BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004D24

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009362958.1|  PREDICTED: uncharacterized protein LOC103952976  97.4    1e-20   
ref|XP_008374404.1|  PREDICTED: TSC22 domain family protein 1-like    95.9    4e-19   
ref|XP_007210458.1|  hypothetical protein PRUPE_ppa005168m2g          89.7    3e-18   
ref|XP_008393001.1|  PREDICTED: putative uncharacterized protein ...  93.2    3e-18   
ref|XP_008239574.1|  PREDICTED: CREB-regulated transcription coac...  91.3    4e-18   
ref|XP_004252212.1|  PREDICTED: extensin-like                         91.3    1e-17   Solanum lycopersicum
ref|XP_010102503.1|  hypothetical protein L484_014559                 91.7    2e-17   
ref|XP_011464066.1|  PREDICTED: formin-like protein 3 isoform X2      90.9    2e-17   Fragaria vesca subsp. vesca
ref|XP_011097415.1|  PREDICTED: protein enabled-like                  90.9    2e-17   Sesamum indicum [beniseed]
ref|XP_004299014.1|  PREDICTED: formin-like protein 3 isoform X1      90.9    2e-17   Fragaria vesca subsp. vesca
ref|XP_009766181.1|  PREDICTED: programmed cell death 6-interacti...  90.5    3e-17   Nicotiana sylvestris
ref|XP_011467000.1|  PREDICTED: LOW QUALITY PROTEIN: adhesive pla...  85.5    2e-16   Fragaria vesca subsp. vesca
ref|XP_004298978.1|  PREDICTED: uncharacterized protein LOC101312152  88.2    2e-16   Fragaria vesca subsp. vesca
ref|XP_002318061.2|  hypothetical protein POPTR_0012s08510g           87.4    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010663116.1|  PREDICTED: vegetative cell wall protein gp1-...  86.7    4e-16   Vitis vinifera
ref|XP_010663115.1|  PREDICTED: proline-rich receptor-like protei...  86.7    6e-16   Vitis vinifera
gb|KJB40752.1|  hypothetical protein B456_007G076000                  85.5    1e-15   Gossypium raimondii
ref|XP_006374537.1|  hypothetical protein POPTR_0015s09340g           84.3    1e-15   
gb|KJB40753.1|  hypothetical protein B456_007G076000                  85.5    1e-15   Gossypium raimondii
gb|KJB40754.1|  hypothetical protein B456_007G076000                  85.5    2e-15   Gossypium raimondii
emb|CAJ44247.1|  hypothetical protein                                 79.0    5e-15   Cocos nucifera
ref|XP_011016820.1|  PREDICTED: arginine-glutamic acid dipeptide ...  81.6    6e-15   Populus euphratica
ref|XP_011098435.1|  PREDICTED: protein diaphanous homolog 1-like     82.4    2e-14   Sesamum indicum [beniseed]
ref|XP_011046206.1|  PREDICTED: uncharacterized protein LOC105140870  81.3    3e-14   Populus euphratica
gb|KDP45326.1|  hypothetical protein JCGZ_09575                       80.5    7e-14   Jatropha curcas
ref|XP_009613823.1|  PREDICTED: putative uncharacterized protein ...  79.7    8e-14   Nicotiana tomentosiformis
ref|XP_009613822.1|  PREDICTED: SH3 domain-containing protein C23...  80.1    1e-13   Nicotiana tomentosiformis
ref|XP_011047825.1|  PREDICTED: altered inheritance of mitochondr...  79.7    1e-13   Populus euphratica
ref|XP_011047827.1|  PREDICTED: arginine-glutamic acid dipeptide ...  79.7    1e-13   Populus euphratica
emb|CAN60421.1|  hypothetical protein VITISV_021069                   79.7    1e-13   Vitis vinifera
ref|XP_007036361.1|  Apoptosis-stimulating of p53 protein 1, puta...  79.3    1e-13   
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      79.3    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006833453.1|  hypothetical protein AMTR_s00082p00053170        79.7    1e-13   
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  79.3    1e-13   
ref|XP_007031556.1|  Uncharacterized protein TCM_016944               79.0    2e-13   
ref|XP_004232320.1|  PREDICTED: pollen-specific leucine-rich repe...  79.0    2e-13   Solanum lycopersicum
gb|KDO69525.1|  hypothetical protein CISIN_1g009789mg                 78.6    2e-13   Citrus sinensis [apfelsine]
