1a006942mg                289   1e-91    Erythranthe guttata [common monkey flower]
ref|XP_009336413.1|  PREDICTED: dnaJ protein homolog                    289   1e-91    Pyrus x bretschneideri [bai li]
gb|AAD12055.1|  DnaJ protein                                            289   1e-91    Hevea brasiliensis [jebe]
ref|XP_003558043.1|  PREDICTED: dnaJ protein homolog                    288   2e-91    Brachypodium distachyon [annual false brome]
gb|KHN17991.1|  DnaJ protein like                                       287   4e-91    Glycine soja [wild soybean]
gb|KHG01500.1|  Chaperone dnaJ 3 -like protein                          284   4e-91    Gossypium arboreum [tree cotton]
ref|XP_010685460.1|  PREDICTED: dnaJ protein homolog ANJ1               287   5e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002874044.1|  hypothetical protein ARALYDRAFT_489058             287   6e-91    
ref|XP_004251216.1|  PREDICTED: dnaJ protein homolog                    286   8e-91    Solanum lycopersicum
ref|XP_007205259.1|  hypothetical protein PRUPE_ppa006299mg             286   8e-91    Prunus persica
gb|EMT10718.1|  DnaJ protein-like protein                               286   1e-90    
ref|XP_003540271.1|  PREDICTED: dnaJ protein homolog                    285   2e-90    Glycine max [soybeans]
ref|XP_008661261.1|  PREDICTED: dnaJ protein homolog 2-like             282   2e-90    Zea mays [maize]
tpg|DAA40640.1|  TPA: putative dnaJ chaperone family protein            281   2e-90    
gb|AFW89867.1|  putative dnaJ chaperone family protein                  283   3e-90    
ref|XP_008670357.1|  PREDICTED: dnaJ protein homolog 2-like             280   3e-90    
ref|XP_008230416.1|  PREDICTED: dnaJ protein homolog                    285   3e-90    Prunus mume [ume]
ref|XP_004291528.1|  PREDICTED: dnaJ protein homolog                    285   4e-90    Fragaria vesca subsp. vesca
gb|EMS60670.1|  DnaJ protein-like protein                               285   8e-90    Triticum urartu
gb|KJB35429.1|  hypothetical protein B456_006G117100                    284   1e-89    Gossypium raimondii
ref|XP_002515865.1|  Chaperone protein dnaJ, putative                   283   2e-89    Ricinus communis
ref|NP_568412.1|  chaperone protein dnaJ 2                              283   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150008.1|  hypothetical protein PHAVU_005G118100g             282   4e-89    Phaseolus vulgaris [French bean]
gb|ABG78615.1|  J-domain protein                                        282   4e-89    Triticum aestivum [Canadian hard winter wheat]
sp|P43644.1|DNJH_ATRNU  RecName: Full=DnaJ protein homolog ANJ1; ...    282   5e-89    Atriplex nummularia
gb|EYU37227.1|  hypothetical protein MIMGU_mgv1a006922mg                281   9e-89    Erythranthe guttata [common monkey flower]
ref|XP_006400711.1|  hypothetical protein EUTSA_v10013655mg             281   1e-88    Eutrema salsugineum [saltwater cress]
ref|XP_010514755.1|  PREDICTED: chaperone protein dnaJ 3-like           281   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010427107.1|  PREDICTED: chaperone protein dnaJ 3 isoform X1     281   1e-88    
gb|KHG16063.1|  DnaJ protein                                            276   2e-88    Gossypium arboreum [tree cotton]
emb|CDX92386.1|  BnaA10g14250D                                          280   2e-88    
ref|XP_002877319.1|  hypothetical protein ARALYDRAFT_905503             280   3e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_006404506.1|  hypothetical protein EUTSA_v10010407mg             280   4e-88    Eutrema salsugineum [saltwater cress]
emb|CDX92385.1|  BnaA10g14240D                                          280   5e-88    
ref|XP_009120689.1|  PREDICTED: chaperone protein dnaJ 3-like           280   5e-88    Brassica rapa
gb|AAK74013.1|  AT3g44110/F26G5_60                                      279   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189997.1|  chaperone protein dnaJ 3                              279   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287824.1|  hypothetical protein CARUB_v10001042mg             279   6e-88    Capsella rubella
emb|CDY16617.1|  BnaC09g36560D                                          272   7e-88    Brassica napus [oilseed rape]
gb|AAB86799.1|  putative                                                279   7e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120690.1|  PREDICTED: chaperone protein dnaJ 3-like           279   7e-88    Brassica rapa
dbj|BAJ91943.1|  predicted protein                                      279   8e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006292339.1|  hypothetical protein CARUB_v10018551mg             278   1e-87    Capsella rubella
ref|XP_010544327.1|  PREDICTED: dnaJ protein homolog                    278   1e-87    Tarenaya hassleriana [spider flower]
gb|AAB49030.1|  DnaJ homolog                                            278   3e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KDP22008.1|  hypothetical protein JCGZ_03128                         274   5e-87    Jatropha curcas
emb|CAC12824.1|  putative DNAJ protein                                  276   6e-87    Nicotiana tabacum [American tobacco]
ref|XP_008660777.1|  PREDICTED: dnaJ protein homolog 2-like             273   1e-86    Zea mays [maize]
gb|ABK21047.1|  unknown                                                 268   1e-86    Picea sitchensis
ref|XP_010420996.1|  PREDICTED: chaperone protein dnaJ 2 isoform X1     276   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010520679.1|  PREDICTED: chaperone protein dnaJ 3-like           277   2e-86    
ref|XP_010454471.1|  PREDICTED: chaperone protein dnaJ 2                275   4e-86    Camelina sativa [gold-of-pleasure]
gb|KJB84164.1|  hypothetical protein B456_N007500                       274   7e-86    Gossypium raimondii
ref|XP_010493266.1|  PREDICTED: chaperone protein dnaJ 2-like iso...    273   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010535721.1|  PREDICTED: chaperone protein dnaJ 3                273   2e-85    Tarenaya hassleriana [spider flower]
emb|CDY09117.1|  BnaA02g05430D                                          271   8e-85    Brassica napus [oilseed rape]
ref|XP_009126521.1|  PREDICTED: chaperone protein dnaJ 3                271   8e-85    Brassica rapa
ref|XP_011088982.1|  PREDICTED: dnaJ protein homolog                    271   9e-85    Sesamum indicum [beniseed]
gb|KFK26344.1|  hypothetical protein AALP_AA8G235700                    271   9e-85    Arabis alpina [alpine rockcress]
gb|ACN39991.1|  unknown                                                 270   2e-84    Picea sitchensis
ref|XP_010521621.1|  PREDICTED: dnaJ protein homolog ANJ1-like          270   3e-84    Tarenaya hassleriana [spider flower]
emb|CDY65546.1|  BnaCnng47600D                                          269   6e-84    Brassica napus [oilseed rape]
ref|XP_002969107.1|  hypothetical protein SELMODRAFT_267228             268   1e-83    Selaginella moellendorffii
gb|AFW86285.1|  putative dnaJ chaperone family protein                  274   1e-83    
ref|XP_009131855.1|  PREDICTED: chaperone protein dnaJ 3-like           266   6e-83    Brassica rapa
ref|XP_001774283.1|  predicted protein                                  265   1e-82    
ref|XP_001782829.1|  predicted protein                                  264   3e-82    
ref|XP_008666814.1|  PREDICTED: dnaJ protein homolog 1-like             267   5e-82    
gb|KHN36510.1|  DnaJ protein like                                       257   5e-81    Glycine soja [wild soybean]
ref|XP_002983333.1|  hypothetical protein SELMODRAFT_118063             261   9e-81    Selaginella moellendorffii
emb|CDX70980.1|  BnaC03g10640D                                          259   2e-80    
gb|KHG16062.1|  Chaperone protein dnaJ 3                                256   3e-80    Gossypium arboreum [tree cotton]
ref|XP_001768102.1|  predicted protein                                  259   4e-80    
ref|XP_010089281.1|  DnaJ-like protein                                  258   1e-79    Morus notabilis
ref|XP_010248011.1|  PREDICTED: dnaJ protein homolog 2-like             256   5e-79    Nelumbo nucifera [Indian lotus]
ref|XP_009622737.1|  PREDICTED: dnaJ protein homolog 2-like             256   9e-79    Nicotiana tomentosiformis
ref|XP_008803820.1|  PREDICTED: dnaJ protein homolog 2-like             255   9e-79    
ref|XP_010933633.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    254   2e-78    Elaeis guineensis
gb|AGR45906.1|  DnaJ protein 2-like protein                             254   2e-78    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010933632.1|  PREDICTED: dnaJ protein homolog isoform X1         254   2e-78    Elaeis guineensis
ref|XP_006445374.1|  hypothetical protein CICLE_v10020330mg             251   4e-78    
ref|XP_010919645.1|  PREDICTED: dnaJ protein homolog                    253   9e-78    Elaeis guineensis
ref|XP_007052233.1|  DNAJ                                               253   1e-77    Theobroma cacao [chocolate]
ref|XP_009382439.1|  PREDICTED: dnaJ protein homolog                    253   1e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002275918.1|  PREDICTED: dnaJ protein homolog 2                  253   1e-77    Vitis vinifera
ref|XP_006445376.1|  hypothetical protein CICLE_v10020330mg             253   1e-77    Citrus clementina [clementine]
ref|XP_003570021.1|  PREDICTED: dnaJ protein homolog 2-like             251   4e-77    Brachypodium distachyon [annual false brome]
ref|XP_009779099.1|  PREDICTED: dnaJ protein homolog                    251   5e-77    Nicotiana sylvestris
ref|XP_001755408.1|  predicted protein                                  251   5e-77    
ref|XP_010258833.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    248   6e-77    Nelumbo nucifera [Indian lotus]
emb|CDP09461.1|  unnamed protein product                                250   9e-77    Coffea canephora [robusta coffee]
ref|XP_008232370.1|  PREDICTED: dnaJ protein homolog 2-like             250   1e-76    Prunus mume [ume]
ref|XP_007220469.1|  hypothetical protein PRUPE_ppa006364mg             250   1e-76    
gb|AGY48888.1|  MIP1L1                                                  250   1e-76    Nicotiana benthamiana
ref|XP_004976432.1|  PREDICTED: dnaJ protein homolog 2-like             249   2e-76    Setaria italica
ref|XP_010258832.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    249   3e-76    Nelumbo nucifera [Indian lotus]
ref|XP_002963792.1|  hypothetical protein SELMODRAFT_230221             249   3e-76    Selaginella moellendorffii
ref|XP_004953339.1|  PREDICTED: dnaJ protein homolog 2-like             248   7e-76    Setaria italica
ref|XP_009596179.1|  PREDICTED: dnaJ protein homolog                    248   9e-76    Nicotiana tomentosiformis
ref|XP_010692097.1|  PREDICTED: dnaJ protein homolog 2-like             248   1e-75    Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA41085.1|  TPA: putative dnaJ chaperone family protein            249   2e-75    
dbj|BAD25681.1|  putative DnaJ-like protein MsJ1                        246   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047626.1|  Os02g0656500                                       246   3e-75    
gb|EEC73725.1|  hypothetical protein OsI_08334                          246   3e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_006647626.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    246   6e-75    Oryza brachyantha
ref|XP_006647627.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    246   6e-75    Oryza brachyantha
ref|XP_002974881.1|  hypothetical protein SELMODRAFT_232411             245   7e-75    Selaginella moellendorffii
ref|XP_003521084.1|  PREDICTED: dnaJ protein homolog 2-like             245   9e-75    Glycine max [soybeans]
gb|EEE57509.1|  hypothetical protein OsJ_07792                          246   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454540.1|  hypothetical protein SORBIDRAFT_04g032970          245   1e-74    Sorghum bicolor [broomcorn]
ref|XP_002446897.1|  hypothetical protein SORBIDRAFT_06g024520          245   1e-74    Sorghum bicolor [broomcorn]
ref|XP_002301248.1|  DnaJ family protein                                245   1e-74    
ref|XP_006386554.1|  hypothetical protein POPTR_0002s14200g             245   1e-74    
ref|NP_001136581.1|  putative dnaJ chaperone family protein             244   2e-74    Zea mays [maize]
gb|ACU24346.1|  unknown                                                 243   6e-74    Glycine max [soybeans]
gb|ABY52936.1|  DnaJ family heat shock protein                          243   9e-74    Oryza sativa Japonica Group [Japonica rice]
gb|KHF97331.1|  Chaperone dnaJ 3 -like protein                          243   1e-73    Gossypium arboreum [tree cotton]
ref|XP_009411580.1|  PREDICTED: dnaJ protein homolog                    243   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011017420.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    240   1e-73    Populus euphratica
emb|CAH67501.1|  OSIGBa0134H18.3                                        242   2e-73    Oryza sativa [red rice]
ref|NP_001053485.1|  Os04g0549600                                       242   2e-73    
ref|XP_004229763.1|  PREDICTED: dnaJ protein homolog 2-like             242   2e-73    Solanum lycopersicum
ref|XP_006345526.1|  PREDICTED: dnaJ protein homolog isoform X1         241   2e-73    Solanum tuberosum [potatoes]
gb|KJB41004.1|  hypothetical protein B456_007G087000                    239   4e-73    
emb|CBI16632.3|  unnamed protein product                                248   4e-73    
dbj|BAA76883.1|  DnaJ homolog protein                                   241   5e-73    
ref|XP_011457522.1|  PREDICTED: dnaJ protein homolog                    240   5e-73    
ref|XP_011017419.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    240   7e-73    
tpg|DAA50892.1|  TPA: putative dnaJ chaperone family protein            250   1e-72    
gb|EPS67712.1|  hypothetical protein M569_07062                         236   1e-72    
ref|XP_003529049.1|  PREDICTED: dnaJ protein homolog 2-like             239   1e-72    
ref|XP_010053981.1|  PREDICTED: dnaJ protein homolog                    239   3e-72    
gb|KJB41003.1|  hypothetical protein B456_007G087000                    239   3e-72    
gb|KDP28841.1|  hypothetical protein JCGZ_14612                         237   1e-71    
ref|XP_008375745.1|  PREDICTED: dnaJ protein homolog 2-like             236   2e-71    
emb|CAD41609.2|  OSJNBb0034G17.1                                        243   4e-71    
ref|XP_006347934.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    235   7e-71    
tpg|DAA45534.1|  TPA: putative dnaJ chaperone family protein            227   3e-70    
ref|XP_004307004.1|  PREDICTED: dnaJ protein homolog 2-like             233   7e-70    
ref|XP_004510114.1|  PREDICTED: dnaJ protein homolog 2-like             232   1e-69    
ref|XP_007134513.1|  hypothetical protein PHAVU_010G053900g             231   2e-69    
gb|AFK35446.1|  unknown                                                 227   2e-69    
ref|XP_011093285.1|  PREDICTED: chaperone protein dnaJ 3-like           229   2e-68    
gb|AFK48766.1|  unknown                                                 229   2e-68    
ref|XP_003626730.1|  DnaJ protein-like protein                          229   2e-68    
gb|ACJ84518.1|  unknown                                                 228   4e-68    
ref|XP_001774301.1|  predicted protein                                  226   3e-67    
emb|CAA04447.1|  DnaJ-like protein                                      225   6e-67    
gb|AHH02353.1|  putative DnaJ-like protein                              212   1e-65    
ref|XP_002511620.1|  Chaperone protein dnaJ, putative                   216   5e-64    
gb|EPS61572.1|  hypothetical protein M569_13222                         204   7e-62    
emb|CAN64325.1|  hypothetical protein VITISV_005641                     204   3e-59    
ref|XP_006369376.1|  hypothetical protein POPTR_0001s22240g             199   1e-58    
ref|XP_008671675.1|  PREDICTED: dnaJ protein homolog                    191   9e-57    
gb|ADW66143.1|  DnaJ like-protein                                       189   1e-56    
tpg|DAA39063.1|  TPA: putative dnaJ chaperone family protein            189   3e-54    
ref|XP_001419206.1|  predicted protein                                  189   3e-53    
ref|NP_850653.1|  chaperone protein dnaJ 3                              186   5e-53    
ref|XP_003058583.1|  predicted protein                                  187   1e-52    
tpg|DAA39850.1|  TPA: putative dnaJ chaperone family protein            179   5e-52    
ref|XP_002507968.1|  predicted protein                                  184   2e-51    
ref|XP_004487721.1|  PREDICTED: dnaJ protein homolog                    181   1e-50    
ref|XP_003080911.1|  DnaJ-like protein (ISS)                            179   2e-49    
gb|AFW76668.1|  putative dnaJ chaperone family protein                  183   5e-49    
tpg|DAA45343.1|  TPA: putative dnaJ chaperone family protein            185   9e-49    
gb|AFW72108.1|  putative dnaJ chaperone family protein                  181   2e-48    
gb|AAD09512.1|  ATFP9                                                   166   3e-48    
ref|XP_005822285.1|  hypothetical protein GUITHDRAFT_97880              173   3e-47    
ref|XP_007515206.1|  predicted protein                                  173   7e-47    
gb|KDO48715.1|  hypothetical protein CISIN_1g015695mg                   166   1e-45    
gb|KDO27150.1|  hypothetical protein SPRG_07857                         166   2e-44    
ref|XP_002900006.1|  conserved hypothetical protein                     166   3e-44    
gb|KDO27145.1|  hypothetical protein SPRG_07853                         165   3e-44    
ref|XP_008607516.1|  hypothetical protein SDRG_03657                    165   3e-44    
ref|XP_008612573.1|  DnaJ like subfamily A member 2                     165   3e-44    
ref|XP_008354864.1|  PREDICTED: dnaJ protein homolog                    163   4e-44    
gb|KJB84165.1|  hypothetical protein B456_N007500                       163   4e-44    
ref|XP_008890293.1|  hypothetical protein PPTG_00631                    164   9e-44    
ref|XP_009525521.1|  hypothetical protein PHYSODRAFT_345922             163   2e-43    
gb|AES67168.2|  DnaJ-class molecular chaperone                          161   2e-43    
gb|KJB35428.1|  hypothetical protein B456_006G117100                    158   1e-42    
ref|XP_005107829.1|  PREDICTED: dnaJ homolog subfamily A member 2...    160   2e-42    
emb|CBJ30599.1|  Heat shock protein 40                                  160   3e-42    
ref|XP_007015642.1|  DNAJ isoform 3                                     157   6e-42    
ref|XP_010098885.1|  DnaJ-like protein                                  150   1e-41    
ref|XP_008607517.1|  hypothetical protein SDRG_03658                    158   1e-41    
gb|KDO19151.1|  hypothetical protein SPRG_15718                         155   2e-41    
gb|EMS59985.1|  Chaperone protein dnaJ 2                                155   3e-41    
ref|XP_004067524.1|  PREDICTED: dnaJ homolog subfamily A member 2       157   3e-41    
ref|XP_008296183.1|  PREDICTED: dnaJ homolog subfamily A member 2       157   3e-41    
ref|XP_004539855.1|  PREDICTED: dnaJ homolog subfamily A member 2...    157   5e-41    
gb|KDO16638.1|  hypothetical protein SPRG_17375                         154   9e-41    
ref|XP_009830477.1|  hypothetical protein H257_06808                    156   9e-41    
emb|CCA21495.1|  conserved hypothetical protein                         155   2e-40    
ref|XP_008874481.1|  hypothetical protein H310_10021                    155   2e-40    
ref|XP_004553333.1|  PREDICTED: dnaJ homolog subfamily A member 2...    155   2e-40    
ref|XP_003440442.1|  PREDICTED: dnaJ homolog subfamily A member 2...    155   2e-40    
emb|CCI48831.1|  unnamed protein product                                159   2e-40    
emb|CCI48830.1|  unnamed protein product                                159   3e-40    
emb|CCI48832.1|  unnamed protein product                                159   3e-40    
ref|XP_009830474.1|  hypothetical protein H257_06805                    154   3e-40    
emb|CCI48829.1|  unnamed protein product                                159   3e-40    
ref|XP_783184.2|  PREDICTED: dnaJ homolog subfamily A member 2-like     155   3e-40    
dbj|BAJ86313.1|  predicted protein                                      149   5e-40    
ref|XP_011400324.1|  DnaJ protein-like protein 2                        151   5e-40    
ref|XP_009904990.1|  PREDICTED: dnaJ homolog subfamily A member 2       152   6e-40    
ref|XP_970724.1|  PREDICTED: dnaJ homolog subfamily A member 2          153   7e-40    
ref|XP_011474480.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    153   8e-40    
ref|XP_007543201.1|  PREDICTED: dnaJ homolog subfamily A member 2       153   1e-39    
ref|NP_997830.1|  DnaJ subfamily A member 2-like                        153   1e-39    
ref|XP_005802556.1|  PREDICTED: dnaJ homolog subfamily A member 2...    153   1e-39    
gb|KFV72167.1|  DnaJ subfamily A member 2                               152   2e-39    
ref|XP_008403090.1|  PREDICTED: dnaJ homolog subfamily A member 2       152   3e-39    
ref|XP_008885880.1|  DnaJ family chaperone, putative                    152   3e-39    
ref|XP_008874469.1|  hypothetical protein H310_10010                    152   3e-39    
ref|XP_002364366.1|  DnaJ domain-containing protein                     152   5e-39    
emb|CDJ42592.1|  DnaJ domain-containing protein, putative               151   5e-39    
emb|CDQ55983.1|  unnamed protein product                                151   5e-39    
dbj|BAG30793.1|  similar to DnaJ protein                                150   7e-39    
ref|XP_008308939.1|  PREDICTED: dnaJ homolog subfamily A member 2       150   7e-39    
ref|XP_010716282.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   9e-39    
ref|XP_007230450.1|  PREDICTED: dnaJ homolog subfamily A member 2       150   9e-39    
ref|NP_001157380.1|  DnaJ (Hsp40) homolog 1                             150   9e-39    
ref|XP_006641433.1|  PREDICTED: dnaJ homolog subfamily A member 2...    150   9e-39    
ref|XP_003289478.1|  heat shock protein                                 150   9e-39    
gb|EMC89242.1|  DnaJ like protein subfamily A member 2                  146   9e-39    
emb|CDQ59403.1|  unnamed protein product                                150   1e-38    
ref|XP_003967154.1|  PREDICTED: dnaJ homolog subfamily A member 2...    150   1e-38    
gb|ABA99886.2|  DnaJ protein, putative, expressed                       150   1e-38    
gb|EAY83926.1|  hypothetical protein OsI_39149                          150   1e-38    
gb|ACN11426.1|  DnaJ homolog subfamily A member 2                       150   1e-38    
ref|XP_005707879.1|  molecular chaperone DnaJ                           150   2e-38    
ref|XP_005802065.1|  PREDICTED: dnaJ homolog subfamily A member 2...    150   2e-38    
ref|XP_008552261.1|  PREDICTED: dnaJ homolog subfamily A member 1       149   2e-38    
ref|XP_007545750.1|  PREDICTED: dnaJ homolog subfamily A member 2...    150   2e-38    
ref|XP_009058223.1|  hypothetical protein LOTGIDRAFT_122424             150   2e-38    
ref|XP_316024.4|  AGAP005981-PA                                         149   2e-38    
ref|XP_003969457.1|  PREDICTED: dnaJ homolog subfamily A member 2...    149   2e-38    
dbj|BAM19149.1|  DnaJ-like-2 protein                                    149   2e-38    
ref|XP_001507642.1|  PREDICTED: dnaJ homolog subfamily A member 2       149   2e-38    
ref|XP_008297938.1|  PREDICTED: dnaJ homolog subfamily A member 2...    149   2e-38    
ref|XP_007887604.1|  PREDICTED: dnaJ homolog subfamily A member 2       149   3e-38    
ref|XP_010783411.1|  PREDICTED: dnaJ homolog subfamily A member 2       149   3e-38    
ref|XP_010896063.1|  PREDICTED: dnaJ homolog subfamily A member 2       149   3e-38    
ref|XP_010730226.1|  PREDICTED: dnaJ homolog subfamily A member 2       149   3e-38    
gb|AAC72887.1|  heat shock protein Ddj1                                 149   4e-38    
ref|XP_007059709.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    147   5e-38    
ref|XP_667910.1|  DNAJ domain protein                                   149   5e-38    
ref|XP_002604869.1|  hypothetical protein BRAFLDRAFT_217157             149   5e-38    
gb|EHJ70691.1|  DnaJ-like protein 1                                     148   5e-38    
ref|XP_007439805.1|  PREDICTED: dnaJ homolog subfamily A member 2       148   5e-38    
emb|CAG13048.1|  unnamed protein product                                149   5e-38    
ref|XP_001363277.1|  PREDICTED: dnaJ homolog subfamily A member 2       148   6e-38    
ref|XP_641304.1|  heat shock protein                                    148   6e-38    
ref|XP_009808292.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   6e-38    
ref|XP_005233897.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   6e-38    
ref|XP_005444666.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   7e-38    
ref|XP_009695370.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   7e-38    
ref|XP_009939420.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   7e-38    
ref|XP_010202745.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   7e-38    
ref|XP_003222964.1|  PREDICTED: dnaJ homolog subfamily A member 2       148   7e-38    
ref|XP_010013041.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   7e-38    
ref|XP_627269.1|  DNAJ like chaperone                                   148   8e-38    
ref|XP_005852710.1|  DnaJ subfamily A member 2-like protein             147   8e-38    
ref|XP_009461777.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   8e-38    
gb|KDR14838.1|  DnaJ-like protein subfamily A member 2                  148   8e-38    
gb|KDO85583.1|  hypothetical protein CISIN_1g014800mg                   146   8e-38    
gb|EWM24221.1|  HSP40/DnaJ heat shock protein                           148   9e-38    
gb|EEE53623.1|  hypothetical protein OsJ_36898                          148   9e-38    
ref|XP_003757275.1|  PREDICTED: dnaJ homolog subfamily A member 2       149   1e-37    
gb|KFV11756.1|  DnaJ subfamily A member 2                               146   1e-37    
gb|KFU89463.1|  DnaJ subfamily A member 2                               147   1e-37    
gb|KGL74052.1|  DnaJ subfamily A member 2                               146   1e-37    
ref|XP_007244129.1|  PREDICTED: dnaJ homolog subfamily A member 2...    147   1e-37    
gb|KFP23640.1|  DnaJ subfamily A member 2                               146   1e-37    
ref|XP_003437760.1|  PREDICTED: dnaJ homolog subfamily A member 2...    147   1e-37    
ref|XP_010888721.1|  PREDICTED: dnaJ homolog subfamily A member 2...    147   1e-37    
ref|XP_010226166.1|  PREDICTED: dnaJ homolog subfamily A member 2       147   1e-37    
gb|KFP57310.1|  DnaJ subfamily A member 2                               146   1e-37    
gb|KFQ09515.1|  DnaJ subfamily A member 2                               146   1e-37    
gb|KFP06656.1|  DnaJ subfamily A member 2                               147   1e-37    
gb|KFW64542.1|  DnaJ subfamily A member 2                               147   1e-37    
gb|KFV98944.1|  DnaJ subfamily A member 2                               146   1e-37    
gb|KFO10768.1|  DnaJ subfamily A member 2                               146   2e-37    
gb|KFO91050.1|  DnaJ subfamily A member 2                               146   2e-37    
ref|NP_998658.1|  dnaJ homolog subfamily A member 2                     147   2e-37    
gb|KFQ81485.1|  DnaJ subfamily A member 2                               146   2e-37    
ref|XP_010077475.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   2e-37    
gb|KFQ95764.1|  DnaJ subfamily A member 2                               146   2e-37    
gb|KFV83098.1|  DnaJ subfamily A member 2                               146   2e-37    
ref|XP_009585864.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   2e-37    
ref|XP_010136565.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   2e-37    
gb|KFQ73423.1|  DnaJ subfamily A member 2                               147   2e-37    
ref|XP_009485287.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   2e-37    
emb|CAD29846.1|  putative DnaJ protein                                  139   2e-37    
gb|KFM05790.1|  DnaJ subfamily A member 2                               146   2e-37    
gb|KFW75471.1|  DnaJ subfamily A member 2                               146   2e-37    
gb|KFZ68007.1|  DnaJ subfamily A member 2                               146   2e-37    
ref|NP_001004807.1|  DnaJ subfamily A member 2                          147   2e-37    
ref|XP_010300497.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   2e-37    
gb|EOA97993.1|  DnaJ-like protein subfamily A member 2                  146   2e-37    
gb|KFQ42556.1|  DnaJ subfamily A member 2                               146   2e-37    
ref|XP_009555239.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   2e-37    
gb|KFQ35044.1|  DnaJ subfamily A member 2                               146   2e-37    
ref|XP_010123723.1|  PREDICTED: dnaJ homolog subfamily A member 2       147   2e-37    
ref|XP_010146106.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   2e-37    
ref|XP_010283751.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   2e-37    
gb|KFR15862.1|  DnaJ subfamily A member 2                               146   2e-37    
ref|XP_010182112.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   2e-37    
ref|XP_005289904.1|  PREDICTED: dnaJ homolog subfamily A member 2       147   2e-37    
ref|NP_001005841.1|  dnaJ homolog subfamily A member 2                  147   2e-37    
ref|XP_009503179.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   2e-37    
ref|XP_006034403.1|  PREDICTED: dnaJ homolog subfamily A member 2       147   2e-37    
ref|XP_009892401.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   2e-37    
ref|XP_009947632.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    147   2e-37    
ref|XP_010728053.1|  PREDICTED: dnaJ homolog subfamily A member 2...    146   2e-37    
ref|XP_006261714.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   3e-37    
ref|XP_009917262.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   3e-37    
ref|XP_008499565.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   3e-37    
gb|EFX86347.1|  hypothetical protein DAPPUDRAFT_187536                  146   3e-37    
gb|EHJ78745.1|  DnaJ-like protein 2                                     140   3e-37    
ref|XP_008053212.1|  PREDICTED: dnaJ homolog subfamily A member 2       147   3e-37    
ref|XP_009676712.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    146   3e-37    
ref|XP_009318613.1|  PREDICTED: dnaJ homolog subfamily A member 2       147   3e-37    
ref|XP_005024213.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   3e-37    
emb|CDQ70216.1|  unnamed protein product                                146   4e-37    
emb|CAA73791.1|  DnaJ protein                                           144   4e-37    
ref|XP_009636345.1|  PREDICTED: dnaJ homolog subfamily A member 2       146   5e-37    
ref|XP_006191405.1|  PREDICTED: dnaJ homolog subfamily A member 2       144   5e-37    
ref|XP_009986790.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    147   5e-37    
ref|XP_010172755.1|  PREDICTED: dnaJ homolog subfamily A member 2       144   6e-37    
gb|KFO69636.1|  DnaJ subfamily A member 2                               145   6e-37    
ref|XP_004403732.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   6e-37    
ref|XP_004704755.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   7e-37    
ref|XP_003885120.1|  DnaJ domain containing protein, related            145   8e-37    
ref|XP_006121305.1|  PREDICTED: dnaJ homolog subfamily A member 2       147   8e-37    
ref|XP_008150572.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   9e-37    
ref|XP_005956400.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   9e-37    
ref|XP_006105496.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   9e-37    
ref|XP_005318528.1|  PREDICTED: dnaJ homolog subfamily A member 2       144   1e-36    
emb|CDQ89408.1|  unnamed protein product                                143   1e-36    
ref|XP_003792569.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   1e-36    
ref|XP_005880376.1|  PREDICTED: dnaJ homolog subfamily A member 2       145   1e-36    
ref|XP_009862983.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    143   1e-36    