ref|XP_002300038.2|  hypothetical protein POPTR_0001s34990g           77.4    2e-13   
ref|XP_002275607.1|  PREDICTED: protein enabled                       79.0    2e-13   Vitis vinifera
ref|XP_006338590.1|  PREDICTED: AT-rich interactive domain-contai...  79.0    2e-13   Solanum tuberosum [potatoes]
emb|CBI34879.3|  unnamed protein product                              78.2    3e-13   Vitis vinifera
ref|XP_006439889.1|  hypothetical protein CICLE_v10019708mg           78.6    3e-13   Citrus clementina [clementine]
gb|KDO69523.1|  hypothetical protein CISIN_1g009789mg                 78.6    3e-13   Citrus sinensis [apfelsine]
gb|KDO69524.1|  hypothetical protein CISIN_1g009789mg                 78.6    3e-13   Citrus sinensis [apfelsine]
ref|XP_006476848.1|  PREDICTED: AT-rich interactive domain-contai...  78.6    3e-13   Citrus sinensis [apfelsine]
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...  78.6    3e-13   Phoenix dactylifera
gb|KHG02060.1|  Myosin-2                                              78.6    3e-13   Gossypium arboreum [tree cotton]
ref|XP_010248593.1|  PREDICTED: pollen-specific leucine-rich repe...  78.2    4e-13   Nelumbo nucifera [Indian lotus]
gb|KJB75894.1|  hypothetical protein B456_012G063600                  78.2    4e-13   Gossypium raimondii
ref|XP_010037529.1|  PREDICTED: vegetative cell wall protein gp1-...  77.8    5e-13   Eucalyptus grandis [rose gum]
ref|XP_010551915.1|  PREDICTED: actin cytoskeleton-regulatory com...  77.8    6e-13   Tarenaya hassleriana [spider flower]
gb|KHG20812.1|  Actin cytoskeleton-regulatory complex PAN1            77.0    9e-13   Gossypium arboreum [tree cotton]
gb|KFK37621.1|  hypothetical protein AALP_AA3G007100                  76.6    1e-12   Arabis alpina [alpine rockcress]
ref|XP_002440684.1|  hypothetical protein SORBIDRAFT_09g005090        76.6    1e-12   
ref|XP_002524656.1|  DNA binding protein, putative                    75.9    2e-12   Ricinus communis
ref|XP_006341319.1|  PREDICTED: trithorax group protein osa-like      75.9    2e-12   Solanum tuberosum [potatoes]
ref|XP_011047322.1|  PREDICTED: vacuolar protein sorting-associat...  75.1    4e-12   Populus euphratica
ref|XP_009611188.1|  PREDICTED: transcriptional regulator DEF1 is...  75.1    4e-12   Nicotiana tomentosiformis
ref|XP_010694912.1|  PREDICTED: putative uncharacterized protein ...  75.1    4e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009611187.1|  PREDICTED: transcriptional regulator DEF1 is...  74.7    5e-12   Nicotiana tomentosiformis
ref|XP_010108811.1|  hypothetical protein L484_020546                 74.7    5e-12   Morus notabilis
ref|XP_010230500.1|  PREDICTED: uncharacterized protein LOC100838076  75.1    6e-12   Brachypodium distachyon [annual false brome]
ref|XP_010496293.1|  PREDICTED: proline-rich receptor-like protei...  73.9    7e-12   
ref|XP_009403230.1|  PREDICTED: pollen-specific leucine-rich repe...  73.9    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS67668.1|  hypothetical protein TRIUR3_30524                     73.9    8e-12   Triticum urartu
ref|XP_010435634.1|  PREDICTED: proline-rich receptor-like protei...  73.9    9e-12   Camelina sativa [gold-of-pleasure]
emb|CDM81418.1|  unnamed protein product                              73.9    9e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002884275.1|  hypothetical protein ARALYDRAFT_477359           73.6    1e-11   
ref|XP_008801957.1|  PREDICTED: LOW QUALITY PROTEIN: atherin-like     72.4    1e-11   
ref|XP_006408524.1|  hypothetical protein EUTSA_v10020517mg           73.2    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_001784568.1|  predicted protein                                72.8    1e-11   
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     73.2    2e-11   Elaeis guineensis