>gb|AFR66645.1| MIP1.1a [Nicotiana benthamiana]
Length=420

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 205/211 (97%), Gaps = 1/211 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDTI+GDIVFVLQQ+EHPKFKR
Sbjct  211  GQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTISGDIVFVLQQKEHPKFKR  270

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLFVEHTL+LTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR
Sbjct  271  KGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  330

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFMRGKLYIHF+VDFPE+LSPEQCK LEAVLPPKP T +TDMELDECEETTLHDVNI EE
Sbjct  331  PFMRGKLYIHFSVDFPETLSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNI-EE  389

Query  224  mrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
              R++QQQAQEAYDED+DMHGGAQRVQCAQQ
Sbjct  390  EMRRKQQQAQEAYDEDEDMHGGAQRVQCAQQ  420



>ref|XP_006345881.1| PREDICTED: dnaJ protein homolog [Solanum tuberosum]
 gb|ABB16989.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  788  LLMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQ  609
            ++  K   GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDT+TGDIVFVLQQ
Sbjct  201  MINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ  260

Query  608  REHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAIND  429
            +EHPKFKRKGDDLFVEHTL+LTEALCGFQFILTHLDNRQL+IK QPGEVVKPDQFKAIND
Sbjct  261  KEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQPGEVVKPDQFKAIND  320

Query  428  EGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTL  249
            EGMPMYQRPFMRGKLYIHFTV+FP++LSPEQCK LEAVLPPKP T +TDMELDECEETTL
Sbjct  321  EGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMTDMELDECEETTL  380

Query  248  HDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            HDVNIEEEMRRKQQQ  +   ++D+DMHGGAQRVQCAQQ
Sbjct  381  HDVNIEEEMRRKQQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>ref|XP_009760224.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009760225.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=420

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 204/211 (97%), Gaps = 1/211 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDTITGDIVF+LQQ+EHPKFKR
Sbjct  211  GQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTITGDIVFILQQKEHPKFKR  270

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLFVEHTL+LTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR
Sbjct  271  KGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  330

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFMRGKLYIHFTVDFPE+LS EQCK LEAVLPPKP T +TDMELDECEETTLHDVNI EE
Sbjct  331  PFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNI-EE  389

Query  224  mrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
              R++QQQAQEAY+ED+DMHGGAQRVQCAQQ
Sbjct  390  EMRRKQQQAQEAYNEDEDMHGGAQRVQCAQQ  420



>ref|XP_009588725.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009588726.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 204/211 (97%), Gaps = 1/211 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKR
Sbjct  211  GQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKR  270

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLFVEHTL+LTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR
Sbjct  271  KGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  330

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFMRGKLYIHFTVDFPE+LS EQCK LEAVLPPKP T +TDMELDECEETTLHDVNI EE
Sbjct  331  PFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNI-EE  389

Query  224  mrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
              R++QQQAQEAYDED+DMHGGAQRVQCAQQ
Sbjct  390  EMRRKQQQAQEAYDEDEDMHGGAQRVQCAQQ  420



>gb|AGY48883.1| MIP1.1b [Nicotiana benthamiana]
Length=418

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 204/211 (97%), Gaps = 1/211 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKG+KVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKR
Sbjct  209  GQCKGDKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKR  268

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLFVEHTL+LTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR
Sbjct  269  KGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  328

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFMRGKLYIHFTVDFPE+LS EQCK LEAVLPPKP T +TDMELDECEETTLHDVNI EE
Sbjct  329  PFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNI-EE  387

Query  224  mrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
              R++QQQAQEAYDED+DMHGGAQRVQCAQQ
Sbjct  388  EMRRKQQQAQEAYDEDEDMHGGAQRVQCAQQ  418



>emb|CAA63965.1| DnaJ protein [Solanum tuberosum]
Length=419

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = -1

Query  788  LLMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQ  609
            ++  K   GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDT+TGDIVFVLQQ
Sbjct  201  MINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ  260

Query  608  REHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAIND  429
            +EHPKFKRKGDDLFVEHTL+LTEALCGFQFILTHLDNRQL+IK Q GEVVKPDQFKAIND
Sbjct  261  KEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQAGEVVKPDQFKAIND  320

Query  428  EGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTL  249
            EGMPMYQRPFMRGKLYIHFTV+FP++LSPEQCK LEAVLPPKP T +TDMELDECEETTL
Sbjct  321  EGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMTDMELDECEETTL  380

Query  248  HDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            HDVNIEEEMRRKQQQ  +   ++D+DMHGGAQRVQCAQQ
Sbjct  381  HDVNIEEEMRRKQQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>dbj|BAC53943.1| DnaJ homolog [Nicotiana tabacum]
Length=339

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 203/212 (96%), Gaps = 1/212 (0%)
 Frame = -1

Query  767  AGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFK  588
             GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDTITGDIVF+LQQ+EHPKFK
Sbjct  129  CGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTITGDIVFILQQKEHPKFK  188

Query  587  RKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ  408
            RK DDLFVEHTL+LTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ
Sbjct  189  RKEDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ  248

Query  407  RPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIee  228
            RPFMRGKLYIHFTVDFPE+LS EQCK LEAVLPPKP T +TDMELDECEETTLHDVNI E
Sbjct  249  RPFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNI-E  307

Query  227  emrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            E  R++QQQAQEAY+ED+DMHGGAQRVQCAQQ
Sbjct  308  EEMRRKQQQAQEAYNEDEDMHGGAQRVQCAQQ  339



>gb|AAN87055.1| tuber-induction protein [Solanum tuberosum]
Length=315

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -1

Query  788  LLMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQ  609
            ++  K   GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPG+ DEAPDT+TGDIVFVLQQ
Sbjct  97   MINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGDMDEAPDTVTGDIVFVLQQ  156

Query  608  REHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAIND  429
            +EHPKFKRKGDDLFVEHTL+LTEALCGFQFILTHLDNRQL+IK Q GEVVKPDQFKAIND
Sbjct  157  KEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQAGEVVKPDQFKAIND  216

Query  428  EGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTL  249
            EGMPMYQRPFMRGKLYIHFTV+FP++LSPEQCK LEAVLPPKP T +TDMELDECEETTL
Sbjct  217  EGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMTDMELDECEETTL  276

Query  248  HDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            HDVNIEEEMRRKQQQ  +   ++D+DMHGGAQRVQCAQQ
Sbjct  277  HDVNIEEEMRRKQQQAQEAYDEDDEDMHGGAQRVQCAQQ  315



>ref|XP_004239737.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = -1

Query  788  LLMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQ  609
            ++  K   GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDT+TGDIVFVLQQ
Sbjct  201  MINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ  260

Query  608  REHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAIND  429
            +EHPKFKRKGDDLFVEHTL+LTEALCGFQFILTHLD RQL+IKSQPGEVVKPDQFKAIND
Sbjct  261  KEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDTRQLIIKSQPGEVVKPDQFKAIND  320

Query  428  EGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTL  249
            EGMPMYQRPFMRGKLYIHFTV+FP++LS EQCK LEAVLPPKP T +TDMELDECEETTL
Sbjct  321  EGMPMYQRPFMRGKLYIHFTVEFPDTLSLEQCKNLEAVLPPKPKTQMTDMELDECEETTL  380

Query  248  HDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            HDVNIEEEMRRKQQQ  +   ++D+DMHGGAQRVQCAQQ
Sbjct  381  HDVNIEEEMRRKQQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>gb|ABB16980.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -1

Query  788  LLMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQ  609
            ++  K   GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDT+TGDIVFVLQQ
Sbjct  201  MINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ  260

Query  608  REHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAIND  429
            +EHPKFKRKGDDLFVEH L+LTE LCGFQFILTHLDNRQL+IK QPGEVVKPDQFKAIND
Sbjct  261  KEHPKFKRKGDDLFVEHXLSLTEXLCGFQFILTHLDNRQLIIKPQPGEVVKPDQFKAIND  320

Query  428  EGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTL  249
            EGMPMYQRPFMRGKLYIHFTV+FP++LSPEQCK LEAVLPPKP T +TDMELDECEETTL
Sbjct  321  EGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMTDMELDECEETTL  380

Query  248  HDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            HDV IEEEMRRKQQQ  +   ++D+DMHGGAQRVQCAQQ
Sbjct  381  HDVXIEEEMRRKQQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>gb|AGY48885.1| MIP1.3 [Nicotiana benthamiana]
Length=418

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+TITGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESL+PE
Sbjct  291  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPE  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP   +++MELDECEETTLHDVNIEEEMRRKQQ   +   ++DD   GG
Sbjct  351  QCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRKQQAAQEAYDEDDDMP-GG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_009793842.1| PREDICTED: dnaJ protein homolog isoform X2 [Nicotiana sylvestris]
Length=412

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+TITGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  225  MQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  284

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESL+PE
Sbjct  285  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPE  344

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP   +++MELDECEETTLHDVNIEEEMRRKQQ   +   ++DD   GG
Sbjct  345  QCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRKQQAAQEAYDEDDDMP-GG  403

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  404  AQRVQCAQQ  412



>ref|XP_009793841.1| PREDICTED: dnaJ protein homolog isoform X1 [Nicotiana sylvestris]
Length=418

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+TITGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESL+PE
Sbjct  291  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPE  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP   +++MELDECEETTLHDVNIEEEMRRKQQ   +   ++DD   GG
Sbjct  351  QCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRKQQAAQEAYDEDDDMP-GG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_004249937.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  232  MQNGQKVTFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGK+YIHFTVDFPESL+ E
Sbjct  292  VLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPESLTAE  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP   ++DMELDECEETTLHDVNIE+EMRRKQQ   +   ++DD   GG
Sbjct  352  QCKNLEAVLPPKPKLQVSDMELDECEETTLHDVNIEDEMRRKQQAAQEAYDEDDDMP-GG  410

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  411  AQRVQCAQQ  419



>ref|XP_009600920.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009600921.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=417

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+TITGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESL+PE
Sbjct  290  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP   +++MELDECEETTLHDVNIEEEMRRKQQ   +   D+DD   GG
Sbjct  350  QCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRKQQAAQEAYDDDDDMP-GG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_006365672.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
Length=419

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAP+TITGDIVFVLQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  232  MQNGQKVTFPGEADEAPETITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGK+YIHFTVDFPESL+PE
Sbjct  292  VLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPESLTPE  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+P   ++DMELDECEETTLHDVNIE+EMRRKQQ   +   ++DD   GG
Sbjct  352  QCKNLEAVLPPRPKLQVSDMELDECEETTLHDVNIEDEMRRKQQAAQEAYDEDDDMP-GG  410

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  411  AQRVQCAQQ  419



>gb|KJB84159.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84160.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84161.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84162.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84166.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTLALTEALCGFQF
Sbjct  230  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLALTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIK+QPGEVVKPDQFKAINDEGMP+YQRPFMRGKL+IHFTVDFP+SL+P+
Sbjct  290  ILTHLDGRQLLIKTQPGEVVKPDQFKAINDEGMPIYQRPFMRGKLFIHFTVDFPDSLTPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPK +  +TDMELDECEETT+HDVNIEEEMRRKQ Q  QEAY+ED+DMHGG
Sbjct  350  QCKALEAVLPPKASVQLTDMELDECEETTMHDVNIEEEMRRKQAQAQQEAYEEDEDMHGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_006365673.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
Length=412

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAP+TITGDIVFVLQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  225  MQNGQKVTFPGEADEAPETITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  284

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGK+YIHFTVDFPESL+PE
Sbjct  285  VLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPESLTPE  344

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+P   ++DMELDECEETTLHDVNIE+EMRRKQQ   +   ++DD   GG
Sbjct  345  QCKNLEAVLPPRPKLQVSDMELDECEETTLHDVNIEDEMRRKQQAAQEAYDEDDDMP-GG  403

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  404  AQRVQCAQQ  412



>ref|XP_010907714.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=415

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFFEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+SL+ E
Sbjct  288  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLTLE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP + +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED+D+HGG
Sbjct  348  QCKALEAVLPPKPVSQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEDVHGG  406

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  407  AQRVQCAQQ  415



>gb|KDO48709.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=381

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  194  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  253

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  254  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  313

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  314  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  372

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  373  AQRVQCAQQ  381



>ref|XP_008787761.1| PREDICTED: dnaJ protein homolog [Phoenix dactylifera]
Length=415

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLF E TL+LTEALCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFYESTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGE+VKPDQFKAINDEGMP+YQRPFMRGKLYIHFTVDFP+SL+PE
Sbjct  288  VLTHLDNRQLLIKSNPGEIVKPDQFKAINDEGMPIYQRPFMRGKLYIHFTVDFPDSLAPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+P + +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED++ HGG
Sbjct  348  QCKALEAVLPPRPVSQMTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEEAHGG  406

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  407  AQRVQCAQQ  415



>ref|XP_007010484.1| DNAJ [Theobroma cacao]
 gb|EOY19294.1| DNAJ [Theobroma cacao]
Length=417

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  230  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+SL P+
Sbjct  290  ILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLIPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED+DMHGG
Sbjct  350  QCKALEAVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>gb|KDO48708.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=383

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  196  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  255

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  256  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  315

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  316  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  374

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  375  AQRVQCAQQ  383



>ref|XP_011032891.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011032892.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=420

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTL+LTEALCGF F
Sbjct  232  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALCGFHF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF+VDFP+SLS +
Sbjct  292  VLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLSAD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEA LPP+ +  +TDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDDMHGG
Sbjct  352  QCKALEAALPPRASVQLTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDDMHGG  411

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  412  AQRVQCAQQ  420



>gb|AAG24642.1|AF308737_1 J1P [Daucus carota]
 gb|AAG24643.1|AF308738_1 J2P [Daucus carota]
Length=418

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEH+L L+EALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHSLTLSEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD RQLLIKSQPGEV+KPDQFK INDEGMPMYQRPFMRGKLYIHF+VDFPESL+PE
Sbjct  291  TLTHLDGRQLLIKSQPGEVIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPESLTPE  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+P+  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDED+DMHGG
Sbjct  351  QCKALEAVLPPRPSIQMTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDEDMHGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>gb|KDO48711.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48712.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48713.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=402

 Score =   312 bits (799),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  215  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  274

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  275  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  334

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  335  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  393

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  394  AQRVQCAQQ  402



>gb|KDO48714.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=335

 Score =   310 bits (793),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  148  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  207

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  208  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  267

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  268  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  326

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  327  AQRVQCAQQ  335



>ref|XP_009398344.1| PREDICTED: dnaJ protein homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKI+FPGEADEAPDT TGDIVFVLQQ++HPK+KRKGDD+F EHTL+LTEALCGFQF
Sbjct  230  MQNGQKISFPGEADEAPDTATGDIVFVLQQKDHPKYKRKGDDIFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIK  PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+SL+P+
Sbjct  290  VLTHLDNRQLLIKLNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLTPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP + +TDMELDECEETT+HDVN+EEEMRRKQ Q  +   ++DDD+HGG
Sbjct  350  QCKALEAVLPPKPASQMTDMELDECEETTVHDVNMEEEMRRKQAQAQEAYEEDDDDVHGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>gb|KDO48707.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=382

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  195  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  254

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  255  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  314

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  315  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  373

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  374  AQRVQCAQQ  382



>ref|XP_006485485.1| PREDICTED: dnaJ protein homolog [Citrus sinensis]
Length=416

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  289  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  349  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_009397426.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=416

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFVLQQ++HPKFKRKGDDLF EH L+LTEALCGF+F
Sbjct  229  MQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGDDLFYEHALSLTEALCGFRF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+S++PE
Sbjct  289  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSMTPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE+VLPPKP + +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+EDDDMHGG
Sbjct  349  QCKALESVLPPKPASQMTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDDDMHGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>gb|KDO48710.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=401

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  214  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  273

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  274  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  333

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  334  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  392

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  393  AQRVQCAQQ  401



>ref|XP_009623415.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009623416.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 182/192 (95%), Gaps = 3/192 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+TITGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKSQPGEVVKPDQFK INDEGMPMYQRPFMRGKLYIHFTVDFPE+L+PE
Sbjct  289  VLTHLDSRQLLIKSQPGEVVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPETLAPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeayde---dddM  168
             CK LEAVLPP+P T  +DMELDECEETTLHDVN+EEEMRRK+QQQAQEAY+E   DDDM
Sbjct  349  LCKNLEAVLPPRPKTQASDMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDDDDDM  408

Query  167  HGGAQRVQCAQQ  132
            HGGAQRVQCAQQ
Sbjct  409  HGGAQRVQCAQQ  420



>dbj|BAA35121.1| DnaJ homolog [Salix gilgiana]
Length=420

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  232  MQNGQKVTFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF+V+FP+SLSP+
Sbjct  292  VLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVEFPDSLSPD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
             CK LEAVLPP+ +  +TDMELDECEETTLHDVNI+EEMRRKQQQQAQEAYDEDD+M GG
Sbjct  352  MCKALEAVLPPRASVQLTDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDEMPGG  411

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  412  AQRVQCAQQ  420



>gb|KJB60379.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60380.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60381.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60382.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60383.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
Length=418

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRK DDLFVEHTL LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKSDDLFVEHTLTLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIK+ PGEVVKPDQFKAINDEGM MYQRPFMRGKLYIHFTVDFP+SL+PE
Sbjct  290  ILTHLDGRQLLIKTHPGEVVKPDQFKAINDEGMAMYQRPFMRGKLYIHFTVDFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +  +TDMELDECEETTL+DVNIEEEMRRKQ Q AQEAY+EDDDMHGG
Sbjct  350  QCKALEAVLPPRTSVQLTDMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDDMHGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_008345828.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLF EHTL+L E+LCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPK +  +TDMELDECEETTLHDVNI EE  R++Q  A EAYD+D+DMHGG
Sbjct  350  QCKALEAVLPPKTSAQLTDMELDECEETTLHDVNI-EEEMRRKQAHAHEAYDDDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_004306421.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=410

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLF EHTL+L EALCGFQF
Sbjct  222  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLMEALCGFQF  281

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKS PGEVVKPDQFKAINDEGMPMYQR FM+GKLYIHFTV+FP+SL+PE
Sbjct  282  VLTHLDSRQLLIKSHPGEVVKPDQFKAINDEGMPMYQRAFMKGKLYIHFTVEFPDSLNPE  341

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +T +TDMELDECEETTLHDVNIEEEMRRKQ QQ+QEAYDED+DMHGG
Sbjct  342  QCKTLEAVLPPRSSTQLTDMELDECEETTLHDVNIEEEMRRKQGQQSQEAYDEDEDMHGG  401

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  402  AQRVQCAQQ  410



>ref|XP_007211787.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
 gb|EMJ12986.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
Length=417

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLF EHTL+L EALCGF F
Sbjct  230  MQNGQRITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVEALCGFHF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCKGLEAVLPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAYDEDDDMHGG
Sbjct  350  QCKGLEAVLPPRSSAQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYDEDDDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_010907982.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFFEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGM +YQRPFMRGKLYIHF VDFP+SL+P+
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMTLYQRPFMRGKLYIHFAVDFPDSLTPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK +EAVLPPKP + +TDME+DECEETTLHDVNI EE  R++Q QAQEAY+ED++ HGG
Sbjct  350  QCKAIEAVLPPKPVSQLTDMEIDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEEAHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_002310999.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE88366.1| DnaJ family protein [Populus trichocarpa]
Length=420

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTL+LTEALCGF F
Sbjct  232  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALCGFHF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF+VDFP+SLS +
Sbjct  292  VLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLSTD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +  +TDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDD+M GG
Sbjct  352  QCKALEAVLPPRASVQLTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDEMPGG  411

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  412  AQRVQCAQQ  420



>ref|XP_008231805.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=417

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLF EHTL+L E+LCGF F
Sbjct  230  MQNGQRITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLCGFHF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCKGLEAVLPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAYDEDDDMHGG
Sbjct  350  QCKGLEAVLPPRSSAQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYDEDDDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>gb|ABA46776.1| DnaJ-like protein [Solanum tuberosum]
Length=443

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  788  LLMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQ  609
            ++  K   GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDT+TGDIVFVLQQ
Sbjct  201  MINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ  260

Query  608  REHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAIND  429
            +EHPKFKRKGDDLFVEHTL+LTEALCGFQFILTHLDNRQL+IK QPGEVVKPDQFKAIND
Sbjct  261  KEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQPGEVVKPDQFKAIND  320

Query  428  EGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTL  249
            EGMPMYQRPFMRGKLYIHFTV+FP++LSPEQCK LEAVLPPKP T +TDMELDECEETTL
Sbjct  321  EGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMTDMELDECEETTL  380

Query  248  HDVNIeeemrrkqqqqaqeaydedddMHGGAQR  150
            HDV+IEEEMRRKQQQ  +   ++D+DMHGGAQR
Sbjct  381  HDVHIEEEMRRKQQQAQEAYDEDDEDMHGGAQR  413



>ref|XP_010319287.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum lycopersicum]
Length=337

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADE PDT+TGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  148  MQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  207

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTVDFP +L+PE
Sbjct  208  VLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNTLTPE  267

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI-eeemrrkqqqqaqeaydedddMHG  162
             CK LEAVLP +P T  +DMELDECEETTLHDVNI EE  R++QQQ  +   ++DDDMHG
Sbjct  268  LCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHG  327

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  328  GAQRVQCAQQ  337



>sp|P42824.1|DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2; Flags: Precursor [Allium 
ampeloprasum]
 emb|CAA54720.1| LDJ2 [Allium ampeloprasum]
Length=418

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLF EH+L+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFYEHSLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEV+KPDQFK INDEGMPMYQRPFMRGKLYIHF+VDFP+SL+P+
Sbjct  290  VLTHLDNRQLLIKSNPGEVIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPDSLTPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE+VLP +  + +TDME+DECEETT+HDVNIEEEMRRKQ QQAQEAYDEDD+ HGG
Sbjct  350  QCKALESVLPSRNASRLTDMEIDECEETTMHDVNIEEEMRRKQHQQAQEAYDEDDEGHGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_010090486.1| DnaJ-like protein [Morus notabilis]
 gb|EXB39585.1| DnaJ-like protein [Morus notabilis]
Length=417

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDD+F EHTL+LTEALCGFQF
Sbjct  230  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDIFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SLSPE
Sbjct  290  ILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+    +TDME+DECEETTLHDVNI EE  R++Q QAQEAYDEDDDMHGG
Sbjct  350  QCKALETVLPPRSGQQLTDMEIDECEETTLHDVNI-EEEMRRKQAQAQEAYDEDDDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_009766164.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
 ref|XP_009766166.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
Length=419

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+TITGDIVF+LQQ+EHPKFKRKGDDLF EHTL LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFAEHTLTLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKSQPGEVVKPDQFK INDEGMPMYQRPFMRGKLYIHFTVDFP++L+PE
Sbjct  289  VLTHLDSRQLLIKSQPGEVVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPDTLAPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeay--dedddMH  165
             CK LEAVLPP+P T  +DMELDECEETTLHDVN+EEEMRRK+QQQAQEAY  D+DDDMH
Sbjct  349  LCKNLEAVLPPRPKTQASDMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDDDDMH  408

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  409  GGAQRVQCAQQ  419



>ref|XP_006445792.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
 gb|ESR59032.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
Length=416

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EH KFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHLKFKRKGDDLFVEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSP+
Sbjct  289  VITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDEDDDM GG
Sbjct  349  QCKMLETVLPPRTSVQLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDDDMQGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_009341572.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=417

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLF EHTL+L E+LCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQR FM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRSFMKGKLYIHFTVEFPDSLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPK +  +TDMELDECEETTLHDVNI EE  R++Q  A EAYD+D+DMHGG
Sbjct  350  QCKALEAVLPPKTSAQLTDMELDECEETTLHDVNI-EEEMRRKQAHAHEAYDDDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_010694477.1| PREDICTED: dnaJ protein homolog [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVF+LQQ+EH K+KRKGDDLF EHTL+LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPDTVTGDIVFILQQKEHSKYKRKGDDLFYEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKSQPGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+ +
Sbjct  291  VLTHLDNRQLLIKSQPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAVD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+    +TDMELDECEETTLHDVNIEEEMRRK+ +  QEAYDED+DMHGG
Sbjct  351  QCKSLEAVLPPRSAAQLTDMELDECEETTLHDVNIEEEMRRKEARAQQEAYDEDEDMHGG  410

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  411  AQRVQCAQQ  419



>ref|XP_004236804.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum lycopersicum]
Length=418

 Score =   307 bits (786),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADE PDT+TGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTVDFP +L+PE
Sbjct  289  VLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNTLTPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI-eeemrrkqqqqaqeaydedddMHG  162
             CK LEAVLP +P T  +DMELDECEETTLHDVNI EE  R++QQQ  +   ++DDDMHG
Sbjct  349  LCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHG  408

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  409  GAQRVQCAQQ  418



>ref|XP_004166311.1| PREDICTED: dnaJ protein homolog, partial [Cucumis sativus]
Length=311

 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 3/189 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  126  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  185

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD RQLLIK+ PGEVVKPD FKAINDEGMP+YQRPFM+GKLYIHF+VDFP+SLSPE
Sbjct  186  ALTHLDGRQLLIKTNPGEVVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDSLSPE  245

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLP KP++ +TDMELDECEET++HDVNI       +++Q  EAY+ED+DMHGG
Sbjct  246  QIKALEAVLPSKPSSQLTDMELDECEETSMHDVNI---EEEMRRKQQAEAYEEDEDMHGG  302

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  303  AQRVQCAQQ  311



>gb|AGY48886.1| MIP1.4a [Nicotiana benthamiana]
Length=403

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ++HP+FKRKGDDLFV+HTL+LTEALCGFQF
Sbjct  216  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQF  275

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            I+THLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF V+FPESLSPE
Sbjct  276  IITHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPESLSPE  335

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLPP+P +  TDMELDECEET+LHDVNI EE  R++Q   QEAYDEDD++HGG
Sbjct  336  QAKALEAVLPPRPQSQYTDMELDECEETSLHDVNI-EEEMRRKQAAQQEAYDEDDELHGG  394

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  395  GQRVQCAQQ  403



>ref|XP_008375557.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLF EHTL+L E+LCGFQF
Sbjct  230  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLMESLCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  ILTHLDGRQLLIKSHPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +  +TDMELDECEETTLHDVNI EE  R++Q  AQEAYDED+DMHGG
Sbjct  350  QCKALEAVLPPRTSAQLTDMELDECEETTLHDVNI-EEEMRRKQAHAQEAYDEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_004982304.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADEAPDT TGDIVFVLQQ++H KFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  230  MQHGQKITFPGEADEAPDTTTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDV-NIeeemrrkqqqqaqeaydedddMHG  162
            QCK LEAVLPPKPT+ +TDME+DECEETT+HDV NIEEEMRRKQ   AQEAY+EDDDM G
Sbjct  350  QCKALEAVLPPKPTSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDDMPG  409

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  410  GAQRVQCAQQ  419



>gb|AGY48884.1| MIP1.2 [Nicotiana benthamiana]
Length=419

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 181/191 (95%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+TITGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKSQPGEVVKPDQFK INDEGMPMYQRPFMRGKLYIHFTVDFP++ +PE
Sbjct  289  VLTHLDSRQLLIKSQPGEVVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPDTFAPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeay--dedddMH  165
             CK LEAVLPP+P T  ++MELDECEETTLHDVN+EEEMRRK+QQQAQEAY  D++DDMH
Sbjct  349  MCKNLEAVLPPRPKTQASNMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDEDDMH  408

Query  164  GGAQRVQCAQQ  132
            GGAQRV+CAQQ
Sbjct  409  GGAQRVECAQQ  419



>gb|KCW50581.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=296

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKI FPGEADEAPDT+TGDIVFVLQQ+EHPK+KRKGDDLF EHTL+LTE+LCGFQF
Sbjct  109  MQNGQKIKFPGEADEAPDTVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLCGFQF  168

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             L+HLD RQLLIKSQPGEV+KPDQFKAINDEGMP+Y RPFM+GKLYIHFTV+FP++LSPE
Sbjct  169  ALSHLDGRQLLIKSQPGEVIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDTLSPE  228

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE +LPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED+DMHGG
Sbjct  229  QCKALETILPPRSSAQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEDMHGG  287

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  288  AQRVQCAQQ  296



>ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 ref|XP_010658892.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 emb|CBI24994.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 176/189 (93%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHF VDFP+SL+ +
Sbjct  290  ILTHLDGRQLLIKSHPGEVVKPDQFKAINDEGMPIYQKPFMKGKLYIHFAVDFPDSLNTD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +T +TDME+DECEETTLHDVNI  E   +++Q AQEAY+ED+D+HGG
Sbjct  350  QCKALEAVLPPRTSTQLTDMEIDECEETTLHDVNI--EEEMRRKQAAQEAYEEDEDIHGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_002316479.1| DnaJ family protein [Populus trichocarpa]
 gb|ABK95315.1| unknown [Populus trichocarpa]
 gb|EEF02650.1| DnaJ family protein [Populus trichocarpa]
Length=422

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN Q+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+L EALCGFQF
Sbjct  233  MQNAQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+SLS +
Sbjct  293  ILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLSLD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-G  162
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDD+MH G
Sbjct  353  QCKALETVLPPRTSAELTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDEMHGG  412

Query  161  GAQRVQCAQQ  132
            G QRVQCAQQ
Sbjct  413  GGQRVQCAQQ  422



>ref|XP_009789005.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=418

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ++HP+FKRKGDDLFV+HTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF V+FP+SLSPE
Sbjct  290  ILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPDSLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPP+P +  TDMELDECEET+LHDVNIEEEMRRKQ  Q +   ++D+   GG
Sbjct  350  QVKALEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQQEAYDEDDEMHGGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  GQRVQCAQQ  418



>ref|XP_010263054.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=416

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITF GEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  229  MQNGQRITFQGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTV+FP+SL+ E
Sbjct  289  VLTHLDNRQLLIKSSPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDSLTME  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED+D+HGG
Sbjct  349  QCKALEAVLPPRTSQQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEDVHGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_002270362.1| PREDICTED: dnaJ protein homolog isoform X1 [Vitis vinifera]
 emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera]
Length=417

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFMRGKLYI F V+FP++LSPE
Sbjct  290  ILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDTLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLP + TT +TDMELDECEETTLHDVNIEEEMRRKQ Q  +   ++++   GG
Sbjct  350  QCKALEAVLPARATTQLTDMELDECEETTLHDVNIEEEMRRKQAQAQEAYEEDEEMP-GG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>emb|CAN82708.1| hypothetical protein VITISV_000291 [Vitis vinifera]
Length=407

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 176/189 (93%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  221  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  280

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHF VDFP+SL+ +
Sbjct  281  ILTHLDGRQLLIKSHPGEVVKPDQFKAINDEGMPIYQKPFMKGKLYIHFAVDFPDSLNTD  340

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +T +TDME+DECEETTLHDVNI  E   +++Q AQEAY+ED+D+HGG
Sbjct  341  QCKALEAVLPPRTSTQLTDMEIDECEETTLHDVNI--EEEMRRKQAAQEAYEEDEDIHGG  398

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  399  AQRVQCAQQ  407



>ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum]
 gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum]
Length=419

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+L E+LCGFQF
Sbjct  232  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLDESLCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GK+YIHFTVDFPESL  E
Sbjct  292  VLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKMYIHFTVDFPESLHAE  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPK    I+DMELDE EETTLHDVNIEEEMRRKQQ   +   ++DD   GG
Sbjct  352  QCKNLEAVLPPKTKLQISDMELDEWEETTLHDVNIEEEMRRKQQAAQEAQDEDDDMP-GG  410

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  411  AQRVQCAQQ  419



>ref|XP_010263053.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=417

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITF GEADEAPDTITGDIVFVLQQ+EHPKFKRKGDD+F EHTL+LTEALCGFQF
Sbjct  230  MQNGQRITFQGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDIFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+SL+ E
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVEFPDSLTME  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED+D HGG
Sbjct  350  QCKALEAVLPPRTSQQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEDAHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|ABH06547.1| molecular chaperone [Ricinus communis]
 gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   305 bits (780),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDL VEHTL+LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLVVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF+VDFP+SL P+
Sbjct  291  ILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLPPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLP + +  ++DMELDECEETTLHDVN  EE  R++QQQAQEAYDED+DMHGG
Sbjct  351  QCKALETVLPSRTSVQLSDMELDECEETTLHDVNF-EEEMRRKQQQAQEAYDEDEDMHGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_011084248.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
 ref|XP_011084249.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=418

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADEAPDT+TGDIVFVLQQ+E+PKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  231  MQHGQKITFPGEADEAPDTVTGDIVFVLQQKEYPKFKRKGDDLFVEHTLTLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLDNRQLLIKS+PGEV+KPDQFKAINDEGMPMYQR FM+GKLYI FTVDFPESLSP+
Sbjct  291  ILTHLDNRQLLIKSEPGEVIKPDQFKAINDEGMPMYQRSFMKGKLYIQFTVDFPESLSPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE VLPP+PTT +TDMELDECEETTLHDVN+ EE  R++QQ AQEAY+EDDDMHGG
Sbjct  351  QSKALEGVLPPRPTTRLTDMELDECEETTLHDVNM-EEEMRRKQQHAQEAYEEDDDMHGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  PQRVQCAQQ  418



>ref|XP_011024143.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011024144.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=422

 Score =   305 bits (780),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN Q+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+L EALCGFQF
Sbjct  233  MQNAQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+SLS +
Sbjct  293  ILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLSLD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-G  162
            QCK LE +LPP+ +  +TDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDDMH G
Sbjct  353  QCKALETMLPPRTSAELTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDDMHSG  412

Query  161  GAQRVQCAQQ  132
            G QRVQCAQQ
Sbjct  413  GGQRVQCAQQ  422



>ref|XP_010651845.1| PREDICTED: dnaJ protein homolog isoform X2 [Vitis vinifera]
Length=417

 Score =   304 bits (779),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFMRGKLYI F V+FP++LSPE
Sbjct  290  ILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDTLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLP + TT +TDMELDECEETTLHDVNIEEEMRRKQ Q  +   ++++   GG
Sbjct  350  QCKALEAVLPARATTQLTDMELDECEETTLHDVNIEEEMRRKQAQAQEAYEEDEEMP-GG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_006378828.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
 gb|ERP56625.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
Length=459

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN Q+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+L EALCGFQF
Sbjct  270  MQNAQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALCGFQF  329

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+SLS +
Sbjct  330  ILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLSLD  389

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-G  162
            QCK LE VLPP+ +  +TDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDD+MH G
Sbjct  390  QCKALETVLPPRTSAELTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDEMHGG  449

Query  161  GAQRVQCAQQ  132
            G QRVQCAQQ
Sbjct  450  GGQRVQCAQQ  459



>gb|ABI83623.1| DnaJ-like protein [Setaria italica]
Length=419

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADEAPDT TGD VFVLQQ++H KFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  230  MQHGQKITFPGEADEAPDTTTGDTVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDV-NIeeemrrkqqqqaqeaydedddMHG  162
            QCK LEAVLPPKPT+ +TDME+DECEETT+HDV NIEEEMRRKQ   AQEAY+EDDDM G
Sbjct  350  QCKALEAVLPPKPTSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDDMPG  409

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  410  GAQRVQCAQQ  419



>ref|XP_004139085.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 gb|KGN66611.1| DnaJ [Cucumis sativus]
Length=413

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 3/189 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD RQLLIK+ PGEVVKPD FKAINDEGMP+YQRPFM+GKLYIHF+VDFP+SLSPE
Sbjct  288  ALTHLDGRQLLIKTNPGEVVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDSLSPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLP KP++ +TDMELDECEET++HDVNI       +++Q  EAY+ED+DMHGG
Sbjct  348  QIKALEAVLPSKPSSQLTDMELDECEETSMHDVNI---EEEMRRKQQAEAYEEDEDMHGG  404

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  405  AQRVQCAQQ  413



>ref|XP_004169945.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: 
Precursor [Cucumis sativus]
 emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus]
 gb|KGN52169.1| hypothetical protein Csa_5G613470 [Cucumis sativus]
Length=413

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 3/189 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+L E+LCGFQF
Sbjct  228  MQNAQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLVESLCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHF+V+FP+SL+PE
Sbjct  288  ILTHLDGRQLLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  ++DMELDECEETTLHDVNI       +++QAQEAYDED+DMHGG
Sbjct  348  QCKALEGVLPPRTSVQLSDMELDECEETTLHDVNI---EEEMRRKQAQEAYDEDEDMHGG  404

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  405  AQRVQCAQQ  413



>gb|ABX57881.1| DnaJ [Viola baoshanensis]
Length=417

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIV VLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVSVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             L HLDNRQLLIKSQPGEVVKPDQFKAINDEGMP+YQRPFMRGKLYIHFTV+FP+SL+P+
Sbjct  290  ALAHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIHFTVEFPDSLTPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + +EAVLP +P+  +TDME+DECEETTLHDVNI E+  R++QQQAQEAYDED+DMHGG
Sbjct  350  QSRAIEAVLPARPSPQLTDMEVDECEETTLHDVNI-EDEMRRKQQQAQEAYDEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>emb|CDO99946.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 173/189 (92%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK DDLF EHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKHDDLFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEV+KPDQFKAINDEGM +YQRPFMRGKLYIHF V+FP+ L PE
Sbjct  290  ILTHLDGRQLLIKSQPGEVLKPDQFKAINDEGMVVYQRPFMRGKLYIHFNVEFPDYLDPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPK T  ITDMELDECEETTLHDVNI  E   +++QQAQEAY+ED+DMHGG
Sbjct  350  QCKSLEAVLPPKTTKQITDMELDECEETTLHDVNI--EDEMRRKQQAQEAYEEDEDMHGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_006367021.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum tuberosum]
Length=338

 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 177/191 (93%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADE PDT+TGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  148  MQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  207

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTVDFP  L+PE
Sbjct  208  VLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNILTPE  267

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
             CK LEAVLP +P T  +DMELDECEETTLHDVNI+EEMRRKQQQQAQEAYDEDDD    
Sbjct  268  LCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHG  327

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  328  GGAQRVQCAQQ  338



>ref|XP_007015641.1| DNAJ isoform 2 [Theobroma cacao]
 gb|EOY33260.1| DNAJ isoform 2 [Theobroma cacao]
Length=414

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADE PDTITGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  228  MQHGQKITFPGEADEVPDTITGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS  GE+VKPD FKAINDEGMP+YQRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  288  VLTHLDGRQLLIKSNSGEIVKPDSFKAINDEGMPLYQRPFMKGKLYIHFTVDFPDSLSPD  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + LEA+LPPKPT+ +TDMELDECEETTLHDVNI  E   +++QQA +   ++++MHGG
Sbjct  348  QVQALEAILPPKPTSQLTDMELDECEETTLHDVNI--EEEMRRKQQAAQETLDEEEMHGG  405

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  406  AQRVQCAQQ  414



>ref|XP_008443634.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 3/189 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIK+ PGEVVKPD FKAINDEGMP+YQRPFM+GKLYIHF+VDFP+SLSPE
Sbjct  288  VLTHLDGRQLLIKTNPGEVVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDSLSPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE VLP KP++ +TDMELDECEET++HDVNI       +++Q  EAY+ED+DMHGG
Sbjct  348  QIKALETVLPSKPSSQLTDMELDECEETSMHDVNI---EEEMRRKQQAEAYEEDEDMHGG  404

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  405  AQRVQCAQQ  413



>gb|AFK48086.1| unknown [Medicago truncatula]
Length=227

 Score =   296 bits (757),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  39   MQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQF  98

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FP++LS +
Sbjct  99   VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLD  158

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q KGLEAVLP KP++ +TDME+DECEETTLHDVN+EEE RRKQQQQ QEAYDEDDDM GG
Sbjct  159  QVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDDMPGG  218

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  219  AQRVQCAQQ  227



>gb|AGY48887.1| MIP1.4b [Nicotiana benthamiana]
Length=418

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ++HP+FKRKGDDLFV+HTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            I+THLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF V+FP+SLSPE
Sbjct  290  IITHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPDSLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPP+P +  TDMELDECEET+LHDVNIEEEMRRKQ  Q +   ++D+   GG
Sbjct  350  QVKTLEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQQEAYDEDDEMHGGG  409

Query  158  AQRVQCAQQ  132
             QRV+CAQQ
Sbjct  410  GQRVECAQQ  418



>gb|AAX95135.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97900.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
Length=416

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  228  MQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  288  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP + +T+ME+DECEETT+HDVN  EE  R++ Q AQEAYDEDD+M GG
Sbjct  348  QCKALEAVLPPKPASQLTEMEIDECEETTMHDVNNIEEEMRRKAQAAQEAYDEDDEMPGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|NP_001050779.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|AAO72551.1| DNAJ-like protein [Oryza sativa Japonica Group]
 gb|AAU89194.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97899.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF97901.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12693.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|EAY94672.1| hypothetical protein OsI_16451 [Oryza sativa Indica Group]
 gb|EAZ27951.1| hypothetical protein OsJ_11911 [Oryza sativa Japonica Group]
 gb|ACA50510.1| DnaJ protein [Oryza sativa Japonica Group]
 dbj|BAG97073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  229  MQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  289  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP + +T+ME+DECEETT+HDVN  EE  R++ Q AQEAYDEDD+M GG
Sbjct  349  QCKALEAVLPPKPASQLTEMEIDECEETTMHDVNNIEEEMRRKAQAAQEAYDEDDEMPGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|NP_001238341.1| seed maturation protein PM37 [Glycine max]
 gb|AAD51625.1|AF169022_1 seed maturation protein PM37 [Glycine max]
 gb|KHN21201.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   302 bits (773),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKAEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+P+
Sbjct  290  VLTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLPPKP++ +TDMELDECEETTLHDVN+EEE RRKQQQ  +   ++DD   GG
Sbjct  350  QVKALEAVLPPKPSSQLTDMELDECEETTLHDVNMEEETRRKQQQAQEAYDEDDDMP-GG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_009418972.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   301 bits (772),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQ ++H KFKRKGDDLF EHTL+L+EALCGFQ+
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIVFVLQLKDHSKFKRKGDDLFFEHTLSLSEALCGFQY  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESL+ +
Sbjct  289  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTLD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+  T +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+EDDD+HGG
Sbjct  349  QCKALETVLPPRLATQMTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDDDVHGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_009418971.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQ ++H KFKRKGDDLF EHTL+L+EALCGFQ+
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQLKDHSKFKRKGDDLFFEHTLSLSEALCGFQY  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESL+ +
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+  T +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+EDDD+HGG
Sbjct  350  QCKALETVLPPRLATQMTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDDDVHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|NP_001267695.1| dnaJ protein homolog [Cucumis sativus]
 gb|ADF30255.1| heat shock protein [Cucumis sativus]
Length=413