dbj|BAK07367.1|  predicted protein                                    73.2    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001758183.1|  predicted protein                                72.0    3e-11   
ref|XP_001770189.1|  predicted protein                                71.6    4e-11   
ref|XP_009377181.1|  PREDICTED: protein transport protein SEC31-like  72.0    4e-11   Pyrus x bretschneideri [bai li]
ref|NP_186805.2|  uncharacterized protein                             71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAF01541.1|AC009325_11  unknown protein                            71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334114.1|  PREDICTED: arginine-glutamic acid dipeptide ...  71.6    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_004489226.1|  PREDICTED: vacuolar protein sorting-associat...  71.6    5e-11   Cicer arietinum [garbanzo]
gb|KEH24794.1|  DNA-binding protein, putative                         71.2    6e-11   Medicago truncatula
gb|ACN27117.1|  unknown                                               68.9    6e-11   Zea mays [maize]
ref|XP_004960805.1|  PREDICTED: protein diaphanous homolog 1-like     71.2    7e-11   
ref|XP_008230557.1|  PREDICTED: protein transport protein SEC31       70.5    1e-10   Prunus mume [ume]
ref|XP_007217219.1|  hypothetical protein PRUPE_ppa003425mg           70.5    1e-10   Prunus persica
ref|XP_008784980.1|  PREDICTED: uncharacterized protein LOC103703781  70.9    1e-10   Phoenix dactylifera
ref|XP_009782100.1|  PREDICTED: pollen-specific leucine-rich repe...  70.1    2e-10   Nicotiana sylvestris
ref|XP_008341426.1|  PREDICTED: YLP motif-containing protein 1-like   70.1    2e-10   
ref|XP_007222918.1|  hypothetical protein PRUPE_ppa003684mg           70.1    2e-10   Prunus persica
ref|XP_010908580.1|  PREDICTED: pollen-specific leucine-rich repe...  69.7    2e-10   Elaeis guineensis
ref|XP_010906083.1|  PREDICTED: protein transport protein SEC31       69.3    3e-10   Elaeis guineensis
ref|XP_006297454.1|  hypothetical protein CARUB_v10013474mg           69.3    3e-10   
gb|KDP31054.1|  hypothetical protein JCGZ_11430                       68.9    3e-10   Jatropha curcas
gb|EYU44780.1|  hypothetical protein MIMGU_mgv1a004985mg              68.9    3e-10   Erythranthe guttata [common monkey flower]
ref|XP_002511348.1|  conserved hypothetical protein                   68.9    4e-10   
gb|AAM96980.1|  putative protein                                      68.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379205.1|  PREDICTED: protein enabled                       68.2    7e-10   
ref|XP_002455112.1|  hypothetical protein SORBIDRAFT_03g004550        68.2    7e-10   
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...  67.8    8e-10   Oryza brachyantha
gb|AFW80147.1|  putative DUF1421 domain family protein                67.8    1e-09   
ref|XP_010492262.1|  PREDICTED: basic salivary proline-rich prote...  67.8    1e-09   Camelina sativa [gold-of-pleasure]
ref|NP_196958.2|  uncharacterized protein                             67.8    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87621.1|  putative protein                                     67.4    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147786.1|  LOC100281396                                     67.8    1e-09   
ref|NP_001140648.1|  uncharacterized protein LOC100272723             67.4    1e-09   Zea mays [maize]
ref|XP_002985569.1|  hypothetical protein SELMODRAFT_446314           67.0    1e-09   Selaginella moellendorffii
ref|XP_002987005.1|  hypothetical protein SELMODRAFT_425866           67.0    2e-09   Selaginella moellendorffii
ref|XP_010910342.1|  PREDICTED: pollen-specific leucine-rich repe...  66.6    2e-09   Elaeis guineensis
ref|XP_010910341.1|  PREDICTED: pollen-specific leucine-rich repe...  66.6    2e-09   Elaeis guineensis
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...  66.6    2e-09   Oryza brachyantha