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 3/189 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+L E+LCGFQF
Sbjct  228  MQNAQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLVESLCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHF V+FP+SL+PE
Sbjct  288  ILTHLDGRQLLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFCVEFPDSLNPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  ++DMELDECEETTLHDVNI       +++QAQEA DED+DMHGG
Sbjct  348  QCKALEGVLPPRTSVQLSDMELDECEETTLHDVNI---EEEMRRKQAQEANDEDEDMHGG  404

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  405  AQRVQCAQQ  413



>ref|XP_008446732.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 3/189 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHP+FKRKGDDLFVEHTL+L E+LCGFQF
Sbjct  228  MQNAQKITFPGEADEAPDTVTGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLVESLCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHF+V+FP+SL+PE
Sbjct  288  ILTHLDGRQLLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPP+ +  ++DMELDECEETTLHDVNI       +++Q QEAYDED+DMHGG
Sbjct  348  QCKALEGVLPPRTSVQLSDMELDECEETTLHDVNI---EEEMRRKQVQEAYDEDEDMHGG  404

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  405  AQRVQCAQQ  413



>gb|AFW68139.1| putative dnaJ chaperone family protein [Zea mays]
Length=338

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKG+DLF EHTL+LTEALCGFQF
Sbjct  149  MQHSQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQF  208

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  209  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPE  268

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDV-NIeeemrrkqqqqaqeaydedddMHG  162
            QCK LE+VLPPKP++ +TDME+DECEETT+HDV NIEEEMRRKQ   AQEAY+EDD+M G
Sbjct  269  QCKALESVLPPKPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPG  328

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  329  GAQRVQCAQQ  338



>gb|KCW50936.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=335

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVF+LQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  148  MQNGQKITFPGEADEAPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  207

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHFTVDFPESLSPE
Sbjct  208  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPESLSPE  267

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + L++VLP KP + +T+MELDECEETTLHDVNIEEEMRRKQQ QA+   ++DD    G
Sbjct  268  QVEALQSVLPQKPASQLTEMELDECEETTLHDVNIEEEMRRKQQAQAEAYDEDDDMP-SG  326

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  327  AQRVQCAQQ  335



>ref|XP_006367020.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
Length=419

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 177/191 (93%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADE PDT+TGDIVF+LQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTVDFP  L+PE
Sbjct  289  VLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNILTPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
             CK LEAVLP +P T  +DMELDECEETTLHDVNI+EEMRRKQQQQAQEAYDEDDD    
Sbjct  349  LCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHG  408

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  409  GGAQRVQCAQQ  419



>ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica]
Length=418

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTE+LCGFQF
Sbjct  231  MQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF+V+FP+SL+PE
Sbjct  291  VLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPE  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKPT+  TDMELDECEET  +DVNIEEE+RR+QQQ  +   +++D   GG
Sbjct  351  QCKALEAVLPPKPTSQYTDMELDECEETMPYDVNIEEELRRRQQQHQEAYDEDEDMP-GG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_010031575.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50935.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=416

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVF+LQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHFTVDFPESLSPE
Sbjct  289  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPESLSPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + L++VLP KP + +T+MELDECEETTLHDVNIEEEMRRKQQ QA+   ++DD    G
Sbjct  349  QVEALQSVLPQKPASQLTEMELDECEETTLHDVNIEEEMRRKQQAQAEAYDEDDDMP-SG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>gb|ADK35105.1| DnaJ-like protein 1 [Astragalus sinicus]
Length=236

 Score =   293 bits (751),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVF+LQQ+EHPKF+RKG+DLFVEHTL+LTE+LCGFQF
Sbjct  48   MQNGQKITFPGEADEAPDTVTGDIVFILQQKEHPKFRRKGEDLFVEHTLSLTESLCGFQF  107

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL  +
Sbjct  108  VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLGVD  167

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE +LPP+P + +TDMELDECEETTLHDVNIEEE RR+QQ Q +   ++DD   GG
Sbjct  168  QVKSLETILPPRPVSQLTDMELDECEETTLHDVNIEEESRRRQQAQQEAYDEDDDMPGGG  227

Query  158  AQRVQCAQQ  132
            AQRV+CAQQ
Sbjct  228  AQRVRCAQQ  236



>gb|KCW50580.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=373

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKI FPGEADEAPDT+TGDIVFVLQQ+EHPK+KRKGDDLF EHTL+LTE+LCGFQF
Sbjct  186  MQNGQKIKFPGEADEAPDTVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLCGFQF  245

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             L+HLD RQLLIKSQPGEV+KPDQFKAINDEGMP+Y RPFM+GKLYIHFTV+FP++LSPE
Sbjct  246  ALSHLDGRQLLIKSQPGEVIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDTLSPE  305

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE +LPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED+DMHGG
Sbjct  306  QCKALETILPPRSSAQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEDMHGG  364

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  365  AQRVQCAQQ  373



>ref|NP_001146715.1| uncharacterized protein LOC100280317 [Zea mays]
 gb|ACL54611.1| unknown [Zea mays]
Length=419

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKG+DLF EHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDV-NIeeemrrkqqqqaqeaydedddMHG  162
            QCK LE+VLPPKP++ +TDME+DECEETT+HDV NIEEEMRRKQ   AQEAY+EDD+M G
Sbjct  350  QCKALESVLPPKPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPG  409

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  410  GAQRVQCAQQ  419



>ref|NP_001168650.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACN29044.1| unknown [Zea mays]
 tpg|DAA51803.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=418

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTE+LCGFQF
Sbjct  231  MQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF+V+FP+SLSPE
Sbjct  291  VVTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPE  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP +  TDMELDECEET  +DVNIE EMRR+QQQ  +   +++D   GG
Sbjct  351  QCKALEAVLPPKPVSQYTDMELDECEETMPYDVNIEAEMRRRQQQHQEAYDEDEDMP-GG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>gb|AFW68140.1| putative dnaJ chaperone family protein isoform 1 [Zea mays]
 gb|AFW68141.1| putative dnaJ chaperone family protein isoform 2 [Zea mays]
Length=419

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKG+DLF EHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDV-NIeeemrrkqqqqaqeaydedddMHG  162
            QCK LE+VLPPKP++ +TDME+DECEETT+HDV NIEEEMRRKQ   AQEAY+EDD+M G
Sbjct  350  QCKALESVLPPKPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPG  409

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  410  GAQRVQCAQQ  419



>ref|XP_010031320.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 ref|XP_010031321.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50579.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=417

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKI FPGEADEAPDT+TGDIVFVLQQ+EHPK+KRKGDDLF EHTL+LTE+LCGFQF
Sbjct  230  MQNGQKIKFPGEADEAPDTVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             L+HLD RQLLIKSQPGEV+KPDQFKAINDEGMP+Y RPFM+GKLYIHFTV+FP++LSPE
Sbjct  290  ALSHLDGRQLLIKSQPGEVIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDTLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE +LPP+ +  +TDMELDECEETTLHDVNI EE  R++Q QAQEAY+ED+DMHGG
Sbjct  350  QCKALETILPPRSSAQLTDMELDECEETTLHDVNI-EEEMRRKQAQAQEAYEEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_009592511.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=418

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ++HP+FKRKGDDLFV+HTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            I+THLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYI F V+FP+SL+ E
Sbjct  290  IMTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIRFVVEFPDSLNTE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPP+P +  TDMELDECEET+LHDVNIEEEMRRKQ  Q +   ++D+   GG
Sbjct  350  QVKALEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQQEAYDEDDEMHGGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  GQRVQCAQQ  418



>gb|KJB09149.1| hypothetical protein B456_001G126200 [Gossypium raimondii]
Length=416

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ++HPKFKRKG+DLFVEHTLALTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTITGDIVFVLQQKDHPKFKRKGEDLFVEHTLALTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKS PGEVVKPD FKAINDEGMP+YQRPF++GK+YIHFTV+FP+SL+P+
Sbjct  289  VVTHLDGRQLLIKSIPGEVVKPDSFKAINDEGMPLYQRPFIKGKMYIHFTVEFPDSLNPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q   LEA+LPPKPT+ +TDMELDECEETTLHDVNI EE  R++QQ AQEAYDED+D HGG
Sbjct  349  QIMALEAILPPKPTSHLTDMELDECEETTLHDVNI-EEEMRRKQQAAQEAYDEDEDTHGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_003561819.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLF EHTL+LTEALCGFQ 
Sbjct  230  MQHNQKITFPGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTLSLTEALCGFQL  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGE+VKPD FKAI+DEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDNRQLLIKSNPGEIVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            QCK LEAVLPPKP + +TDMELDECEETTLHDVN  EE  R++ Q A +   ++DD    
Sbjct  350  QCKALEAVLPPKPVSKLTDMELDECEETTLHDVNNMEEEMRRKAQAAAQEAYDEDDDMPG  409

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  410  GGAQRVQCAQQ  420



>emb|CDP15561.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDIVFV+QQ+EHPK KRK DD+FVEHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTATGDIVFVVQQKEHPKLKRKHDDIFVEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS+PGEV+KPDQFKAI+DEGMPMYQRPFMRGK+YIHFTV+FP+SLSP+
Sbjct  289  ILTHLDGRQLLIKSKPGEVIKPDQFKAIDDEGMPMYQRPFMRGKMYIHFTVEFPDSLSPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE +LPPKP + +TDMELDECEETTLHDVNIEEEMRRKQ  Q +   ++DD   GG
Sbjct  349  QVKALEGILPPKPQSQLTDMELDECEETTLHDVNIEEEMRRKQAAQQEAYEEDDDMHGGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>gb|KHG17902.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=417

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFVLQQ++HPKFKRKG+DLF+EHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKS PGEVVKPD  KAINDEGMP+YQRPFM+GKLYI FTV+FP+SLSP+
Sbjct  289  VITHLDGRQLLIKSNPGEVVKPDSCKAINDEGMPLYQRPFMKGKLYIQFTVEFPDSLSPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPPKPT+ ++DMELDECEETTL+DVNIEEEMRRKQQQ AQEAY+ED+DMHGG
Sbjct  349  QVKALEAILPPKPTSQLSDMELDECEETTLYDVNIEEEMRRKQQQAAQEAYEEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>gb|EMT20603.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLF EHT++LTEALCGFQ 
Sbjct  232  MQHNQKITFPGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALCGFQL  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPD FKAI+DEGMPMYQRPFM+GKLYIHFTV+FP+SL+P+
Sbjct  292  VLTHLDNRQLLIKSNPGEVVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddM-HG  162
            QCK LEAVLPPKP + +TDMELDECEETT+HDVN+EEEMRRK    AQEAYDEDD+M  G
Sbjct  352  QCKALEAVLPPKPASKLTDMELDECEETTMHDVNMEEEMRRKAHAAAQEAYDEDDEMPGG  411

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  412  GAQRVQCAQQ  421



>ref|XP_003596917.1| DnaJ [Medicago truncatula]
Length=256

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  69   MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  128

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FPESL+ +
Sbjct  129  ALTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPESLTLD  188

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE +LP +P + +TDMELDECEETTLHDVNIEEE RR+QQ Q +   ++D+   GG
Sbjct  189  QVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQQEAYDEDDEMP-GG  247

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  248  AQRVQCAQQ  256



>gb|KJB35426.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=417

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFVLQQ++HPKFKRKG+DLF+EHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ++THLD RQLLIKS PGEVVKPD  KAINDEGMP+YQRPFM+GKLYI FTV+FP+SLSP+
Sbjct  289  VITHLDGRQLLIKSNPGEVVKPDSCKAINDEGMPLYQRPFMKGKLYIQFTVEFPDSLSPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPPKPT+ ++DMELDECEETTL+DVNIEEEMRRKQQQ AQEAY+ED+DMHGG
Sbjct  349  QVKALEAILPPKPTSQLSDMELDECEETTLYDVNIEEEMRRKQQQAAQEAYEEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|NP_001149958.1| dnaJ protein [Zea mays]
 gb|ACG37341.1| dnaJ protein [Zea mays]
Length=336

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTE+LCGFQF
Sbjct  149  MQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLCGFQF  208

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF+V+FP+SLSPE
Sbjct  209  VLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPE  268

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPPKP +  TDMELDECEET  +DVNIEEEMRR+QQQ  +   ++DD   GG
Sbjct  269  QCKALEAVLPPKPVSQYTDMELDECEETMSYDVNIEEEMRRRQQQHQEAYDEDDDVP-GG  327

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  328  GQRVQCAQQ  336



>ref|XP_006650350.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=417

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKGDDLF EHTL+LTEALCGFQF
Sbjct  229  MQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  289  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPE  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLP KP + +T+ME+DECEETT+HDV+  EE  R++ Q AQEAYDEDD+M GG
Sbjct  349  QCKALEAVLPAKPASQLTEMEIDECEETTMHDVSNIEEEMRRKAQAAQEAYDEDDEMPGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_004506241.1| PREDICTED: dnaJ protein homolog ANJ1-like [Cicer arietinum]
Length=418

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHFTV+FPE+LS +
Sbjct  290  ALTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPETLSLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q KGLEAVLP KP++ +TDMELDECEETTLHDVN+EEE RRKQ QQ QEAYDEDDDM GG
Sbjct  350  QVKGLEAVLPAKPSSQLTDMELDECEETTLHDVNMEEETRRKQHQQQQEAYDEDDDMPGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_006826444.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
 gb|ERM93681.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
Length=419

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPD ITGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDCITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMY RPFM+GKLYIHFTV+FP+SLSP+
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYGRPFMKGKLYIHFTVEFPDSLSPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqq-qaqeaydedddMHG  162
            Q K LEAVL P+ ++ +TDMELDECEETTLHDVNIEEEMRRKQ     +   ++DD    
Sbjct  350  QSKALEAVLLPRSSSQLTDMELDECEETTLHDVNIEEEMRRKQSHPAQEVYDEDDDGPAS  409

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  410  GAQRVQCAQQ  419



>gb|AHA84223.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKF+RK +DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLY+HFTV+FP+ L+PE
Sbjct  290  VLTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYLHFTVEFPDFLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLPPK  + +TDMELDECEETTLHDVN+E+E RR+QQQ AQEAY+EDDDM GG
Sbjct  350  QVKALEAVLPPKQPSQLTDMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDDMPGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>gb|AFK38714.1| unknown [Lotus japonicus]
Length=247

 Score =   291 bits (745),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT TGDIVFVLQ +EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  59   MQNQQKITFPGEADEAPDTTTGDIVFVLQLKEHPKFKRKAEDLFVEHTLSLTEALCGFQF  118

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHFTV+FP+SL+P 
Sbjct  119  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPN  178

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA LP KP++ +TDMELDECEETTLHDVN+EEE RRK+QQ  QEAYDEDDDM GG
Sbjct  179  QVKDLEAALPAKPSSQLTDMELDECEETTLHDVNMEEENRRKEQQAQQEAYDEDDDMPGG  238

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  239  AQRVQCAQQ  247



>ref|XP_007132506.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
 gb|ESW04500.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
Length=418

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKF+RK +DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLY+HFTV+FP+ L+PE
Sbjct  290  VLTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYLHFTVEFPDFLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLPPK  + +TDMELDECEETTLHDVN+E+E RR+QQQ AQEAY+EDDDM GG
Sbjct  350  QVKALEAVLPPKQPSQLTDMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDDMPGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_006650701.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=418

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS+PGEVVKPD FKA+NDEGMPMYQRPFM+GKLYIHF+V+FP+SL+P+
Sbjct  289  VLTHLDNRQLLIKSKPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-G  162
            QCK LE VLPP+P +  TDMELDECEET  +DVNIEEEMRR+QQQQ QEAYDED+DMH G
Sbjct  349  QCKALETVLPPRPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDEDMHGG  408

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  409  GAQRVQCAQQ  418



>ref|NP_001051497.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|AAT75262.1| putative DnaJ like protein [Oryza sativa Japonica Group]
 gb|ABF99246.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13411.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|EAZ28837.1| hypothetical protein OsJ_12871 [Oryza sativa Japonica Group]
 dbj|BAG87697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTEALCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLNLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS+PGEVVKPD FKA+NDEGMPMYQRPFM+GKLYIHF+V+FP+SL+P+
Sbjct  288  VLTHLDNRQLLIKSKPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPD  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-G  162
            QCK LE VLPP+P +  TDMELDECEET  +DVNIEEEMRR+QQQQ QEAYDED+DMH G
Sbjct  348  QCKALETVLPPRPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDEDMHGG  407

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  408  GAQRVQCAQQ  417



>gb|EAY92107.1| hypothetical protein OsI_13813 [Oryza sativa Indica Group]
Length=417

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTEALCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLNLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS+PGEVVKPD FKA+NDEGMPMYQRPFM+GKLYIHF+V+FP+SL+P+
Sbjct  288  VLTHLDNRQLLIKSKPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPD  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-G  162
            QCK LE VLPP+P +  TDMELDECEET  +DVNIEEEMRR+QQQQ QEAYDED+DMH G
Sbjct  348  QCKALETVLPPRPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDEDMHGG  407

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  408  GAQRVQCAQQ  417



>ref|XP_010089798.1| DnaJ-like protein [Morus notabilis]
 gb|EXB38414.1| DnaJ-like protein [Morus notabilis]
Length=440

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPG +DEAPDTITGDIVFVLQQ+EHPKFKRKGDDLFVEH L+LTEALCGFQF
Sbjct  252  MQNGQRITFPGASDEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHNLSLTEALCGFQF  311

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHFTVDFP+ LSPE
Sbjct  312  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDYLSPE  371

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
              K LE VLPPKP + ++DMELDECEETT H+VNIEEEMRRKQQQ   EAY+ED+DM GG
Sbjct  372  HVKALEVVLPPKPLSPLSDMELDECEETTPHNVNIEEEMRRKQQQAQAEAYEEDEDMQGG  431

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  432  AQRVQCAQQ  440



>ref|NP_001130317.1| chaperone DNA J2 [Zea mays]
 gb|AAC08009.1| DnaJ-related protein ZMDJ1 [Zea mays]
 gb|ACF78499.1| unknown [Zea mays]
 gb|ACG32917.1| dnaJ protein [Zea mays]
 gb|ACL53813.1| unknown [Zea mays]
 gb|ACN34490.1| unknown [Zea mays]
 gb|ACR38444.1| unknown [Zea mays]
 tpg|DAA50285.1| TPA: chaperone DNA J2 [Zea mays]
Length=419

 Score =   297 bits (760),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKG+DLF EHTL+LTEALCGFQF
Sbjct  230  MQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDNRQLLIKSDPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDV-NIeeemrrkqqqqaqeaydedddMHG  162
            QCK LE VLPP+P++ +TDME+DECEETT+HDV NIEEEMRRKQ   AQEAY+EDD+M G
Sbjct  350  QCKALETVLPPRPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPG  409

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  410  GAQRVQCAQQ  419



>sp|Q03363.1|DNJH1_ALLPO RecName: Full=DnaJ protein homolog 1; Short=DNAJ-1; Flags: Precursor, 
partial [Allium ampeloprasum]
 emb|CAA49211.1| DNA J protein [Allium ampeloprasum]
 prf||1914140A DnaJ protein
Length=397

 Score =   296 bits (758),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKF+RKGDDLF +HTL+LTEALCGFQF
Sbjct  209  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFQRKGDDLFYKHTLSLTEALCGFQF  268

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYI F VDFP+SL+P+
Sbjct  269  VLTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDSLTPD  328

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK +E+VLP   ++ +TDME+DECEETT+HDVNIEEEMRRKQ Q AQEAYDEDD+ HGG
Sbjct  329  QCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRKQHQHAQEAYDEDDEGHGG  388

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  389  GQRVQCAQQ  397



>ref|XP_008385581.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFV+QQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF V+FPESLSPE
Sbjct  291  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPE  350

Query  338  QCKGLEAVLPPKPT-TGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEA LP KP+ + +TDME+DECEETTLHDVN+EEEMRRKQQQ  QEAYDEDDDM G
Sbjct  351  QVKALEAALPGKPSXSQLTDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPG  410

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  411  GAQRVQCAQQ  420



>gb|KDO48966.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=335

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLF EHTL+LTEALCGFQF
Sbjct  148  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALCGFQF  207

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD RQLLIKS PGEVVKPD +KAIN+EGMP+YQRPFM+GKLYIHFTV+FP+SL+P+
Sbjct  208  ALTHLDGRQLLIKSNPGEVVKPDSYKAINEEGMPLYQRPFMKGKLYIHFTVEFPDSLTPD  267

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LP +P +G+TDMELDECEETTLHDVNIEEEMRRKQ    +   +++D   GG
Sbjct  268  QVKALEAILPSRPLSGMTDMELDECEETTLHDVNIEEEMRRKQAHAQEAYEEDEDMP-GG  326

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  327  AQRVQCAQQ  335



>ref|XP_002466747.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
 gb|EER93745.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
Length=419

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITFPGEADEAPDT+TGDIVFVLQQ++H KFKRKG+DLF EHTL+LTEALCGFQF
Sbjct  230  MQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHFTV+FP+SL+PE
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDV-NIeeemrrkqqqqaqeaydedddMHG  162
            QCK LEAVLPP+ ++ +TDME+DECEETT+HDV NIEEEMRRKQ   AQEAY+EDD+M G
Sbjct  350  QCKALEAVLPPRSSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPG  409

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  410  GAQRVQCAQQ  419



>gb|ABI18985.1| molecular chaperone DjA2 [Allium ampeloprasum]
Length=418

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ+EHPKF+RKGDDLF +HTL+LTEALCGFQF
Sbjct  230  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFQRKGDDLFYKHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYI F VDFP+SL+P+
Sbjct  290  VLTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDSLTPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK +E+VLP   ++ +TDME+DECEETT+HDVNIEEEMRRKQ Q AQEAYDEDD+ HGG
Sbjct  350  QCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRKQHQHAQEAYDEDDEGHGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  GQRVQCAQQ  418



>ref|NP_001242510.1| uncharacterized protein LOC100808604 [Glycine max]
 gb|ACU21221.1| unknown [Glycine max]
Length=410

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRK +DLFVEH L+LTEALCGFQF
Sbjct  223  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKAEDLFVEHILSLTEALCGFQF  282

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQR FM+GKLYIHFTV+FP+SL+P+
Sbjct  283  VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRSFMKGKLYIHFTVEFPDSLNPD  342

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLPPKP++ +TDMELDECEETTLHDVN+EEE RRKQQQ  +   ++DD   GG
Sbjct  343  QVKALEAVLPPKPSSQLTDMELDECEETTLHDVNMEEETRRKQQQAQEAYDEDDDMP-GG  401

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  402  AQRVQCAQQ  410



>emb|CBI28261.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 156/189 (83%), Gaps = 24/189 (13%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFMRGKLYI F V+FP++LSPE
Sbjct  290  ILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDTLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLP + TT +TDMELDECEETTLHD+                         GG
Sbjct  350  QCKALEAVLPARATTQLTDMELDECEETTLHDM------------------------PGG  385

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  386  AQRVQCAQQ  394



>ref|XP_006590333.1| PREDICTED: uncharacterized protein LOC100808604 isoform X1 [Glycine 
max]
 gb|KHN13055.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRK +DLFVEH L+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKAEDLFVEHILSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQR FM+GKLYIHFTV+FP+SL+P+
Sbjct  290  VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRSFMKGKLYIHFTVEFPDSLNPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLPPKP++ +TDMELDECEETTLHDVN+EEE RRKQQQ  +   ++DD   GG
Sbjct  350  QVKALEAVLPPKPSSQLTDMELDECEETTLHDVNMEEETRRKQQQAQEAYDEDDDMP-GG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_003605981.1| DnaJ [Medicago truncatula]
Length=413

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  225  MQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQF  284

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FP++LS +
Sbjct  285  VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLD  344

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q KGLEAVLP KP++ +TDME+DECEETTLHDVN+EEE RRKQQQQ QEAYDEDDDM GG
Sbjct  345  QVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDDMPGG  404

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  405  AQRVQCAQQ  413



>gb|AAF64454.1|AF239932_1 DnaJ protein [Euphorbia esula]
Length=418

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVF+LQQREHPKFKR+GDDL VEHTL+LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPDTVTGDIVFILQQREHPKFKRRGDDLVVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF V+FP+SL P+
Sbjct  291  ILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFNVEFPDSLPPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLP + +  ++DME+DECEETTLHDVN EEEMRRKQQQ A+   +++D   GG
Sbjct  351  QSKALEAVLPSRTSVQLSDMEVDECEETTLHDVNFEEEMRRKQQQSAEAYDEDEDMP-GG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|XP_003605980.1| DnaJ [Medicago truncatula]
 gb|AES88177.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=416

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  228  MQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FP++LS +
Sbjct  288  VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLD  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q KGLEAVLP KP++ +TDME+DECEETTLHDVN+EEE RRKQQQQ QEAYDEDDDM GG
Sbjct  348  QVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDDMPGG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_008359180.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=424

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFV+QQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  235  MQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  294

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF V+FPESLSPE
Sbjct  295  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPE  354

Query  338  QCKGLEAVLPPKPT-TGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEA LP KP+ + +TDME+DECEETTLHDVN+EEEMRRKQQQ  QEAYDEDDDM G
Sbjct  355  QVKALEAALPGKPSXSQLTDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPG  414

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  415  GAQRVQCAQQ  424



>gb|EYU36023.1| hypothetical protein MIMGU_mgv1a007093mg [Erythranthe guttata]
Length=420

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQK+TFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDLF+EHTL L EALCGFQF
Sbjct  231  MQNGQKVTFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFIEHTLPLAEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L+HLD RQLLIKSQPGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHF V+FP+SLS E
Sbjct  291  VLSHLDGRQLLIKSQPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFNVEFPDSLSAE  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqq-qqaqeaydedddMHG  162
            Q   LE +LPPKP + +TDME+DECEETTLHDVNIE+EMRRKQ  +Q +   DED+DMHG
Sbjct  351  QVAALEKILPPKPQSELTDMEVDECEETTLHDVNIEDEMRRKQAHRQQEAYDDEDEDMHG  410

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  411  GAQRVQCAQQ  420



>ref|XP_002313505.1| seed maturation protein PM37 [Populus trichocarpa]
 gb|EEE87460.1| seed maturation protein PM37 [Populus trichocarpa]
Length=415

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLPLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGE VKPD FKAINDEGMPMYQRPFM+GKLYIHFTVDFP+SL+P+
Sbjct  289  VLTHLDGRQLLIKSNPGEAVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLTPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +E +L P+P++ +TDMELDECEETTLHDVNIEEEMRRKQQ + +   ++++  HGG
Sbjct  349  QVKAIETIL-PRPSSQLTDMELDECEETTLHDVNIEEEMRRKQQAREEAYDEDEEMPHGG  407

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  408  -QRVQCAQQ  415



>ref|XP_006424068.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 ref|XP_006487844.1| PREDICTED: dnaJ protein homolog ANJ1-like [Citrus sinensis]
 gb|ESR37308.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 gb|KDO48965.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=416

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLF EHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD RQLLIKS PGEVVKPD +KAIN+EGMP+YQRPFM+GKLYIHFTV+FP+SL+P+
Sbjct  289  ALTHLDGRQLLIKSNPGEVVKPDSYKAINEEGMPLYQRPFMKGKLYIHFTVEFPDSLTPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LP +P +G+TDMELDECEETTLHDVNIEEEMRRKQ    +   +++D   GG
Sbjct  349  QVKALEAILPSRPLSGMTDMELDECEETTLHDVNIEEEMRRKQAHAQEAYEEDEDMP-GG  407

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  408  AQRVQCAQQ  416



>ref|XP_009406563.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=414

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 176/189 (93%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVF+LQQ++HPKFKRKGDD+F EHTL+LTEALCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTVTGDIVFILQQKDHPKFKRKGDDIFYEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAI+DEGMPMYQRPFMRGKLYIHFTVDFP+SL+P+
Sbjct  288  VLTHLDNRQLLIKSNPGEVVKPDQFKAIDDEGMPMYQRPFMRGKLYIHFTVDFPDSLTPD  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLPP+    +T+MELDECEET L++VNI EE  R++Q Q+QEAYDEDDD+HGG
Sbjct  348  QCKALEAVLPPRQALQMTEMELDECEETILNNVNI-EEEMRRKQAQSQEAYDEDDDVHGG  406

Query  158  AQRVQCAQQ  132
            A RVQCAQQ
Sbjct  407  A-RVQCAQQ  414



>ref|XP_011090296.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=417

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            IL+HLD RQLLIKSQPGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHF VDFP+SL+ +
Sbjct  290  ILSHLDGRQLLIKSQPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFNVDFPDSLTAD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q   L  +LPPK  + +TDMELDECEETTLHDVNI EE  R++Q Q QEAYDED++MHGG
Sbjct  350  QVDALAKILPPKAQSQLTDMELDECEETTLHDVNI-EEEMRRKQTQHQEAYDEDEEMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_003596916.1| DnaJ [Medicago truncatula]
 gb|AES67167.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=417

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FPESL+ +
Sbjct  290  ALTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPESLTLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE +LP +P + +TDMELDECEETTLHDVNIEEE RR+QQ Q +   ++D+   GG
Sbjct  350  QVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQQEAYDEDDEMP-GG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>gb|AFK37703.1| unknown [Medicago truncatula]
Length=417

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FPESL+ +
Sbjct  290  ALTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPESLTLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE +LP +P + +TDMELDECEETTLHDVNIEEE RR+QQ Q +   ++D+   GG
Sbjct  350  QVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQQEAYDEDDEMP-GG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_009368443.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFV+QQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQ+
Sbjct  231  MQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQY  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF V+FPESLSPE
Sbjct  291  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPE  350

Query  338  QCKGLEAVLPPKPTTG-ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEA LP K +   +TDME+DECEETTLHDVN+EEEMRRKQQQ  QEAYDEDDDM G
Sbjct  351  QVKALEAALPGKASASQLTDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPG  410

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  411  GAQRVQCAQQ  420



>ref|XP_006340319.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X2 [Solanum 
tuberosum]
Length=337

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGD+VFVLQQ+EHPKFKRKG+DLFV+HTL LTEALCGFQF
Sbjct  149  MQNGQKITFPGEADEAPDTVTGDVVFVLQQKEHPKFKRKGEDLFVDHTLTLTEALCGFQF  208

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHFTV+FP+SLS  
Sbjct  209  ILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPVYQRPFMKGKLYIHFTVEFPDSLSLP  268

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + LEA+LPP+PT+  +DMELDECEETTLHDVN+EEEMRRKQ  Q +   ++++    G
Sbjct  269  QVQLLEAILPPRPTSQYSDMELDECEETTLHDVNMEEEMRRKQAAQQEAYDEDEEMSGSG  328

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  329  GQRVQCAQQ  337



>ref|XP_009408521.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAP+T+TGDIVFVLQQ++HPKFKRKGDDL+ EHTL+LTEALC FQF
Sbjct  229  MQNEQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGDDLYYEHTLSLTEALCSFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+ L+ +
Sbjct  289  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDLLTLD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEA LPPKP + +TDMELDECEETTL+DVNIEEEMRRKQ Q  +   +EDD   G 
Sbjct  349  QCKALEAALPPKPASQMTDMELDECEETTLYDVNIEEEMRRKQAQAQEAYEEEDDVS-GR  407

Query  158  AQRVQCAQQ  132
            AQR+QCAQQ
Sbjct  408  AQRLQCAQQ  416



>gb|ACJ84348.1| unknown [Medicago truncatula]
 gb|AFK39964.1| unknown [Medicago truncatula]
Length=256

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  69   MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  128

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
              THLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV FPESL+ +
Sbjct  129  APTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVVFPESLTLD  188

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE +LP +P + +TDMELDECEETTLHDVNIEEE RR+QQ Q +   ++D+   GG
Sbjct  189  QVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQQEAYDEDDEMP-GG  247

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  248  AQRVQCAQQ  256



>ref|XP_006340318.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGD+VFVLQQ+EHPKFKRKG+DLFV+HTL LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPDTVTGDVVFVLQQKEHPKFKRKGEDLFVDHTLTLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHFTV+FP+SLS  
Sbjct  291  ILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPVYQRPFMKGKLYIHFTVEFPDSLSLP  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + LEA+LPP+PT+  +DMELDECEETTLHDVN+EEEMRRKQ  Q +   ++++    G
Sbjct  351  QVQLLEAILPPRPTSQYSDMELDECEETTLHDVNMEEEMRRKQAAQQEAYDEDEEMSGSG  410

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  411  GQRVQCAQQ  419



>ref|XP_009408520.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAP+T+TGDIVFVLQQ++HPKFKRKGDDL+ EHTL+LTEALC FQF
Sbjct  230  MQNEQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGDDLYYEHTLSLTEALCSFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+ L+ +
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDLLTLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEA LPPKP + +TDMELDECEETTL+DVNIEEEMRRKQ Q  +   +EDD   G 
Sbjct  350  QCKALEAALPPKPASQMTDMELDECEETTLYDVNIEEEMRRKQAQAQEAYEEEDDVS-GR  408

Query  158  AQRVQCAQQ  132
            AQR+QCAQQ
Sbjct  409  AQRLQCAQQ  417



>gb|AFW67420.1| putative dnaJ chaperone family protein [Zea mays]
Length=415

 Score =   292 bits (747),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTE+LCGFQF
Sbjct  228  MQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLILTESLCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF+V+FP+SLSPE
Sbjct  288  VLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPE  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLP KP +  TDMELDECEET  +DVNIEEEMRR+QQQ  +   ++DD   GG
Sbjct  348  QCKTLEAVLPLKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQHQEAYDEDDDVP-GG  406

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  407  GQRVQCAQQ  415



>gb|AFW67421.1| putative dnaJ chaperone family protein [Zea mays]
Length=417

 Score =   292 bits (747),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF EHTL LTE+LCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLILTESLCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF+V+FP+SLSPE
Sbjct  290  VLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLP KP +  TDMELDECEET  +DVNIEEEMRR+QQQ  +   ++DD   GG
Sbjct  350  QCKTLEAVLPLKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQHQEAYDEDDDVP-GG  408

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  409  GQRVQCAQQ  417



>ref|XP_011008852.1| PREDICTED: dnaJ protein homolog isoform X1 [Populus euphratica]
Length=415

 Score =   291 bits (746),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEH L LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHVLPLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGE VKPD FKAINDEGMPMYQRPFM+GKLYIHFTVDFP+SL+P+
Sbjct  289  VLTHLDGRQLLIKSNPGEAVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLTPD  348

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +E +L P+P+  +TDMELDECEETTLHDVNIEEEMRRKQQ + +   ++++  HGG
Sbjct  349  QVKAIETIL-PRPSRQLTDMELDECEETTLHDVNIEEEMRRKQQAREEAYEEDEEMPHGG  407

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  408  -QRVQCAQQ  415



>ref|XP_011008853.1| PREDICTED: dnaJ protein homolog isoform X2 [Populus euphratica]
Length=409

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEH L LTEALCGFQF
Sbjct  223  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHVLPLTEALCGFQF  282

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGE VKPD FKAINDEGMPMYQRPFM+GKLYIHFTVDFP+SL+P+
Sbjct  283  VLTHLDGRQLLIKSNPGEAVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLTPD  342

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +E +L P+P+  +TDMELDECEETTLHDVNIEEEMRRKQQ + +   ++++  HGG
Sbjct  343  QVKAIETIL-PRPSRQLTDMELDECEETTLHDVNIEEEMRRKQQAREEAYEEDEEMPHGG  401

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  402  -QRVQCAQQ  409



>gb|AHA84264.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVFVLQQ+EHPKF+RK +DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQL IK  PGEVVKPD +KAINDEGMPMYQRPFM+GKLY HFTV+FP+ L+PE
Sbjct  290  VLTHLDSRQLFIKFNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYFHFTVEFPDFLNPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLPPK  + +TDMELDECEETTLHDVN+E+E RR+QQQ AQEAY+EDDDM GG
Sbjct  350  QVKALEAVLPPKQPSQLTDMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDDMPGG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>gb|AFK46626.1| unknown [Medicago truncatula]
Length=256

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  69   MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  128

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
              THLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV FPESL+ +
Sbjct  129  APTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVVFPESLTLD  188

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE +LP +P + +TDMELDECEETTLHDVNIEEE RR+QQ Q +   ++D+   GG
Sbjct  189  QVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQQEAYDEDDEMP-GG  247

Query  158  AQRVQCAQQ  132
            AQRVQC QQ
Sbjct  248  AQRVQCGQQ  256



>ref|XP_008361658.1| PREDICTED: dnaJ protein homolog [Malus domestica]
 ref|XP_008355256.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFV+QQ+EHPKFKRKG+DLFVEHTL LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLPLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHF V+FPESL+PE
Sbjct  291  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLNPE  350

Query  338  QCKGLEAVLPPKPTTG-ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEA LP KP+   +TDME+ ECEETTLHDVN+EEEMRRKQ Q  QEAYDEDDDM G
Sbjct  351  QVKALEAALPGKPSASQLTDMEVXECEETTLHDVNMEEEMRRKQLQAQQEAYDEDDDMPG  410

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  411  GAQRVQCAQQ  420



>gb|EYU36024.1| hypothetical protein MIMGU_mgv1a007013mg [Erythranthe guttata]
Length=422

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFV+QQ+EHPK+KRKGDDLF+EHTL L EALCGFQF
Sbjct  233  MQNGQKITFPGEADEAPDTVTGDIVFVVQQKEHPKYKRKGDDLFIEHTLPLGEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
             L+HLD RQLLIKSQPGEVVKPD +KAINDEGMP+YQRPFM+GKLYIHF V+FP+SLS E
Sbjct  293  ALSHLDGRQLLIKSQPGEVVKPDSYKAINDEGMPIYQRPFMKGKLYIHFNVEFPDSLSTE  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqq-qqaqeaydedddMHG  162
            Q + LE +LPPKP + +TDME+DECEETTLHDVNIE+EMRRKQ  +Q +   D+D+DMHG
Sbjct  353  QVEALEKILPPKPQSKLTDMEVDECEETTLHDVNIEDEMRRKQAHRQQEAYDDDDEDMHG  412

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  413  GAQRVQCAQQ  422



>ref|NP_001240264.1| uncharacterized protein LOC100818805 [Glycine max]
 gb|ACU23708.1| unknown [Glycine max]
Length=417

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK DDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLIKS PGEVVKP+ FKAINDEGMP YQR F++GKLYIHF+V+FP++LS +
Sbjct  290  VLTHLDSRQLLIKSNPGEVVKPESFKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEAVLP KPT+ ++DMELDECEETTLHDVN+ EE  R++QQ  QEAYDED+DMHGG
Sbjct  350  QVKALEAVLPSKPTSQLSDMELDECEETTLHDVNM-EEETRRRQQAQQEAYDEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>gb|ACJ83716.1| unknown [Medicago truncatula]
Length=156

 Score =   281 bits (719),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  1    MQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQF  60

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FP++LS +
Sbjct  61   VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLD  120

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            Q KGLEAVLP KP++ +TDME+DECEETTLHDVN+
Sbjct  121  QVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNM  155



>ref|XP_004291531.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=423

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVV EKKVLEV VEKGMQNGQKITFPGEADEAPDT+TGDIVF++QQ+EHPKFKR
Sbjct  212  GQCKGEKVVHEKKVLEVHVEKGMQNGQKITFPGEADEAPDTVTGDIVFIIQQKEHPKFKR  271

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            K DDLFVEH+L+LT+ALCGFQF+L HLD RQLLIKS PGEVVKPD FKA+NDEGMPMYQR
Sbjct  272  KMDDLFVEHSLSLTDALCGFQFVLNHLDGRQLLIKSNPGEVVKPDSFKAVNDEGMPMYQR  331

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTT-GITDMELDECEETTLHDVNIee  228
            PFM+GKLYIHF+VDFPE+LSPEQ K LEA LP + ++  +TDMELDECEETTLHDVN+EE
Sbjct  332  PFMKGKLYIHFSVDFPETLSPEQVKALEAALPSRASSQQLTDMELDECEETTLHDVNMEE  391

Query  227  emrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            EMRRKQ Q   EAYDEDDDM GGAQRVQCAQQ
Sbjct  392  EMRRKQHQAHSEAYDEDDDMPGGAQRVQCAQQ  423



>gb|KDP42967.1| hypothetical protein JCGZ_23909 [Jatropha curcas]
Length=418

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDL VEH L+LTE+LCGFQF
Sbjct  230  MQHGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLIVEHNLSLTESLCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+G+LYIHF V+FP+SL+ +
Sbjct  290  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGRLYIHFNVEFPDSLTLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPP+P++ +TDMELDECEETTLHDVN+EEEMRRK Q+  QEAYDEDDDM  G
Sbjct  350  QVKALEAILPPRPSSMLTDMELDECEETTLHDVNMEEEMRRKDQRSQQEAYDEDDDMPSG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  GQRVQCAQQ  418



>ref|XP_007015640.1| DNAJ isoform 1 [Theobroma cacao]
 gb|EOY33259.1| DNAJ isoform 1 [Theobroma cacao]
Length=431

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADE PDTITGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  228  MQHGQKITFPGEADEVPDTITGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  287

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS  GE+VKPD FKAINDEGMP+YQRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  288  VLTHLDGRQLLIKSNSGEIVKPDSFKAINDEGMPLYQRPFMKGKLYIHFTVDFPDSLSPD  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + LEA+LPPKPT+ +TDMELDECEETTLHDVNI  E   +++QQA +   ++++MHGG
Sbjct  348  QVQALEAILPPKPTSQLTDMELDECEETTLHDVNI--EEEMRRKQQAAQETLDEEEMHGG  405

Query  158  AQRV  147
            AQR+
Sbjct  406  AQRL  409



>ref|NP_001275059.1| DnaJ-like protein [Solanum tuberosum]
 gb|ABB55383.1| DnaJ-like protein-like [Solanum tuberosum]
Length=445

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 194/216 (90%), Gaps = 2/216 (1%)
 Frame = -1

Query  788  LLMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQ  609
            ++  K   GQCKGEKVVQEKKVLEV+VEKGMQNGQKITFPGEADEAPDT+TGDIVFVLQQ
Sbjct  201  MINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ  260

Query  608  REHPKFKRKGDDLFVEHTLALTEALC-GFQFI-LTHLDNRQLLIKSQPGEVVKPDQFKAI  435
            +EHPKFKRKGDDLFVEHTL L    C GFQFI LTHLD RQL+IK QPGEVVKPDQFKAI
Sbjct  261  KEHPKFKRKGDDLFVEHTLKLKPRPCVGFQFIFLTHLDYRQLIIKPQPGEVVKPDQFKAI  320

Query  434  NDEGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEET  255
            NDEGMPMYQRPFMRGKLYIHFTV+FP++LSPEQCK LEAVLPPKP T +TDMELDECEET
Sbjct  321  NDEGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMTDMELDECEET  380

Query  254  TLHDVNIeeemrrkqqqqaqeaydedddMHGGAQRV  147
            TLHDVNIEEEMRRKQQQ  +   ++D+DMHGGAQRV
Sbjct  381  TLHDVNIEEEMRRKQQQAQEAYDEDDEDMHGGAQRV  416



>gb|EYU37228.1| hypothetical protein MIMGU_mgv1a006942mg [Erythranthe guttata]
Length=425

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQK+TFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  235  MQHGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  294

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLDNRQLLIKS+ GEV+KPDQFKAINDEGMPMYQ+ FM+GKLYI F+VDFPESL+PE
Sbjct  295  ILTHLDNRQLLIKSESGEVIKPDQFKAINDEGMPMYQKSFMKGKLYIQFSVDFPESLNPE  354

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K +  VLP K T  +TDMELDECEETTLHDVN+EEEMRRKQ Q AQEAYDE+DD    
Sbjct  355  QSKAIGTVLPSKSTNQLTDMELDECEETTLHDVNMEEEMRRKQHQHAQEAYDEEDDDMHG  414

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  415  GGAQRVQCAQQ  425



>ref|XP_009336413.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFV+QQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  231  MQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMP+YQR FM+GKLYIHF V+FPESL+PE
Sbjct  291  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPIYQRSFMKGKLYIHFNVEFPESLNPE  350

Query  338  QCKGLEAVLPPKPTTG-ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEA LP KP+   + DME+DECEETTLHDVN+EEEMRRKQQQ  QEAYDEDDDM G
Sbjct  351  QVKALEAALPGKPSASQLMDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPG  410

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  411  GAQRVQCAQQ  420



>gb|AAD12055.1| DnaJ protein [Hevea brasiliensis]
Length=415

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRKGDDL V+HTL+LTEALC  QF
Sbjct  229  MQNGQRITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLIVDHTLSLTEALCASQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD   LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHF+VDFP+SL P+
Sbjct  289  ILTHLDG-DLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLPPD  347

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LEAVLP + +  ++DMELDECEETTLHDVN  +E  R++QQQAQEAYDEDDDMHGG
Sbjct  348  QCKALEAVLPSRTSVQLSDMELDECEETTLHDVNF-DEEMRRKQQQAQEAYDEDDDMHGG  406

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  407  GQRVQCAQQ  415



>ref|XP_003558043.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKRK DDLF EHTL LTEALCGFQ+
Sbjct  231  MQHGQKITFPGEADEAPDTLTGDIIFVLQQKEHPKFKRKSDDLFYEHTLTLTEALCGFQY  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQRPFM+GKLYIHFTVDFP+SL+P+
Sbjct  291  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLNPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddM-HG  162
            QCK LEAVLPPKP +  TDMELDECEET  +D++IEEEMRR+QQQQ QEAYDED+DM  G
Sbjct  351  QCKALEAVLPPKPASQYTDMELDECEETMAYDIDIEEEMRRRQQQQQQEAYDEDEDMPGG  410

Query  161  GAQRVQCAQQ  132
            G QRVQCAQQ
Sbjct  411  GGQRVQCAQQ  420



>gb|KHN17991.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK DDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L HLD RQLLIKS PGEVVKPD +KAINDEGMP YQR F++GKLYIHF+V+FP++LS +
Sbjct  290  VLAHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA LP KPT+ +TDMELDECEETTLHDVN+ EE  R++QQ  QEAY+ED+DMHGG
Sbjct  350  QVKALEATLPLKPTSQLTDMELDECEETTLHDVNM-EEEIRRRQQAQQEAYEEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>gb|KHG01500.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
 gb|KHG06497.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=318

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  650  PDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQP  471
            PDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTLALTEALCGFQFILTHLD RQLLIK+QP
Sbjct  146  PDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDGRQLLIKTQP  205

Query  470  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTG  291
            GEVVKPDQFKAINDEGMP+YQRPFMRGKLYI FTVDFP+SL+P+QCK LEAVLPPK +  
Sbjct  206  GEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFTVDFPDSLTPDQCKALEAVLPPKASVQ  265

Query  290  ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            +TDMELDECEETTLHDVNIEE MRRKQ Q  QEAYDED+DMHGGAQRVQCAQQ
Sbjct  266  LTDMELDECEETTLHDVNIEEVMRRKQTQAQQEAYDEDEDMHGGAQRVQCAQQ  318



>ref|XP_010685460.1| PREDICTED: dnaJ protein homolog ANJ1 [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            M +GQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLF EHTL+LTE+LCGF+F
Sbjct  230  MLHGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTESLCGFRF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEV+KPDQFKAI+DEGMP+YQRPFM+GK+YIHFTV+FP+SL+P+
Sbjct  290  VLTHLDGRQLLIKSNPGEVIKPDQFKAIDDEGMPIYQRPFMKGKMYIHFTVEFPDSLNPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPPKPT  +TDMELDECEETT+HDVN+EEEMRRKQ Q  QEAYDEDD+  GG
Sbjct  350  QVKALEAILPPKPTMTLTDMELDECEETTMHDVNMEEEMRRKQTQAQQEAYDEDDEPQGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  -QRVQCAQQ  417



>ref|XP_002874044.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50303.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  231  MQHNQKITFNGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FPESLSP+
Sbjct  291  VLTHLDKRQLLIKSSPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +EAVLP      I+DME+DECEETTLHDVNIE+EM+RK Q Q +   D++D+  GG
Sbjct  351  QTKAIEAVLPKPTKAAISDMEIDECEETTLHDVNIEDEMKRKAQAQREAYDDDEDEHPGG  410