ref|XP_004968338.1|  PREDICTED: class E vacuolar protein-sorting ...  66.6    2e-09   Setaria italica
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                66.2    3e-09   Citrus sinensis [apfelsine]
ref|NP_001042136.2|  Os01g0169900                                     66.2    3e-09   
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           66.2    3e-09   Citrus clementina [clementine]
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  66.2    3e-09   Citrus sinensis [apfelsine]
ref|XP_008365379.1|  PREDICTED: protein enabled-like                  66.2    3e-09   
ref|XP_010420094.1|  PREDICTED: protein transport protein sec31-like  65.9    4e-09   
ref|XP_006289230.1|  hypothetical protein CARUB_v10002686mg           65.9    4e-09   Capsella rubella
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                65.5    6e-09   Citrus sinensis [apfelsine]
emb|CDX85594.1|  BnaA02g02190D                                        65.1    6e-09   
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                65.5    6e-09   Citrus sinensis [apfelsine]
emb|CDX91045.1|  BnaC02g05520D                                        65.1    7e-09   
gb|ADE75761.1|  unknown                                               64.7    1e-08   Picea sitchensis
gb|KFK25694.1|  hypothetical protein AALP_AA8G147000                  64.7    1e-08   Arabis alpina [alpine rockcress]
ref|XP_009125985.1|  PREDICTED: WW domain-binding protein 11 isof...  64.3    1e-08   Brassica rapa
ref|XP_009125983.1|  PREDICTED: WW domain-binding protein 11 isof...  64.3    1e-08   Brassica rapa
ref|XP_010453577.1|  PREDICTED: basic salivary proline-rich prote...  63.2    3e-08   Camelina sativa [gold-of-pleasure]
ref|NP_001054762.2|  Os05g0169400                                     62.8    5e-08   
gb|EAY96697.1|  hypothetical protein OsI_18619                        62.4    6e-08   Oryza sativa Indica Group [Indian rice]
gb|KHN27460.1|  hypothetical protein glysoja_022169                   62.0    9e-08   Glycine soja [wild soybean]
ref|XP_003525675.1|  PREDICTED: arginine-glutamic acid dipeptide ...  61.6    9e-08   Glycine max [soybeans]
ref|XP_010033310.1|  PREDICTED: pollen-specific leucine-rich repe...  60.8    2e-07   Eucalyptus grandis [rose gum]
emb|CDP02078.1|  unnamed protein product                              60.1    4e-07   Coffea canephora [robusta coffee]
ref|XP_006603779.1|  PREDICTED: vacuolar protein sorting-associat...  59.7    4e-07   
gb|KCW54142.1|  hypothetical protein EUGRSUZ_I00119                   59.3    5e-07   Eucalyptus grandis [rose gum]
ref|XP_003554822.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    6e-07   Glycine max [soybeans]
ref|XP_007150938.1|  hypothetical protein PHAVU_004G007500g           58.9    8e-07   Phaseolus vulgaris [French bean]
gb|ACZ74657.1|  hypothetical protein                                  58.9    9e-07   Phaseolus vulgaris [French bean]
gb|AEW09170.1|  hypothetical protein CL4474Contig1_03                 53.1    2e-06   Pinus radiata
gb|AEW08657.1|  hypothetical protein CL1065Contig1_02                 53.5    4e-06   Pinus radiata
gb|AFG58096.1|  hypothetical protein CL1065Contig1_02                 53.1    4e-06   Pinus taeda
gb|EMT01630.1|  hypothetical protein F775_09697                       56.2    7e-06   
ref|XP_003568842.1|  PREDICTED: zyxin-like                            54.7    2e-05   Brachypodium distachyon [annual false brome]
dbj|BAK01901.1|  predicted protein                                    53.9    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS54596.1|  Tryptophan aminotransferase 1                         53.1    7e-05   Triticum urartu
ref|XP_011400494.1|  hypothetical protein F751_5373                   50.8    3e-04   Auxenochlorella protothecoides
ref|XP_002508487.1|  predicted protein                                50.1    7e-04   Micromonas commoda



>ref|XP_009362958.1| PREDICTED: uncharacterized protein LOC103952976 [Pyrus x bretschneideri]
Length=246

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 86/149 (58%), Gaps = 13/149 (9%)
 Frame = -2

Query  592  FTNQVKPTHHPSGS-QYSEFSDSTNKPYGFGNYNDTSPFS---------TMKTSEFSSPW  443
            +   ++ TH P+ S QY EFS    +P     ++D    S          MK S+   P 
Sbjct  90   YAGSIQYTHDPTTSNQYPEFSPGNMQPVQHSYFDDFRSHSGSQSYNSGPNMKHSQVL-PA  148

Query  442  ALDRENQNTQYSHAHKILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRR  263
            + DR   ++        +LPHA+P A+ V   E S+ GTGN  P D +V++KV  MGFRR
Sbjct  149  SFDRSGGSSFLKLPTAKVLPHAIPMAASV-DKESSSSGTGNRIPID-NVIDKVVAMGFRR  206

Query  262  DLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            D+V+ATV+K+ +NGQSVD+N VLDKLMNN
Sbjct  207  DMVRATVRKMTENGQSVDVNLVLDKLMNN  235



>ref|XP_008374404.1| PREDICTED: TSC22 domain family protein 1-like [Malus domestica]
Length=529

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  472  MKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASFVASTEPSTGGTGNTAPNDEDVV  293
            MK S+ S P +LDR   ++        +LPHA+P A+ V   E S+ GTGN  P D +V+
Sbjct  423  MKHSQVS-PASLDRSGGSSFSKLPTAKVLPHAIPMAASV-DKESSSSGTGNRIPID-NVI  479

Query  292  EKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            +KV  MGFRRD+V+ATV+K+ +NGQSVD+N VLDKLMNN
Sbjct  480  DKVVAMGFRRDMVRATVRKMTENGQSVDVNVVLDKLMNN  518



>ref|XP_007210458.1| hypothetical protein PRUPE_ppa005168m2g, partial [Prunus persica]
 gb|EMJ11657.1| hypothetical protein PRUPE_ppa005168m2g, partial [Prunus persica]
Length=203

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = -2

Query  448  PWALDRENQNTQYSHAHKILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGF  269
            P +LDR   ++        +LP+A+P AS +   E S+G TGN  P D +V+++V  MGF
Sbjct  103  PASLDRSGGSSISRLPTAQVLPYAIPMASSM-DKESSSGVTGNRIPID-NVIDEVVTMGF  160

Query  268  RRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            RRD+V+ATVKK+ +NGQSVD+N VLDKLMNN
Sbjct  161  RRDIVRATVKKMTENGQSVDINVVLDKLMNN  191