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  411  AQRVQCAQQ  419



>ref|XP_004251216.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=418

 Score =   286 bits (733),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGD+VFVLQQ++HPKFKRKGDDLFV+HTL LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDVVFVLQQKDHPKFKRKGDDLFVDHTLTLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            IL HLD R+LL+KS PGEVVKPDQFKAINDEGMP+YQRPFM+GKLYIHF V+FP+SLS  
Sbjct  290  ILAHLDGRRLLVKSNPGEVVKPDQFKAINDEGMPVYQRPFMKGKLYIHFIVEFPDSLSLP  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q + LEA+LP +PT+  +DMELDECEETTLHDVN+EEEMRRKQ  Q +   ++++   GG
Sbjct  350  QVQLLEAMLPSRPTSQYSDMELDECEETTLHDVNMEEEMRRKQAAQQEAYDEDEEMSGGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  GQRVQCAQQ  418



>ref|XP_007205259.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
 gb|EMJ06458.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
Length=418

 Score =   286 bits (733),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 172/190 (91%), Gaps = 2/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI+FPGEADEAP+T+TGDIVF++ Q+EHPKFKRKG+DLFVEH+L+LTEALCGFQF
Sbjct  230  MQSGQKISFPGEADEAPETVTGDIVFIIHQKEHPKFKRKGEDLFVEHSLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMP+YQRPFM+GKLYIHF VDFPESL+PE
Sbjct  290  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPLYQRPFMKGKLYIHFNVDFPESLNPE  349

Query  338  QCKGLEAVLPPKP-TTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEA+LP KP  + +TDME+DECEETTLHDVN+EEEMRRKQQ QA+   ++DD   G
Sbjct  350  QVKALEAILPSKPGASQLTDMEVDECEETTLHDVNMEEEMRRKQQAQAEAYDEDDDMP-G  408

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  409  GAQRVQCAQQ  418



>gb|EMT10718.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVV EKKVLEV+VEKGMQ+GQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKR
Sbjct  210  GQCKGEKVVHEKKVLEVVVEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKR  269

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLF EHTL LTEALCGFQ++L HLD RQLLIKS PGEVVKPD FKAINDEGMPMYQR
Sbjct  270  KGDDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQR  329

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFM+GKLYIHFTVDFP+SLS +QCK LE VLPPKP +  TDMELDECEET  +D++IEEE
Sbjct  330  PFMKGKLYIHFTVDFPDSLSLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEE  389

Query  224  mrrkqqqqaqeaydedddM-HGGAQRVQCAQQ  132
            MRR++QQQAQE YDED+DM  GG QRVQCAQQ
Sbjct  390  MRRREQQQAQEGYDEDEDMPGGGGQRVQCAQQ  421



>ref|XP_003540271.1| PREDICTED: dnaJ protein homolog [Glycine max]
Length=417

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRK DDLFVEHTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L HLD RQLLIKS PGEVVKPD +KAINDEGMP YQR F++GKLYIHF+V+FP++LS +
Sbjct  290  VLAHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LE  LP KPT+ +TDMELDECEETTLHDVN+ EE  R++QQ  QEAY+ED+DMHGG
Sbjct  350  QVKALETTLPLKPTSQLTDMELDECEETTLHDVNM-EEEIRRRQQAQQEAYEEDEDMHGG  408

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  409  AQRVQCAQQ  417



>ref|XP_008661261.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=312

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF +HTL LTE+LCGFQF
Sbjct  125  MQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQF  184

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP+SLSPE
Sbjct  185  VLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPDSLSPE  244

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPPKP +  TDMELDECEET  +DVNI+EEMRR+QQQ  +   ++DD   GG
Sbjct  245  QCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIKEEMRRRQQQHQEAYDEDDDVPSGG  304

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  305  -QRVQCAQQ  312



>tpg|DAA40640.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=301

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF +HTL LTE+LCGFQF
Sbjct  114  MQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQF  173

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP SLSPE
Sbjct  174  VLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPNSLSPE  233

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPPKP +  TDMELDECEET  +DVNIEEEMRR+QQQ  +   ++DD   GG
Sbjct  234  QCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQHQEAYDEDDDVPSGG  293

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  294  -QRVQCAQQ  301



>gb|AFW89867.1| putative dnaJ chaperone family protein [Zea mays]
Length=344

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF +HTL LTE+LCGFQF
Sbjct  157  MQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQF  216

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP+SLSPE
Sbjct  217  VLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPDSLSPE  276

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPPKP +  TDMELDECEET  +DVNI+EEMRR+QQQ  +   ++DD   GG
Sbjct  277  QCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIKEEMRRRQQQHQEAYDEDDDVPSGG  336

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  337  -QRVQCAQQ  344



>ref|XP_008670357.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=267

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF +HTL LTE+LCGFQF
Sbjct  80   MQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQF  139

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP SLSPE
Sbjct  140  VLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPNSLSPE  199

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPPKP +  TDMELDECEET  +DVNIEEEMRR+QQQ  +   ++DD   GG
Sbjct  200  QCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQHQEAYDEDDDVPSGG  259

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  260  -QRVQCAQQ  267



>ref|XP_008230416.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=418

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 172/190 (91%), Gaps = 2/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI+FPGEADEAP+T+TGDIVF++ Q+EHPKFKRKG+DLFVEH+L+LTEALCGFQF
Sbjct  230  MQSGQKISFPGEADEAPETVTGDIVFIIHQKEHPKFKRKGEDLFVEHSLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAINDEGMP+YQRPFM+GKLYIHF VDFPESL+P+
Sbjct  290  VLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPLYQRPFMKGKLYIHFNVDFPESLNPD  349

Query  338  QCKGLEAVLPPKP-TTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEA+LP KP  + +TDME+DECEETTLHDVN+EEEMRRKQQ QA+   ++DD   G
Sbjct  350  QVKALEAILPSKPGASQLTDMEVDECEETTLHDVNMEEEMRRKQQAQAEAYDEDDDMP-G  408

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  409  GAQRVQCAQQ  418



>ref|XP_004291528.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=423

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKV QEKKVLEV VEKGMQNGQKITFPGEADEAPDTITGDIVF++QQ+EHPKFKR
Sbjct  212  GQCKGEKVAQEKKVLEVHVEKGMQNGQKITFPGEADEAPDTITGDIVFIIQQKEHPKFKR  271

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLFVEH+L LT+ALCGFQF+L HLD RQLLIKS PGEVVKPD FKA+NDEGMPMY R
Sbjct  272  KGDDLFVEHSLLLTDALCGFQFVLNHLDGRQLLIKSNPGEVVKPDSFKAVNDEGMPMYGR  331

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTT-GITDMELDECEETTLHDVNIee  228
            PFM+GKLYIHF+V+FPE+LS EQ K LEA LP + ++  +TDMELDECEETTLHDVN+EE
Sbjct  332  PFMKGKLYIHFSVEFPETLSLEQVKALEAALPTRASSQQLTDMELDECEETTLHDVNMEE  391

Query  227  emrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            EMRRKQ     EAYDED+DM GGAQRVQCAQQ
Sbjct  392  EMRRKQHHAHSEAYDEDEDMPGGAQRVQCAQQ  423



>gb|EMS60670.1| DnaJ protein-like protein [Triticum urartu]
Length=446

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVV EKKVLEV+VEKGMQ+GQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKR
Sbjct  235  GQCKGEKVVHEKKVLEVVVEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKR  294

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLF EHTL LTEALCGFQ++L HLD RQLLIKS PGEVVKPD FKAINDEGMPMYQR
Sbjct  295  KGDDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQR  354

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFM+GKLYIHFTVDFP+SLS +QCK LE VLPPKP +  TDMELDECEET  +D++IEEE
Sbjct  355  PFMKGKLYIHFTVDFPDSLSLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEE  414

Query  224  mrrkqqqqaqeaydedddM-HGGAQRVQCAQQ  132
            MRR+QQQQAQEAYDED+DM  GG QRVQCAQQ
Sbjct  415  MRRRQQQQAQEAYDEDEDMPGGGGQRVQCAQQ  446



>gb|KJB35429.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=444

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 181/216 (84%), Gaps = 27/216 (13%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAP+T+TGDIVFVLQQ++HPKFKRKG+DLF+EHTL+LTEALCGFQF
Sbjct  229  MQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQF---------------------------KAINDEGM  420
            ++THLD RQLLIKS PGEVVKP +F                           KAINDEGM
Sbjct  289  VITHLDGRQLLIKSNPGEVVKPGKFLEVSILKGIFYQLLGFKFVKLVIPDSCKAINDEGM  348

Query  419  PMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDV  240
            P+YQRPFM+GKLYI FTV+FP+SLSP+Q K LEA+LPPKPT+ ++DMELDECEETTL+DV
Sbjct  349  PLYQRPFMKGKLYIQFTVEFPDSLSPDQVKALEAILPPKPTSQLSDMELDECEETTLYDV  408

Query  239  NIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            NIEEEMRRKQQQ AQEAY+ED+DMHGGAQRVQCAQQ
Sbjct  409  NIEEEMRRKQQQAAQEAYEEDEDMHGGAQRVQCAQQ  444



>ref|XP_002515865.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF46534.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADEAPDTITGDIVFVLQQ++HPKFKRK DDL V+H L+LTEALCGFQF
Sbjct  230  MQHGQKITFPGEADEAPDTITGDIVFVLQQKDHPKFKRKEDDLVVDHNLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKP  FKAINDEGMPMYQRPFM+GKLYIHF VDFP+SL+ +
Sbjct  290  VLTHLDGRQLLIKSTPGEVVKPGSFKAINDEGMPMYQRPFMKGKLYIHFNVDFPDSLTAD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LP + +T +TDMELDECEETTLHDVN+EEEMRRKQQQ  QEAYDEDDDM  G
Sbjct  350  QVKALEAILPLRSSTQLTDMELDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPSG  409

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  410  AQRVQCAQQ  418



>ref|NP_568412.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
 sp|P42825.2|DNAJ2_ARATH RecName: Full=Chaperone protein dnaJ 2; Short=AtDjA2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC34499.1| DNAJ PROTEIN HOMOLOG ATJ [Arabidopsis thaliana]
 dbj|BAC42997.1| putative DnaJ protein homolog ATJ [Arabidopsis thaliana]
 gb|ABH04586.1| At5g22060 [Arabidopsis thaliana]
 gb|AED92977.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
Length=419

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKG+DLFVEHT++LTEALCGFQF
Sbjct  231  MQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS+PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FPESLSP+
Sbjct  291  VLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +EAVLP      I+DME+D+CEETTLHDVNIE+EM+RK Q Q +   D+++D  GG
Sbjct  351  QTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQAQREAYDDDEEDHPGG  410

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  411  AQRVQCAQQ  419



>ref|XP_007150008.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
 gb|ESW22002.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
Length=418

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 171/190 (90%), Gaps = 2/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDTITGDIVFVLQQ+EHPKFKRK +DLFVEHTL+LTEALCGFQF
Sbjct  230  MQNAQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKIEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  290  VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLSPD  349

Query  338  QCKGLEAVLPPKPT-TGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q   +EAVLP K +   +T+MELDECEETTLH VN+ EE  R++QQ  QEAY+EDDDMHG
Sbjct  350  QVTAIEAVLPAKTSPQKLTEMELDECEETTLHGVNM-EEELRRRQQIPQEAYEEDDDMHG  408

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  409  GAQRVQCAQQ  418



>gb|ABG78615.1| J-domain protein [Triticum aestivum]
Length=420

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVV EKKVLEV+VEKGMQ+GQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKR
Sbjct  209  GQCKGEKVVHEKKVLEVVVEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKR  268

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLF EHTL LTEALCGFQ++L HLD RQLLIKS PGEV KPD FKAINDEGMPMYQR
Sbjct  269  KGDDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGEVAKPDSFKAINDEGMPMYQR  328

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFM+GKLYIHFTVDFP+SL+ +QCK LE VLPPKP +  TDMELDECEET  +D++IEEE
Sbjct  329  PFMKGKLYIHFTVDFPDSLNLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEE  388

Query  224  mrrkqqqqaqeaydedddM-HGGAQRVQCAQQ  132
            MRR+QQQQAQEAYDED+DM  GG QRVQCAQQ
Sbjct  389  MRRRQQQQAQEAYDEDEDMPGGGGQRVQCAQQ  420



>sp|P43644.1|DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1; Flags: Precursor [Atriplex 
nummularia]
Length=417

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLF EHTL+LTEALCGF+F
Sbjct  230  MQHGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALCGFRF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS  GEVVKPDQFKAI DEGMP+YQRPFM+GK+YIHFTV+FP+SL+P+
Sbjct  290  VLTHLDGRQLLIKSNLGEVVKPDQFKAIEDEGMPIYQRPFMKGKMYIHFTVEFPDSLNPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPPKP+  +T MELDECEETTLH+VNIEEEM+RKQ Q  QEAYDEDD+  GG
Sbjct  350  QVKSLEAILPPKPSMSLTYMELDECEETTLHNVNIEEEMKRKQTQAQQEAYDEDDEPAGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  -QRVQCAQQ  417



>gb|EYU37227.1| hypothetical protein MIMGU_mgv1a006922mg [Erythranthe guttata]
Length=426

 Score =   281 bits (720),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQK+TFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL LTEALCGFQF
Sbjct  235  MQHGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQF  294

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLDNRQLLIKS+PGEV+KPDQFKAINDEGMPMY++ FM+GKLYI FTVDFPESL+P+
Sbjct  295  VLTHLDNRQLLIKSEPGEVIKPDQFKAINDEGMPMYEKSFMKGKLYIQFTVDFPESLNPQ  354

Query  338  QCKGLEAVLPP-KPTTGITDMELDECEETTLHDVNIeeemrrk--qqqqaqeaydedddM  168
            Q K L  VLP  K TT +TDMELDECEETTLHDVN+EEEMRRK  Q+       D++D  
Sbjct  355  QIKALATVLPSKKSTTQLTDMELDECEETTLHDVNMEEEMRRKPQQRAHEAYDDDDEDMH  414

Query  167  HGGAQRVQCAQQ  132
             GGAQ V CAQQ
Sbjct  415  GGGAQSVPCAQQ  426



>ref|XP_006400711.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
 gb|ESQ42164.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
Length=420

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  232  MQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI+DEGMP++QRPFM+GKLYIHFTV+FPESLSP+
Sbjct  292  VLTHLDTRQLLIKSNPGEVVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPESLSPD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +EAVLP      ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+++D  GG
Sbjct  352  QTKAIEAVLPKPSKAALSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDEEDGPGG  411

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  412  AQRVQCAQQ  420



>ref|XP_010514755.1| PREDICTED: chaperone protein dnaJ 3-like [Camelina sativa]
Length=420

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTVDFP+SLSPE
Sbjct  290  VLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPVYQRPFMKGKLYIHFTVDFPDSLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   T  + DME+DECEETTLHDVNIE+EMRRK Q Q +   D+DDD    
Sbjct  350  QTKALEAVLPKPSTAQLNDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDDDDDHP  409

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  410  GGAQRVQCAQQ  420



>ref|XP_010427107.1| PREDICTED: chaperone protein dnaJ 3 isoform X1 [Camelina sativa]
 ref|XP_010427108.1| PREDICTED: chaperone protein dnaJ 3 isoform X2 [Camelina sativa]
Length=420

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTVDFP+SLSPE
Sbjct  290  VLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPVYQRPFMKGKLYIHFTVDFPDSLSPE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   T  + DME+DECEETTLHDVNIE+EMRRK Q Q +   D+DDD    
Sbjct  350  QTKALEAVLPKPSTAQLNDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDDDDDHP  409

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  410  GGAQRVQCAQQ  420



>gb|KHG16063.1| DnaJ protein [Gossypium arboreum]
Length=299

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  650  PDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQP  471
            PDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTL LTEALCGFQFILTHLD RQLLIK+ P
Sbjct  127  PDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKTHP  186

Query  470  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTG  291
            GEVVKPDQ KAINDEGMPMYQRPFMRGKLYIHFTVDFP+SL+PEQCK LEAVLP + +  
Sbjct  187  GEVVKPDQCKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPSRASVQ  246

Query  290  ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            +TDMELDECEETTL+DVNIEEEMRRKQ Q AQEAY+EDDDMHGGAQRVQCAQQ
Sbjct  247  LTDMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDDMHGGAQRVQCAQQ  299



>emb|CDX92386.1| BnaA10g14250D [Brassica napus]
Length=422

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 168/191 (88%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  233  MQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+QRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  293  VLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K +EAVL PKP   ++DME+DECEETTLHDVNI +EMRRK Q Q +   D+DDD    
Sbjct  353  QTKAIEAVL-PKPKADLSDMEIDECEETTLHDVNIGDEMRRKAQAQREAYDDDDDDEEGP  411

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  412  GGAQRVQCAQQ  422



>ref|XP_002877319.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53578.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  231  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  291  VLTHLDGRNLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   TT ++DME+DECEETTLHDVNIE+EM+RK Q Q +   D+D+D    
Sbjct  351  QTKALEAVLPKPSTTQLSDMEIDECEETTLHDVNIEDEMKRKAQAQREAYDDDDEDDDHP  410

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  411  GGAQRVQCAQQ  421



>ref|XP_006404506.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
 gb|ESQ45959.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
Length=421

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  231  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LL+KS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FP+SLSP 
Sbjct  291  VLTHLDGRNLLVKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPN  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   TT ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+DDD    
Sbjct  351  QTKALEAVLPKPSTTQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDDDDEHP  410

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  411  GGAQRVQCAQQ  421



>emb|CDX92385.1| BnaA10g14240D [Brassica napus]
Length=422

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 169/191 (88%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  233  MQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+QRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  293  VLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K +EAVL PKP   ++DME+DECEETTLH+VNIE+EMRRK Q Q +   D+DDD    
Sbjct  353  QTKAIEAVL-PKPKADLSDMEIDECEETTLHEVNIEDEMRRKAQAQREAYDDDDDDEEGP  411

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  412  GGAQRVQCAQQ  422



>ref|XP_009120689.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
Length=422

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 169/191 (88%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  233  MQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+QRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  293  VLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K +EAVL PKP   ++DME+DECEETTLH+VNIE+EMRRK Q Q +   D+DDD    
Sbjct  353  QTKAIEAVL-PKPKADLSDMEIDECEETTLHEVNIEDEMRRKAQAQREAYDDDDDDEEGP  411

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  412  GGAQRVQCAQQ  422



>gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thaliana]
Length=420

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  290  VLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   T  ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+D+D    
Sbjct  350  QTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDEDDDHP  409

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  410  GGAQRVQCAQQ  420



>ref|NP_189997.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 sp|Q94AW8.2|DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3; Short=AtDjA3; Short=AtJ3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86892.1| AtJ3 [Arabidopsis thaliana]
 emb|CAB88419.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAK59592.1| putative dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAM44926.1| putative DnaJ-like protein atj3 [Arabidopsis thaliana]
 gb|AAM65624.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 dbj|BAE98606.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AEE77863.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=420

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  290  VLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   T  ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+D+D    
Sbjct  350  QTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDEDDDHP  409

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  410  GGAQRVQCAQQ  420



>ref|XP_006287824.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
 gb|EOA20722.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
Length=421

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  232  MQHSQKITFSGQADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+R+LLIKS PGEVVKPD +KAINDEGM +YQRPFM+GKLYIHFTV FPESLSP+
Sbjct  292  VLTHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVIYQRPFMKGKLYIHFTVVFPESLSPD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-G  162
            Q K +EAVLP      ++DM++D+CEETTLHDVNIE+EMRRK Q Q +   D+DD+ H G
Sbjct  352  QTKAIEAVLPKPTKAAMSDMDIDDCEETTLHDVNIEDEMRRKAQAQREAYDDDDDEDHPG  411

Query  161  GAQRVQCAQQ  132
            GAQRVQCAQQ
Sbjct  412  GAQRVQCAQQ  421



>emb|CDY16617.1| BnaC09g36560D [Brassica napus]
Length=208

 Score =   272 bits (695),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  19   MQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  78

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI DEGMP++QRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  79   VLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPVHQRPFMKGKLYIHFTVDFPDSLSPD  138

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqea--ydedddMH  165
            Q K +EAVL PKP   ++DME DECEETTLH+VNIE+EMRRK Q Q +     D+D++  
Sbjct  139  QTKAIEAVL-PKPKADLSDMETDECEETTLHEVNIEDEMRRKAQAQREAYDDDDDDEEGP  197

Query  164  GGAQRVQCAQQ  132
            GG QRVQCAQQ
Sbjct  198  GGPQRVQCAQQ  208



>gb|AAB86799.1| putative [Arabidopsis thaliana]
 prf||2118338A AtJ2 protein
Length=419

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKG+DLFVEHT++LTEALCGFQF
Sbjct  231  MQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS+PGEVVKPD +KAI+DEGMP+YQ PFM+GKLYIHFTV+FPESLSP+
Sbjct  291  VLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQSPFMKGKLYIHFTVEFPESLSPD  350

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +EAVLP      I+DME+D+CEETTLHDVNIE+EM+RK Q Q +    +++D  GG
Sbjct  351  QTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQAQREAYDVDEEDHPGG  410

Query  158  AQRVQCAQQ  132
            A RVQCAQQ
Sbjct  411  AHRVQCAQQ  419



>ref|XP_009120690.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
Length=422

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 169/191 (88%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  233  MQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+QRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  293  VLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K +EAVL PKP   ++DME+DECEETTLH+VNIE+EMRRK Q Q +   D+DDD    
Sbjct  353  QTKAIEAVL-PKPKADLSDMEIDECEETTLHEVNIEDEMRRKAQAQREAYDDDDDDEEGP  411

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  412  GGAQRVQCAQQ  422



>dbj|BAJ91943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKGEKVV EKKVLEV+VEKGMQ+GQKITFPGEADEAPDT+TGDI+FVLQQ+EHPKFKR
Sbjct  210  GQCKGEKVVHEKKVLEVVVEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKR  269

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            K DDLF EHTL LTEALCGFQ++L HLD RQLLIKS PGEVVKPD FKAINDEGMPMYQR
Sbjct  270  KADDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQR  329

Query  404  PFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeee  225
            PFM+GKLYIHFTV FP+SLS +QCK LE VLPPKP +  TDMELDECEET  +D++IEEE
Sbjct  330  PFMKGKLYIHFTVVFPDSLSLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEE  389

Query  224  mrrkqqqqaqeaydedddM-HGGAQRVQCAQQ  132
            MRR+QQQQAQEAYDED+DM  GG QRVQCAQQ
Sbjct  390  MRRQQQQQAQEAYDEDEDMPGGGGQRVQCAQQ  421



>ref|XP_006292339.1| hypothetical protein CARUB_v10018551mg [Capsella rubella]
 gb|EOA25237.1| hypothetical protein CARUB_v10018551mg [Capsella rubella]
Length=420

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  290  VLTHLDGRNLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   T  ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+DDD    
Sbjct  350  QTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDDDDDHP  409

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  410  GGAQRVQCAQQ  420



>ref|XP_010544327.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
 ref|XP_010544328.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
Length=419

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 166/193 (86%), Gaps = 4/193 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPG ADEAPDT+TGD+VFV+QQ+EHPKFKRKG++LF EHTL+LTEALCGFQF
Sbjct  227  MQNGQKITFPGAADEAPDTVTGDVVFVIQQKEHPKFKRKGENLFYEHTLSLTEALCGFQF  286

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD FKAI+DEGMP++QRPFM+GKLYIHF V+FP+SLS +
Sbjct  287  VLTHLDGRQLLIKSNPGEVVKPDSFKAIDDEGMPVHQRPFMKGKLYIHFMVEFPDSLSSD  346

Query  338  QCKGLEAVLPPKPTTG-ITDMELDECEETTLHDVNIeeemrrkq---qqqaqeaydeddd  171
            Q K LEA+LPP  T+   TDMELDECEETTLHDVNIEEEMRRK    Q+      D DD 
Sbjct  347  QVKALEAILPPPRTSSQFTDMELDECEETTLHDVNIEEEMRRKHQQPQRGEAYEEDGDDS  406

Query  170  MHGGAQRVQCAQQ  132
             HGGAQRVQCAQQ
Sbjct  407  GHGGAQRVQCAQQ  419



>gb|AAB49030.1| DnaJ homolog [Arabidopsis thaliana]
Length=420

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHP+FKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPQFKRKGEDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  290  VLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K LEAVLP   T  ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+D+D    
Sbjct  350  QTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDEDDDHP  409