>ref|XP_008393001.1| PREDICTED: putative uncharacterized protein DDB_G0291608 [Malus 
domestica]
Length=525

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 84/149 (56%), Gaps = 13/149 (9%)
 Frame = -2

Query  592  FTNQVKPTHHPSGS-QYSEFSDSTNKPYGFGNYNDTSPFS---------TMKTSEFSSPW  443
            +   ++ TH  + S QY EFS    +P     ++D    S          MK S+   P 
Sbjct  369  YAGSIQYTHDQTASNQYPEFSPGHMQPVQHSYFDDFRSHSGSQSHNSSPNMKHSQVL-PA  427

Query  442  ALDRENQNTQYSHAHKILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRR  263
            +LDR   +         +LPHA+P A+ V   E S+ GTGN  P D +V++KV  MGFRR
Sbjct  428  SLDRSGGSXFSKLPTAKVLPHAIPMAASV-DKESSSSGTGNRIPID-NVIDKVVAMGFRR  485

Query  262  DLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            D+V+ATV+K+ +NGQSVD+N VLDKLM N
Sbjct  486  DMVRATVRKMTENGQSVDVNLVLDKLMXN  514



>ref|XP_008239574.1| PREDICTED: CREB-regulated transcription coactivator 1-like, partial 
[Prunus mume]
Length=371

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = -2

Query  448  PWALDRENQNTQYSHAHKILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGF  269
            P +LDR   ++        +LP+A+P AS +   E S+G TGN  P D +VV++V  MGF
Sbjct  271  PASLDRSGGSSISRLPTAQVLPYAIPMASSM-DKESSSGATGNRIPID-NVVDEVVTMGF  328

Query  268  RRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            RRD+V+ATVKK+ +NGQSVD+N VLDKLMNN
Sbjct  329  RRDIVRATVKKMTENGQSVDINVVLDKLMNN  359



>ref|XP_004252212.1| PREDICTED: extensin-like [Solanum lycopersicum]
Length=504

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 94/185 (51%), Gaps = 22/185 (12%)
 Frame = -2

Query  694  PEERTYTPHSYNPTITESPF-KYP--GGQFAQHPYSDFTNQVKPTHHPSGSQYSEFSDST  524
            PEER +      P    S F  +P  G   + H Y+   N  +P   PS  Q S FS + 
Sbjct  327  PEERHFIASQTYPQANTSQFPSHPSSGAPVSHHFYAAPANLFEP---PSSRQGSGFSSAY  383

Query  523  NKPYGFG----------NYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHAL  374
                G G           Y   SPF   K+ + +SP  + +   N         +LP AL
Sbjct  384  GPSTGPGESYPYSGSTVQYGSGSPF---KSQQLASPL-MGQSGGNGYPQLPTTRILPQAL  439

Query  373  PTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVL  194
            PTA F  S+  S+  TGN  P D DVV+KVT MGF RD V+ATV++L +NGQSVDLN VL
Sbjct  440  PTA-FAVSSGSSSPRTGNRVPID-DVVDKVTNMGFPRDQVRATVQRLTENGQSVDLNVVL  497

Query  193  DKLMN  179
            DKLMN
Sbjct  498  DKLMN  502



>ref|XP_010102503.1| hypothetical protein L484_014559 [Morus notabilis]
 gb|EXB93567.1| hypothetical protein L484_014559 [Morus notabilis]
Length=613

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 81/134 (60%), Gaps = 15/134 (11%)
 Frame = -2

Query  571  THHPSGSQYSEFSDSTNKPYGFGNYNDTSPFST--MKTSEFS--SPWALDRENQNTQYSH  404
            T H   S++S F D      G+ +    S +S+  MK+SE    SP  L  EN+ TQ   
Sbjct  478  TEHVQPSRHSSFRD------GYSHSGLPSQYSSSKMKSSEVPPFSP-VLASENRFTQLPT  530