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  410  GGAQRVQCAQQ  420



>gb|KDP22008.1| hypothetical protein JCGZ_03128 [Jatropha curcas]
Length=326

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 1/173 (1%)
 Frame = -1

Query  650  PDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQP  471
            PDTITGDIVFVLQQ+EHPKFKRKGDDL V+HTL+LTEALCGFQFILTHLD RQLLIKSQP
Sbjct  155  PDTITGDIVFVLQQKEHPKFKRKGDDLIVDHTLSLTEALCGFQFILTHLDGRQLLIKSQP  214

Query  470  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTG  291
            GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP+SL P+QCK LEAVLP + +  
Sbjct  215  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLPPDQCKALEAVLPSRSSVQ  274

Query  290  ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            ++DMELDECEETTLHDVN  EE  R++QQ A EAYDED+DMHGG+QRVQCAQQ
Sbjct  275  LSDMELDECEETTLHDVNF-EEEMRRKQQHAAEAYDEDEDMHGGSQRVQCAQQ  326



>emb|CAC12824.1| putative DNAJ protein [Nicotiana tabacum]
Length=418

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPG+ADE PD ITGDIVFVLQQ++    KRKGDDLFV+HTL+LTEALCGFQF
Sbjct  230  MQNGQKITFPGKADETPDAITGDIVFVLQQKDTRGSKRKGDDLFVDHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            I+THLD RQLLIKS  GEVVKPDQFKAINDEG PMYQRPFMRGKLYI F V+FP+SL+ E
Sbjct  290  IMTHLDGRQLLIKSNLGEVVKPDQFKAINDEGTPMYQRPFMRGKLYIRFVVEFPDSLNTE  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K LEA+LPP+P +  TDMELDECEET+LHDVNIEEEMRRKQ  Q +   ++D+   GG
Sbjct  350  QVKALEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQQEAYDEDDEMHGGG  409

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  410  GQRVQCAQQ  418



>ref|XP_008660777.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=324

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNG KITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF EHTL L E+LC FQF
Sbjct  137  MQNGHKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLIESLCSFQF  196

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTH+DNRQ+LIK   GEVVKP+ FKAINDEGMPMYQRPF++GKLYIHF+V+F +SLSPE
Sbjct  197  VLTHMDNRQMLIKLNHGEVVKPNSFKAINDEGMPMYQRPFIKGKLYIHFSVEFSDSLSPE  256

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPPKP +  TDMELDECE+T  +DVNIEEEMRR+QQQ  +   ++D+   GG
Sbjct  257  QCKALEVVLPPKPVSQYTDMELDECEDTMPYDVNIEEEMRRRQQQHQEAYDEDDNVP-GG  315

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  316  GQRVQCAQQ  324



>gb|ABK21047.1| unknown [Picea sitchensis]
Length=189

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 168/191 (88%), Gaps = 4/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQ+I F GEADEAPDTITGDIVFVLQ ++H KFKRKGDDL+VEHTL LTEALCGFQF
Sbjct  1    MQHGQRIVFQGEADEAPDTITGDIVFVLQLKDHSKFKRKGDDLYVEHTLNLTEALCGFQF  60

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGE++KP Q+KAINDEGMP YQRPFM+G+LYIHF V+FPES  LS
Sbjct  61   PLTHLDGRQLLIKSSPGEIIKPSQYKAINDEGMPQYQRPFMKGRLYIHFNVEFPESGALS  120

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            PEQCK LE++LPP+P   +TDMELDECEETTLHDVNIE+E+RRKQQQQ QEAY+EDD+  
Sbjct  121  PEQCKALESILPPRPAGYMTDMELDECEETTLHDVNIEDELRRKQQQQQQEAYEEDDEPQ  180

Query  164  GGAQRVQCAQQ  132
            G   RVQCAQQ
Sbjct  181  G--HRVQCAQQ  189



>ref|XP_010420996.1| PREDICTED: chaperone protein dnaJ 2 isoform X1 [Camelina sativa]
 ref|XP_010420997.1| PREDICTED: chaperone protein dnaJ 2 isoform X2 [Camelina sativa]
Length=421

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHP FKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  233  MQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPMFKRKGDDLFVEHTLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+R+LLIKS PGEVVKPD +KAINDEGM MYQRPFM+GKLYIHFTV+FPESLSP+
Sbjct  293  VLTHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPESLSPD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +E VLP      ++DM++D+CEETTLHDVNIE+EMRRK Q Q +   D+D++  GG
Sbjct  353  QTKTIEEVLPKPTKATMSDMDIDDCEETTLHDVNIEDEMRRKAQTQREAYDDDDEEHPGG  412

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  413  AQRVQCAQQ  421



>ref|XP_010520679.1| PREDICTED: chaperone protein dnaJ 3-like [Tarenaya hassleriana]
Length=484

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QK+TF G+ADEAPDTITGDIVFVLQQ+EHP+FKRKGDDLFVEHTL+L EALCGFQF
Sbjct  295  MQHNQKVTFSGQADEAPDTITGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLAEALCGFQF  354

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+RQLLI+S PGEVVKPD +KAINDEGMP+YQRPFM+GKLYIHF+V+FPESLSP+
Sbjct  355  VLTHLDDRQLLIRSSPGEVVKPDSYKAINDEGMPVYQRPFMKGKLYIHFSVEFPESLSPD  414

Query  338  QCKGLEAVLPPKPTTG-ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHG  162
            Q K LEAVLP KP+   +T+ME+DECEETTLH VN+EEEMRRKQQ Q +   D+DDD   
Sbjct  415  QAKALEAVLPQKPSGNQLTEMEIDECEETTLHQVNMEEEMRRKQQSQREAYDDDDDDGDD  474

Query  161  GAQRVQCAQQ  132
            G QRVQCAQQ
Sbjct  475  GPQRVQCAQQ  484



>ref|XP_010454471.1| PREDICTED: chaperone protein dnaJ 2 [Camelina sativa]
Length=420

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  232  MQHNQKITFNGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +L HLD+R+LLIKS PGEVVKPD +KAINDEGM MYQRPFM+GKLYIHFTV+FPESLSP+
Sbjct  292  VLNHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPESLSPD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +E VLP      ++DM++D+CEETTLHDVNIE+EMRRK Q Q +   D+D++  GG
Sbjct  352  QTKTIEEVLPKPTKATMSDMDIDDCEETTLHDVNIEDEMRRKAQAQREAYDDDDEEHPGG  411

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  412  GQRVQCAQQ  420



>gb|KJB84164.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQ+ITFPGEADEAPDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTLALTEALCGFQF
Sbjct  230  MQNGQRITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLALTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            ILTHLD RQLLIK+QPGEVVKPDQFKAINDEGMP+YQRPFMRGKL+IHFTVDFP+SL+P+
Sbjct  290  ILTHLDGRQLLIKTQPGEVVKPDQFKAINDEGMPIYQRPFMRGKLFIHFTVDFPDSLTPD  349

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTL  249
            QCK LEAVLPPK +  +TDMELDE   T +
Sbjct  350  QCKALEAVLPPKASVQLTDMELDEKMRTCM  379



>ref|XP_010493266.1| PREDICTED: chaperone protein dnaJ 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010493267.1| PREDICTED: chaperone protein dnaJ 2-like isoform X2 [Camelina 
sativa]
Length=420

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+Q +EHPKFKRKGDDLFVEHTL+LTEALCGF F
Sbjct  232  MQHNQKITFSGQADEAPDTVTGDIVFVIQLKEHPKFKRKGDDLFVEHTLSLTEALCGFHF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD+R+LLIKS PGEVVKPD +KAINDEGM MYQRPFM+GKLYIHFTV+FPESLSP+
Sbjct  292  VLTHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPESLSPD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q K +E VLP      ++DM++D+CEETTLHDVNIE+EM+RK Q Q +   D+D++  GG
Sbjct  352  QTKTIEEVLPKPTKATMSDMDIDDCEETTLHDVNIEDEMKRKAQAQREAYDDDDEEHPGG  411

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  412  AQRVQCAQQ  420



>ref|XP_010535721.1| PREDICTED: chaperone protein dnaJ 3 [Tarenaya hassleriana]
Length=423

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 170/194 (88%), Gaps = 5/194 (3%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFVLQQ+EHP+FKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSQKITFSGQADEAPDTVTGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
              THLD RQLLI+S PGEVVKPD +KAINDEGMP+YQRPFM+GKLYIHF+V+FPESLSP+
Sbjct  290  AQTHLDGRQLLIRSNPGEVVKPDSYKAINDEGMPIYQRPFMKGKLYIHFSVEFPESLSPD  349

Query  338  QCKGLEAVLPPKPTTG---ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddM  168
            Q K +EAVLP +P++    +T+ME+DECEETTLHDV+  EE  R++QQ  +EAYD+DDD 
Sbjct  350  QAKAIEAVLPGRPSSSKKQLTEMEIDECEETTLHDVSNMEEEMRRKQQAQREAYDDDDDD  409

Query  167  HG--GAQRVQCAQQ  132
             G  GAQRVQCAQQ
Sbjct  410  DGPHGAQRVQCAQQ  423



>emb|CDY09117.1| BnaA02g05430D [Brassica napus]
Length=423

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EH  FKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  233  MQHSQKITFRGQADEAPDTVTGDIVFVIQQKEHSTFKRKGDDLFVEHTLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI+DEGMP++QRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  293  VLTHLDTRQLLIKSNPGEVVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPDSLSPD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K +EAVLP      ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+DDD    
Sbjct  353  QTKAIEAVLPRPANATLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDDDEEGP  412

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  413  GGAQRVQCAQQ  423



>ref|XP_009126521.1| PREDICTED: chaperone protein dnaJ 3 [Brassica rapa]
Length=423

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EH  FKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  233  MQHSQKITFRGQADEAPDTVTGDIVFVIQQKEHSTFKRKGDDLFVEHTLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI+DEGMP++QRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  293  VLTHLDTRQLLIKSSPGEVVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPDSLSPD  352

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH--  165
            Q K +EAVLP      ++DME+DECEETTLHDVNIE+EMRRK Q Q +   D+DDD    
Sbjct  353  QTKAIEAVLPRPANATLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDDDEEGP  412

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  413  GGAQRVQCAQQ  423



>ref|XP_011088982.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=413

 Score =   271 bits (692),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 161/189 (85%), Gaps = 5/189 (3%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITFPGEADEAPDT+TGDIVFVLQQ+EHPKFKRKGDDL        TEALCGFQF
Sbjct  230  MQNLQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDL----XXXXTEALCGFQF  285

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            IL+HLD RQLLIKSQPGEVVKP+ +KAINDEGMPMYQRPFM+GKLYIHF V+FP+SLS +
Sbjct  286  ILSHLDGRQLLIKSQPGEVVKPNSYKAINDEGMPMYQRPFMKGKLYIHFNVEFPDSLSLD  345

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            Q   LE +LPPKP + +TDME+DECEETTLHDVNI E+  R++ Q  +   ++D+DMHGG
Sbjct  346  QVGALEKILPPKPQSQLTDMEIDECEETTLHDVNI-EDEMRRKAQHQEAYEEDDEDMHGG  404

Query  158  AQRVQCAQQ  132
            AQRVQCAQQ
Sbjct  405  AQRVQCAQQ  413



>gb|KFK26344.1| hypothetical protein AALP_AA8G235700 [Arabis alpina]
Length=421

 Score =   271 bits (693),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKIT  G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  231  MQHSQKITMTGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  290

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAI++EGMP+YQRPFM+GKLYIHFTV+FP+SLSP+
Sbjct  291  VLTHLDKRQLLIKSNPGEVVKPDSYKAISEEGMPIYQRPFMKGKLYIHFTVEFPDSLSPD  350

Query  338  QCKGLEAVLP-PKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH-  165
            Q K +EAVLP P      +DM++DECEETTLHDVNIE+EM+RK Q Q +   D+D+    
Sbjct  351  QTKAIEAVLPKPAKAAQTSDMDIDECEETTLHDVNIEDEMKRKAQAQREAYDDDDEGEGP  410

Query  164  GGAQRVQCAQQ  132
            GGAQRVQCAQQ
Sbjct  411  GGAQRVQCAQQ  421



>gb|ACN39991.1| unknown [Picea sitchensis]
Length=421

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 188/213 (88%), Gaps = 4/213 (2%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKG KVVQ+KKVLEV VEKGMQ+GQ+I F GEADEAPDTITGDIVFVLQ ++H KFKR
Sbjct  211  GQCKGSKVVQDKKVLEVHVEKGMQHGQRIVFQGEADEAPDTITGDIVFVLQLKDHSKFKR  270

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDL+VEHTL LTEALCGFQF LTHLD RQLLIKS PGE++KP Q+KAINDEGMP YQR
Sbjct  271  KGDDLYVEHTLNLTEALCGFQFPLTHLDGRQLLIKSSPGEIIKPSQYKAINDEGMPQYQR  330

Query  404  PFMRGKLYIHFTVDFPES--LSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIe  231
            PFM+G+LYIHF V+FPES  LSPEQCK LE++LPP+P   +TDMELDECEETTLHDVNIE
Sbjct  331  PFMKGRLYIHFNVEFPESGALSPEQCKALESILPPRPAGYMTDMELDECEETTLHDVNIE  390

Query  230  eemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            +E+RRKQQQQ QEAY+EDD+  G   RVQCAQQ
Sbjct  391  DELRRKQQQQQQEAYEEDDEPQG--HRVQCAQQ  421



>ref|XP_010521621.1| PREDICTED: dnaJ protein homolog ANJ1-like [Tarenaya hassleriana]
Length=423

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITFPGEADEAPDTITGDIVF+LQQ+EHPKFKRKGDDLF EHTL LTEALCGFQF
Sbjct  233  MQNGQKITFPGEADEAPDTITGDIVFILQQKEHPKFKRKGDDLFYEHTLCLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGM--PMYQRPFMRGKLYIHFTVDFPESLS  345
            +LTHLD RQLLIKS PGEVVKP +    +  G   PMYQRPFM+GKLYIHFTV+FPE+L 
Sbjct  293  VLTHLDGRQLLIKSNPGEVVKPGKHFPRSGFGCHPPMYQRPFMKGKLYIHFTVEFPETLK  352

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+Q K LE VLPPKP+T +++MELDECEETTLHDVNIEEEMRRKQQ Q QEAYDEDDD  
Sbjct  353  PDQVKALEKVLPPKPSTQMSEMELDECEETTLHDVNIEEEMRRKQQSQQQEAYDEDDDEP  412

Query  164  GGAQRVQCAQQ  132
             GAQRVQCAQQ
Sbjct  413  HGAQRVQCAQQ  423



>emb|CDY65546.1| BnaCnng47600D [Brassica napus]
Length=421

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  232  MQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD ++AI DEGMP++QRPFM+GKLYIHFTVDFP+SLSP+
Sbjct  292  VLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPVHQRPFMKGKLYIHFTVDFPDSLSPD  351

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqea--ydedddMH  165
            Q K +EAVL PKP   ++DME DECEETTLH+VNIE+EMRRK Q Q +     D+D++  
Sbjct  352  QTKAIEAVL-PKPKADLSDMETDECEETTLHEVNIEDEMRRKAQAQREAYDDDDDDEEGP  410

Query  164  GGAQRVQCAQQ  132
            GG QRVQCAQQ
Sbjct  411  GGPQRVQCAQQ  421



>ref|XP_002969107.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
 ref|XP_002973957.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ24912.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ30223.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
Length=414

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 172/191 (90%), Gaps = 4/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            M + QKITF GEADEAPDTITGDI+FVLQQ+EHPKFKRKGDDLF+EH+L+L +ALCGFQF
Sbjct  226  MSHNQKITFQGEADEAPDTITGDIIFVLQQKEHPKFKRKGDDLFLEHSLSLLDALCGFQF  285

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPE--SLS  345
             +THLD RQLL+KS+PGE++KP QFKAINDEGMP +QRPFM+G LYIHF+VDFPE  SL+
Sbjct  286  TITHLDGRQLLVKSRPGEIIKPGQFKAINDEGMPHHQRPFMKGTLYIHFSVDFPESGSLT  345

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            PEQCK LEAVLPP+P++ +T+MELDECEETTLHDVN+EEEMR+KQQQQ QEAYDEDD+  
Sbjct  346  PEQCKALEAVLPPRPSSQLTEMELDECEETTLHDVNLEEEMRKKQQQQQQEAYDEDDEPA  405

Query  164  GGAQRVQCAQQ  132
            G   RVQCAQQ
Sbjct  406  G--PRVQCAQQ  414



>gb|AFW86285.1| putative dnaJ chaperone family protein [Zea mays]
Length=641

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNG KITFPGEADEAPDT TGDI+FVLQQ+EHPKFKRKGDDLF EHTL L E+LC FQF
Sbjct  454  MQNGHKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLIESLCSFQF  513

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTH+DNRQ+LIK   GEVVKP+ FKAINDEGMPMYQRPF++GKLYIHF+V+F +SLSPE
Sbjct  514  VLTHMDNRQMLIKLNHGEVVKPNSFKAINDEGMPMYQRPFIKGKLYIHFSVEFSDSLSPE  573

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGG  159
            QCK LE VLPPKP +  TDMELDECE+T  +DVNIEEEMRR+QQQ  +   ++D+   GG
Sbjct  574  QCKALEVVLPPKPVSQYTDMELDECEDTMPYDVNIEEEMRRRQQQHQEAYDEDDNVP-GG  632

Query  158  AQRVQCAQQ  132
             QRVQCAQQ
Sbjct  633  GQRVQCAQQ  641



>ref|XP_009131855.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
 emb|CDX88812.1| BnaA03g08370D [Brassica napus]
Length=408

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITF G+ADEAPDT+TGDIVFV+QQ+EHPKFKRKGDDLFVEHTL+LTEALCGFQF
Sbjct  219  MQNSQKITFRGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF  278

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVVKPD +KAI+DEGMP++QRPFM+GKLYIHFTV+FPESLS +
Sbjct  279  VLTHLDARQLLIKSSPGEVVKPDSYKAISDEGMPIHQRPFMKGKLYIHFTVEFPESLSRD  338

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            Q K  EAVLP    + ++DME+DECEETTLH+VNI
Sbjct  339  QTKAFEAVLPKPAKSAMSDMEIDECEETTLHEVNI  373



>ref|XP_001774283.1| predicted protein [Physcomitrella patens]
 gb|EDQ60919.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 180/220 (82%), Gaps = 5/220 (2%)
 Frame = -1

Query  785  LMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQR  606
            +  K   GQCKG+KVVQ+KKVLEV VEKGM +GQKITF GEADEAPDT+TGDIVFVLQ +
Sbjct  201  ISEKDKCGQCKGQKVVQDKKVLEVHVEKGMAHGQKITFQGEADEAPDTVTGDIVFVLQLK  260

Query  605  EHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDE  426
            EHPKFKRKGDDLFVEHTL+LTEALCGFQF LTHLD RQLLIK+ PGE+VKP QFKAINDE
Sbjct  261  EHPKFKRKGDDLFVEHTLSLTEALCGFQFPLTHLDGRQLLIKTNPGEIVKPGQFKAINDE  320

Query  425  GMPMYQRPFMRGKLYIHFTVDFPE--SLSPEQCKGLEAVLPPKPTTGITDMELDECEETT  252
            GMP YQRPFM+GKLY+HFTV+FPE  SLS EQC+ LE++LPP+ ++ +TDM+LDECEETT
Sbjct  321  GMPQYQRPFMKGKLYLHFTVEFPESGSLSSEQCRMLESILPPRASSHLTDMDLDECEETT  380

Query  251  LHDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            L DVNI       +++  Q+    D+D      R+QCAQQ
Sbjct  381  LIDVNI---EEEMRRKHQQQQEAYDEDEESSGPRIQCAQQ  417



>ref|XP_001782829.1| predicted protein [Physcomitrella patens]
 gb|EDQ52343.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = -1

Query  764  GQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKR  585
            GQCKG+KVVQ+KK+LEV VEKGM +GQKITF GEADEAPDT+TGDIVFVLQ ++HPKFKR
Sbjct  206  GQCKGQKVVQDKKMLEVHVEKGMVHGQKITFQGEADEAPDTVTGDIVFVLQLKDHPKFKR  265

Query  584  KGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQR  405
            KGDDLFVEH+L LTEALCGFQF LTHLD RQLLIKS PGE+VKP QFKAINDEGMP YQR
Sbjct  266  KGDDLFVEHSLNLTEALCGFQFPLTHLDGRQLLIKSNPGEIVKPGQFKAINDEGMPHYQR  325

Query  404  PFMRGKLYIHFTVDFPES--LSPEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIe  231
            PFM+G+LY+HF+V+FPES  L+PEQ K LE +LPP+PT+ +TDMELDECEETTL DVNI 
Sbjct  326  PFMKGRLYLHFSVEFPESGALTPEQLKALEVILPPRPTSQMTDMELDECEETTLIDVNI-  384

Query  230  eemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
                  +++Q Q+    D+D      R+QCAQQ
Sbjct  385  --EDEMRRKQQQQQEAYDEDEESSGPRIQCAQQ  415



>ref|XP_008666814.1| PREDICTED: dnaJ protein homolog 1-like [Zea mays]
Length=515

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 171/219 (78%), Gaps = 30/219 (14%)
 Frame = -1

Query  698  MQNGQKITFP-----------------------------GEADEAPDTITGDIVFVLQQR  606
            MQ+ QKITFP                              EADEAPDT+TGDIVFVL+Q+
Sbjct  297  MQHNQKITFPGEADEAPAEAAAAAPAAGELAGDEGRGGSAEADEAPDTVTGDIVFVLRQK  356

Query  605  EHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDE  426
            +H KFKRKG+DL  EHTL+LTEALCG QF+LTHLDNRQLLIKS PGEVVKPDQFKAINDE
Sbjct  357  DHSKFKRKGEDLLYEHTLSLTEALCGCQFVLTHLDNRQLLIKSDPGEVVKPDQFKAINDE  416

Query  425  GMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTGITDMELDECEETTLH  246
            GMP+YQRPFM+GKLYIHFTV+FP+SL+PEQCK LE VLPP+ ++ +TDME DECEETT+H
Sbjct  417  GMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALETVLPPRLSSKLTDMETDECEETTMH  476

Query  245  DV-NIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            DV NIEEEM RKQ   A EAY+EDD+M GGAQRVQCAQQ
Sbjct  477  DVNNIEEEMHRKQAHAAHEAYEEDDEMPGGAQRVQCAQQ  515



>gb|KHN36510.1| DnaJ protein like [Glycine soja]
Length=298

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = -1

Query  650  PDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQP  471
            PDT+TGDIVFVLQQ+EHPKFKRK DDLFVEHTL+LTEALCGFQF+LTHLD+RQLLIKS P
Sbjct  127  PDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQFVLTHLDSRQLLIKSNP  186

Query  470  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTG  291
            GEVVKP+ FKAINDEGMP YQR F++GKLYIHF+V+FP++LS +Q K LEA LP KPT+ 
Sbjct  187  GEVVKPESFKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLDQVKALEATLPLKPTSQ  246

Query  290  ITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            +TDMELDECEETTLHDVN+ EE  R++QQ  QEAYDED+DMHGGAQRVQCAQQ
Sbjct  247  LTDMELDECEETTLHDVNM-EEETRRRQQAQQEAYDEDEDMHGGAQRVQCAQQ  298



>ref|XP_002983333.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
 ref|XP_002987616.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ11191.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ15675.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
Length=419

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            M + QKITF GEADEAPDTITGDIVFV+Q ++HPKFKR+GDDLF EHTL LTEALCGFQF
Sbjct  229  MMHNQKITFQGEADEAPDTITGDIVFVIQVKDHPKFKRRGDDLFYEHTLTLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPE--SLS  345
            ILTHLD R LL+KS PGE++KPDQFK I+DEGMP YQRPFM+G+L+I F VDFP+  SLS
Sbjct  289  ILTHLDGRSLLVKSTPGEIIKPDQFKGIDDEGMPHYQRPFMKGRLFIQFHVDFPDSGSLS  348

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            PEQCK LE +LPP+PT  +TDMELDECEETTL DVNIEEEMRRKQQ Q Q+    D+D  
Sbjct  349  PEQCKMLETILPPRPTNHLTDMELDECEETTLLDVNIEEEMRRKQQHQQQQQEAYDEDDE  408

Query  164  GGAQRVQCAQQ  132
                RVQCAQQ
Sbjct  409  PSGPRVQCAQQ  419



>emb|CDX70980.1| BnaC03g10640D [Brassica napus]
Length=407

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKITF G+ADEAPDT+TGDIV V+QQ+EHPKFKRKG+DLFVEHTL+LTEALCGFQF
Sbjct  218  MQNSQKITFRGQADEAPDTVTGDIVLVIQQKEHPKFKRKGNDLFVEHTLSLTEALCGFQF  277

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPE  339
            +LTHLD RQLLIKS PGEVV+PD +KAI+DEGMPM+QRPFM+GKLYIHFTV+FPESLS +
Sbjct  278  VLTHLDARQLLIKSIPGEVVQPDSYKAISDEGMPMHQRPFMKGKLYIHFTVEFPESLSGD  337

Query  338  QCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            Q K  EAVLP    + ++DME+D+CEETTLH+VNI
Sbjct  338  QTKAFEAVLPKPAESALSDMEIDKCEETTLHEVNI  372



>gb|KHG16062.1| Chaperone protein dnaJ 3 [Gossypium arboreum]
Length=321

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  650  PDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQP  471
            PDT+TGDIVFVLQQ++HPKFKRKGDDLFVEHTL LTEALCGFQFILTHLD RQLLIK+ P
Sbjct  127  PDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKTHP  186

Query  470  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPEQCKGLEAVLPPKPTTG  291
            GEVVKPDQ KAINDEGMPMYQRPFMRGKLYIHFTVDFP+SL+PEQCK LEAVLP + +  
Sbjct  187  GEVVKPDQCKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPSRASVQ  246

Query  290  ITDMELDECEETTLHDVNI  234
            +TDMELDECEETTL+DVNI
Sbjct  247  LTDMELDECEETTLYDVNI  265



>ref|XP_001768102.1| predicted protein [Physcomitrella patens]
 gb|EDQ66975.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 176/220 (80%), Gaps = 5/220 (2%)
 Frame = -1

Query  785  LMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQR  606
            ++ K   GQCKG+KVVQ+KK+LEV VEKGMQ+GQKITF GEADEAPDTITGDIVFVLQ +
Sbjct  203  IVEKDRCGQCKGQKVVQDKKLLEVHVEKGMQHGQKITFQGEADEAPDTITGDIVFVLQLK  262

Query  605  EHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDE  426
            EHPKFKRK DDLFVEHTL+LTEALCGFQF LTHLD RQLLIKS PGE++KP QFKAINDE
Sbjct  263  EHPKFKRKVDDLFVEHTLSLTEALCGFQFPLTHLDGRQLLIKSAPGEIIKPGQFKAINDE  322

Query  425  GMPMYQRPFMRGKLYIHFTVDFPE--SLSPEQCKGLEAVLPPKPTTGITDMELDECEETT  252
            GMP + RPFM+G+LY+HFTV+ PE  SLS EQ K LE VLPP+PT  +TDMELDECEETT
Sbjct  323  GMPHHLRPFMKGRLYLHFTVEVPESGSLSLEQIKALETVLPPRPTRQMTDMELDECEETT  382

Query  251  LHDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            L+DVNI       +++Q       ++D      R QCAQQ
Sbjct  383  LYDVNI---DEEMRRKQVHAQEAYEEDEESSGPRTQCAQQ  419



>ref|XP_010089281.1| DnaJ-like protein [Morus notabilis]
 gb|EXB37606.1| DnaJ-like protein [Morus notabilis]
Length=419

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQN QKI F G+ADEAPDTITGDIVF+LQ +EHP+FKRK DDL+VEHTL+LTEALCGFQF
Sbjct  230  MQNNQKIVFEGQADEAPDTITGDIVFILQLKEHPRFKRKYDDLYVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             L HLD RQLLIKS PGE++KPDQ+KAINDEGMP +QRPFM+G+LYIHF V FP++  LS
Sbjct  290  ALNHLDGRQLLIKSNPGEIIKPDQYKAINDEGMPHHQRPFMKGRLYIHFNVVFPDAGVLS  349

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+QC+ LE +LPP+P+  +TDME+D+CEETTLHDVNI EE  R++QQQ  +   ++DD  
Sbjct  350  PDQCRTLEKILPPRPSKCLTDMEVDDCEETTLHDVNI-EEEMRRKQQQQYQEAYDEDDDE  408

Query  164  GGAQRVQCAQQ  132
                RVQCAQQ
Sbjct  409  SSMPRVQCAQQ  419



>ref|XP_010248011.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
 ref|XP_010248012.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
Length=417

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F GEADEAPDTITGDIVFVLQ +EHPKFKRK DDL+VEHTL+LTEALCGFQF
Sbjct  229  MQHGQKIVFRGEADEAPDTITGDIVFVLQLKEHPKFKRKFDDLYVEHTLSLTEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGEV+KP Q+KAINDEGMP +QRPFM+G+LYI F+VDFP++  LS
Sbjct  289  ALTHLDGRQLLIKSNPGEVIKPGQYKAINDEGMPHHQRPFMKGRLYIEFSVDFPDTGVLS  348

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            P+QC+ LE +LPP+ ++ +++MELDECEETTLHDVNI
Sbjct  349  PDQCRTLETILPPRTSSHLSEMELDECEETTLHDVNI  385



>ref|XP_009622737.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
 ref|XP_009622738.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   256 bits (653),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ QKI F GEADEAPDTITGDIVFVLQQ++H KFKRK DDL++EHTL LTEALCGFQF
Sbjct  232  MQHNQKIVFEGEADEAPDTITGDIVFVLQQKDHSKFKRKFDDLYMEHTLTLTEALCGFQF  291

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD RQLLIKS PGEV+KPDQ+KAINDEGMP Y RPF++G+LYIHF VDFPES  LS
Sbjct  292  VLTHLDGRQLLIKSNPGEVIKPDQYKAINDEGMPSYGRPFIKGRLYIHFNVDFPESGVLS  351

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            PE C+G+  +LP +P  G ++MELD+CEETT+H+VNI
Sbjct  352  PETCRGIGTILPARPGKGSSEMELDKCEETTMHNVNI  388



>ref|XP_008803820.1| PREDICTED: dnaJ protein homolog 2-like [Phoenix dactylifera]
Length=417

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ +KI F GEADEAPDT+TGDI+F+LQQ+EHPKFKRK DDLFVEHTL+LTEALCGFQF
Sbjct  230  MQHSEKIVFQGEADEAPDTVTGDIIFILQQKEHPKFKRKYDDLFVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGEVVKP QFKAINDEGMP + RPFM+G+LYI F V+FP+S  LS
Sbjct  290  ALTHLDGRQLLIKSNPGEVVKPGQFKAINDEGMPHHGRPFMKGRLYIQFNVEFPDSGALS  349

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+QC  LE +LPP+P+  + DMELDECEETTL+DVN+EEE RRKQQQQ Q+AYDED+D  
Sbjct  350  PDQCHALETLLPPRPSNHLLDMELDECEETTLYDVNMEEETRRKQQQQQQDAYDEDED--  407

Query  164  GGAQRVQCAQQ  132
              A RVQCAQQ
Sbjct  408  -AAPRVQCAQQ  417



>ref|XP_010933633.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Elaeis guineensis]
Length=416

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ  QKI F GEADEAPDT+TGDIVFV+QQ+EHPKFKRK DDL+VEHTL+L+EALCGFQF
Sbjct  229  MQQSQKIVFQGEADEAPDTVTGDIVFVVQQKEHPKFKRKYDDLYVEHTLSLSEALCGFQF  288

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGEVVKP QFKAINDEGMP + RPFMRG+LYI F V+FP+S  LS
Sbjct  289  ALTHLDGRQLLIKSNPGEVVKPGQFKAINDEGMPHHGRPFMRGRLYIQFNVEFPDSGVLS  348

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            P+QC+ LE  LPP+P+  ++DMELDECEETTL+DVNI
Sbjct  349  PDQCRMLETFLPPRPSNRLSDMELDECEETTLYDVNI  385



>gb|AGR45906.1| DnaJ protein 2-like protein [Triticum aestivum]
Length=421

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F GEADEAPDT+TGDIVFVLQ +EHPKFKRK DDLFVEHT++LTEALCGFQF
Sbjct  230  MQHGQKIVFQGEADEAPDTVTGDIVFVLQLKEHPKFKRKSDDLFVEHTISLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD RQLLIKS PGE++KP Q KAINDEGMP + RPFM+G+L++ F+V+FPE   L+
Sbjct  290  VLTHLDGRQLLIKSNPGEIIKPGQHKAINDEGMPQHGRPFMKGRLFVEFSVEFPEPGVLT  349

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P QCK LE +LPP+P +  +DM++D+CEETT+HDVNIEEEMRR+Q Q+ QEAYDE+DD  
Sbjct  350  PSQCKSLEKILPPRPGSQSSDMDVDQCEETTMHDVNIEEEMRRRQHQRRQEAYDEEDDDE  409

Query  164  GGAQR-VQCAQQ  132
            GGA R VQCAQQ
Sbjct  410  GGAPRGVQCAQQ  421



>ref|XP_010933632.1| PREDICTED: dnaJ protein homolog isoform X1 [Elaeis guineensis]
Length=421

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ  QKI F GEADEAPDT+TGDIVFV+QQ+EHPKFKRK DDL+VEHTL+L+EALCGFQF
Sbjct  234  MQQSQKIVFQGEADEAPDTVTGDIVFVVQQKEHPKFKRKYDDLYVEHTLSLSEALCGFQF  293

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGEVVKP QFKAINDEGMP + RPFMRG+LYI F V+FP+S  LS
Sbjct  294  ALTHLDGRQLLIKSNPGEVVKPGQFKAINDEGMPHHGRPFMRGRLYIQFNVEFPDSGVLS  353

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            P+QC+ LE  LPP+P+  ++DMELDECEETTL+DVNI
Sbjct  354  PDQCRMLETFLPPRPSNRLSDMELDECEETTLYDVNI  390



>ref|XP_006445374.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006445375.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|ESR58614.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|ESR58615.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
Length=337

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F G+ADEAPDTITGDIVF+LQ +EHPKFKRK DDL+V+HTL+LTEALCGFQF
Sbjct  149  MQHGQKIAFEGQADEAPDTITGDIVFILQLKEHPKFKRKFDDLYVDHTLSLTEALCGFQF  208

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGE++KP Q+KAINDEGMP +QRPFM+G+LYI F V+FPE   LS
Sbjct  209  ALTHLDGRQLLIKSNPGEIIKPGQYKAINDEGMPHHQRPFMKGRLYIQFNVEFPECGILS  268

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            P+QC+ LE+VLPP+P   ++DMELD+CEE T+HDVNI
Sbjct  269  PDQCRTLESVLPPRPGKNLSDMELDDCEEVTMHDVNI  305



>ref|XP_010919645.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
 ref|XP_010919646.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+ +KI F GEADEAPDT+TGDI+F+LQQ+EHPKFKRK DDLFVEHTL LTEALCGFQF
Sbjct  230  MQHSEKIVFQGEADEAPDTVTGDIIFMLQQKEHPKFKRKYDDLFVEHTLCLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGEV+KP QFKAINDEGMP + RPFM+G+LYI F V+FP+S  LS
Sbjct  290  ALTHLDGRQLLIKSNPGEVIKPGQFKAINDEGMPHHGRPFMKGRLYIQFNVEFPDSGALS  349

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+QC  LE +LPP+P+  ++DMELDECEETTL+DVN+EEEMRRKQQQQ QEAYDED+D  
Sbjct  350  PDQCHVLETLLPPRPSNHLSDMELDECEETTLYDVNMEEEMRRKQQQQPQEAYDEDED--  407

Query  164  GGAQRVQCAQQ  132
              A RVQCAQQ
Sbjct  408  -AAPRVQCAQQ  417



>ref|XP_007052233.1| DNAJ [Theobroma cacao]
 gb|EOX96390.1| DNAJ [Theobroma cacao]
Length=421

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQNGQKITF G+ADEAPDTITGDIVF+LQ ++HPKF+RK DDL+VEH L+LTEALCG+QF
Sbjct  230  MQNGQKITFEGQADEAPDTITGDIVFLLQLKKHPKFERKFDDLYVEHNLSLTEALCGYQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGEV+KP Q+KAINDEGMP +QRPFM+G+L+IHF VDFPES   S
Sbjct  290  ALTHLDGRQLLIKSNPGEVIKPGQYKAINDEGMPHHQRPFMKGRLFIHFNVDFPESGVFS  349

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            PEQC+ LE +LP + +  +TDME+D+CEETTLHDVNI
Sbjct  350  PEQCRTLETILPMRSSKHLTDMEVDDCEETTLHDVNI  386



>ref|XP_009382439.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=423

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F GEADEAPDT+TGDIVFVLQ +EHPKFKRK DDL+V+ TL+LTEALCGFQF
Sbjct  236  MQHGQKIVFAGEADEAPDTVTGDIVFVLQHKEHPKFKRKYDDLYVDRTLSLTEALCGFQF  295

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD RQLLIKS PGEV+KP Q+KAI+DEGMP + RPFM+G+LYI F V+FPE+   S
Sbjct  296  VLTHLDGRQLLIKSSPGEVIKPGQYKAIDDEGMPHHGRPFMKGRLYIQFNVEFPETGVFS  355

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+QC+ LE +LPP+P+  I++MELDECEETT++DVNIEEEMRR++ Q+ QEAYDED+D  
Sbjct  356  PDQCRSLEKILPPRPSNHISNMELDECEETTMYDVNIEEEMRRQRLQRQQEAYDEDED--  413

Query  164  GGAQRVQCAQQ  132
              A RVQCAQQ
Sbjct  414  -AAPRVQCAQQ  423



>ref|XP_002275918.1| PREDICTED: dnaJ protein homolog 2 [Vitis vinifera]
Length=419

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 166/191 (87%), Gaps = 3/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+G++I F GEAD+APDTITGDIVFVLQ ++H KFKRK DDL+VEHTL+LTEALCGFQF
Sbjct  230  MQHGERIVFQGEADQAPDTITGDIVFVLQLKDHAKFKRKYDDLYVEHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGE++KPDQ+KAINDEGMP +QRPFM+GKLYIHF V+FPES  LS
Sbjct  290  ALTHLDGRQLLIKSNPGEIIKPDQYKAINDEGMPHHQRPFMKGKLYIHFDVEFPESGILS  349

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+QCK LE++LP K +  I+ ME+DE EETTL+DVNIEEEMRRKQQQQ  EAYDEDDD  
Sbjct  350  PDQCKALESILPQKRSKQISAMEVDEAEETTLYDVNIEEEMRRKQQQQQHEAYDEDDDDF  409

Query  164  GGAQRVQCAQQ  132
             GA RVQCAQQ
Sbjct  410  -GAPRVQCAQQ  419



>ref|XP_006445376.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006464459.1| PREDICTED: dnaJ protein homolog 2-like [Citrus sinensis]
 gb|ESR58616.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|KDO85581.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
 gb|KDO85582.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=418

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 164/191 (86%), Gaps = 4/191 (2%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F G+ADEAPDTITGDIVF+LQ +EHPKFKRK DDL+V+HTL+LTEALCGFQF
Sbjct  230  MQHGQKIAFEGQADEAPDTITGDIVFILQLKEHPKFKRKFDDLYVDHTLSLTEALCGFQF  289

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD RQLLIKS PGE++KP Q+KAINDEGMP +QRPFM+G+LYI F V+FPE   LS
Sbjct  290  ALTHLDGRQLLIKSNPGEIIKPGQYKAINDEGMPHHQRPFMKGRLYIQFNVEFPECGILS  349

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+QC+ LE+VLPP+P   ++DMELD+CEE T+HDVNI+EEMRRK+ QQ QEAYDEDD+  
Sbjct  350  PDQCRTLESVLPPRPGKNLSDMELDDCEEVTMHDVNIDEEMRRKRYQQQQEAYDEDDEP-  408

Query  164  GGAQRVQCAQQ  132
                RVQCAQQ
Sbjct  409  -AMPRVQCAQQ  418



>ref|XP_003570021.1| PREDICTED: dnaJ protein homolog 2-like [Brachypodium distachyon]
Length=423

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F GEADEAPDT+TGDIVFVLQ +EHPKFKRK DDL+VEHT++LTEALCGFQF
Sbjct  233  MQHGQKIVFQGEADEAPDTVTGDIVFVLQLKEHPKFKRKSDDLYVEHTISLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD RQLLIKS PGEVVKP Q KAINDEGMP + RPFM+G+L++ F V+FPE   LS
Sbjct  293  VLTHLDGRQLLIKSNPGEVVKPGQHKAINDEGMPQHGRPFMKGRLFVEFGVEFPEPGVLS  352

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P QC+ LE +LPP+    ++DMELD+CEETT+HDVNIEEEMRR+Q Q+ QEAYDE+++  
Sbjct  353  PGQCRSLEKILPPRAGNQLSDMELDQCEETTMHDVNIEEEMRRRQHQRRQEAYDEEEEDD  412

Query  164  GGAQRVQCAQQ  132
            G  + VQCAQQ
Sbjct  413  GAPRGVQCAQQ  423



>ref|XP_009779099.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009779100.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=423

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F GEADEAPDTITGDI+F+LQQ++H KF+RK DDL+ EH L+LTEALCGFQF
Sbjct  233  MQHGQKIVFDGEADEAPDTITGDIIFILQQKDHSKFRRKSDDLYAEHNLSLTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD R LLIKS PGEV+KPDQ+KAINDEGMP Y RPF++G+LYIHF V+FPES  L+
Sbjct  293  VLTHLDGRLLLIKSSPGEVIKPDQYKAINDEGMPHYGRPFIKGRLYIHFNVEFPESGFLT  352

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            PE+C+ LE+VLPP+P    +DMEL+ CEETTLHDVN+
Sbjct  353  PEKCRILESVLPPRPGKRASDMELNNCEETTLHDVNM  389



>ref|XP_001755408.1| predicted protein [Physcomitrella patens]
 gb|EDQ79888.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 176/220 (80%), Gaps = 6/220 (3%)
 Frame = -1

Query  785  LMRKIGAGQCkgekvvqekkvlevlvekGMQNGQKITFPGEADEAPDTITGDIVFVLQQR  606
            +  K   GQCKG+KVVQ+KK+LEV VEKGM +GQKITF GEADEAPDT TGDIVFVLQ +
Sbjct  204  ISEKDKCGQCKGQKVVQDKKLLEVHVEKGMMHGQKITFQGEADEAPDTQTGDIVFVLQLK  263

Query  605  EHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDE  426
            EHPKFKRKGDDLFVEHTL+LTEALCGF+F L HLD RQLLIKS  GE++KP QFKAINDE
Sbjct  264  EHPKFKRKGDDLFVEHTLSLTEALCGFRFPLVHLDGRQLLIKSDAGEIIKPGQFKAINDE  323

Query  425  GMPMYQRPFMRGKLYIHFTVDFPES--LSPEQCKGLEAVLPPKPTTGITDMELDECEETT  252
            GMP YQRPFM+G+L++HF V+FPES  L+P+QCK LE +LPP+P+  +TDMELDECEETT
Sbjct  324  GMPHYQRPFMKGRLFLHFNVEFPESGGLTPDQCKALETILPPRPSQ-MTDMELDECEETT  382

Query  251  LHDVNIeeemrrkqqqqaqeaydedddMHGGAQRVQCAQQ  132
            L DVN        +++Q Q+    D+D      R+QCAQQ
Sbjct  383  LIDVNF---EDEMRRKQQQQQEAYDEDEESSGPRIQCAQQ  419



>ref|XP_010258833.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Nelumbo nucifera]
Length=332

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F GEADEAPDTITGDIVFVLQ +EH KFKRK DDL+VEHTL+LTEALCGFQF
Sbjct  144  MQHGQKIVFQGEADEAPDTITGDIVFVLQLKEHSKFKRKFDDLYVEHTLSLTEALCGFQF  203

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
             LTHLD+RQLLIKS PGEV+KP Q+KAINDEGMP +QRPFM+G+LYI F VDFP+S  LS
Sbjct  204  ALTHLDSRQLLIKSNPGEVIKPGQYKAINDEGMPHHQRPFMKGRLYIQFHVDFPDSAVLS  263

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            P++C+ LE +LPP+  + ++ M+LD+CEETTLHDVN+
Sbjct  264  PDECRTLETILPPRANSHLSGMDLDDCEETTLHDVNV  300



>emb|CDP09461.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            M++GQKI +PGEADEAPDT+TGDIVFVLQQ+EHPKFKRK DDL+VE +L+LTEALCGFQF
Sbjct  226  MKHGQKIVYPGEADEAPDTVTGDIVFVLQQKEHPKFKRKFDDLYVEQSLSLTEALCGFQF  285

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD RQLL+KS PGEVVKPDQ+KAINDEGMP YQRPFM+G+L+IHF V+FPES  L 
Sbjct  286  VLTHLDGRQLLVKSNPGEVVKPDQYKAINDEGMPHYQRPFMKGRLFIHFNVEFPESGALP  345

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
             E+C+ L+A+LP       +DM+LDECEETTLHDVNI
Sbjct  346  SEKCQVLKAMLPSGSLKQSSDMDLDECEETTLHDVNI  382



>ref|XP_008232370.1| PREDICTED: dnaJ protein homolog 2-like [Prunus mume]
Length=415

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            M++GQKI F G+ADEAPDTITGDIVFVLQ +EH KFKRK DDL+VEHTL LT ALCGFQF
Sbjct  225  MEHGQKIVFEGQADEAPDTITGDIVFVLQLKEHAKFKRKLDDLYVEHTLNLTAALCGFQF  284

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD RQLL+KS PGEV+KP Q KAINDEGMP YQRPFM+G L+IHF V+FP+S  LS
Sbjct  285  VLTHLDGRQLLVKSNPGEVIKPGQSKAINDEGMPHYQRPFMKGNLFIHFNVEFPDSGILS  344

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+Q + L+ VL PKP+  +TDMELDECEETT+HDVNIE+EMRRK +QQ +EAYDEDDD  
Sbjct  345  PDQSRNLQTVLSPKPSKRLTDMELDECEETTMHDVNIEDEMRRKPRQQYREAYDEDDDDD  404

Query  164  GGAQRVQCAQQ  132
                RVQCAQQ
Sbjct  405  EPMPRVQCAQQ  415



>ref|XP_007220469.1| hypothetical protein PRUPE_ppa006364mg [Prunus persica]
 gb|EMJ21668.1| hypothetical protein PRUPE_ppa006364mg [Prunus persica]
Length=415

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            M++GQKI F G+ADEAPDTITGDIVF+LQ +EH KFKRK DDL+VEHTL LTEALCGFQF
Sbjct  225  MEHGQKIVFEGQADEAPDTITGDIVFILQLKEHAKFKRKLDDLYVEHTLNLTEALCGFQF  284

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD RQLL+KS PGEV+KP Q KAINDEGMP YQRPFM+G L+IHF V+FP+S  LS
Sbjct  285  VLTHLDGRQLLVKSNPGEVIKPGQSKAINDEGMPHYQRPFMKGNLFIHFNVEFPDSGILS  344

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNIeeemrrkqqqqaqeaydedddMH  165
            P+Q + L+ VL PKP+  +TD+ELDECEETT+HDVNIE+EMRRK +QQ +EAYDEDDD  
Sbjct  345  PDQSRNLQTVLSPKPSKHLTDVELDECEETTMHDVNIEDEMRRKPRQQYREAYDEDDDDD  404

Query  164  GGAQRVQCAQQ  132
                RVQCAQQ
Sbjct  405  EPMPRVQCAQQ  415



>gb|AGY48888.1| MIP1L1 [Nicotiana benthamiana]
Length=423

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  698  MQNGQKITFPGEADEAPDTITGDIVFVLQQREHPKFKRKGDDLFVEHTLALTEALCGFQF  519
            MQ+GQKI F GEADEAPDTITGDI+FVLQQ++H KF+RK DDL+VEH L LTEALCGFQF
Sbjct  233  MQHGQKIVFHGEADEAPDTITGDIIFVLQQKDHSKFRRKSDDLYVEHNLILTEALCGFQF  292

Query  518  ILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES--LS  345
            +LTHLD+RQ LIKS PGEV+KPDQ+KAINDEGMP Y RPF++G+LYIHF V+FPES  LS
Sbjct  293  VLTHLDSRQFLIKSSPGEVIKPDQYKAINDEGMPHYGRPFIKGRLYIHFNVEFPESGFLS  352

Query  344  PEQCKGLEAVLPPKPTTGITDMELDECEETTLHDVNI  234
            PE+C+ LE++LPP+     +DMELDECE TTLHDVN+
Sbjct  353  PEKCRILESILPPRLGKHSSDMELDECELTTLHDVNM  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360