Query  403  AHKILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADN  224
            A   +LP ALP AS V S    + GTGN  P D DV++ +  MGFRRD+V+ATVKK+ +N
Sbjct  531  AQ--VLPRALPMASDVDSGS-CSNGTGNRIPVD-DVIDNIVAMGFRRDIVRATVKKMTEN  586

Query  223  GQSVDLNEVLDKLM  182
            GQSVDLN VLDKLM
Sbjct  587  GQSVDLNVVLDKLM  600



>ref|XP_011464066.1| PREDICTED: formin-like protein 3 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=550

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 98/181 (54%), Gaps = 15/181 (8%)
 Frame = -2

Query  691  EERTYTP-HSYNPTITESPFKYPGGQFAQHPYSDFTNQV--KPTHHPSGSQYSEFS--DS  527
            EE  Y P  +Y P++ + P + P G      Y + T+ V   P+  P+    S +     
Sbjct  364  EETPYAPSQTYPPSLRQPPSQTPTGLPPSQQYYNPTSNVYEPPSSRPNSGFSSGYGPPSG  423

Query  526  TNKPYGFG----NYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASF  359
             N+PY +G     Y  TS   +MK  + SS  +  +   +         +LPHA+PT S 
Sbjct  424  LNEPYHYGGSPSQYGGTS---SMKP-QLSSATSQSQSGGSGYPQLPTARVLPHAVPTPSG  479

Query  358  VASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            V S    + GTGN  P D DV+++VT MGF RD V+ATV+KL DNGQ+VDLN VLDKLMN
Sbjct  480  V-SDRSGSAGTGNKVPID-DVIDRVTSMGFPRDHVRATVRKLTDNGQAVDLNVVLDKLMN  537

Query  178  N  176
            +
Sbjct  538  D  538



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 91/185 (49%), Gaps = 25/185 (14%)
 Frame = -2

Query  694  PEERTYTPHSYNPTITESPFKYPGGQFAQHPYSDFTNQVKPTHH-PSGSQYSEFSDSTNK  518
            PEE  YTP +Y+P +  S   Y        P   F       +  PSG     +S S   
Sbjct  360  PEEAPYTPPNYSPPVRPS-SSYSPSAVPPLPSQQFYGPTPSVYEAPSGRPGPGYSGSFGP  418

Query  517  PYGFG----------NYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKI-LLPHALP  371
              G G          +Y D  P   ++ S  S       ++  + Y H     +LP ALP
Sbjct  419  TSGHGEPYTYSSPPPHYGDGPPMKPIQLSSQSL-----GQSGGSGYPHLPTARILPQALP  473

Query  370  TASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLD  191
            TAS       S GG+GN  P D DVV+KVT MGF RD V+ATV+KL +NGQSVDLN VLD
Sbjct  474  TASG------SAGGSGNRVPID-DVVDKVTNMGFPRDQVRATVRKLTENGQSVDLNIVLD  526

Query  190  KLMNN  176
            KLMN+
Sbjct  527  KLMND  531



>ref|XP_004299014.1| PREDICTED: formin-like protein 3 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=561

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 98/181 (54%), Gaps = 15/181 (8%)
 Frame = -2

Query  691  EERTYTP-HSYNPTITESPFKYPGGQFAQHPYSDFTNQV--KPTHHPSGSQYSEFS--DS  527
            EE  Y P  +Y P++ + P + P G      Y + T+ V   P+  P+    S +     
Sbjct  375  EETPYAPSQTYPPSLRQPPSQTPTGLPPSQQYYNPTSNVYEPPSSRPNSGFSSGYGPPSG  434

Query  526  TNKPYGFG----NYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASF  359
             N+PY +G     Y  TS   +MK  + SS  +  +   +         +LPHA+PT S 
Sbjct  435  LNEPYHYGGSPSQYGGTS---SMK-PQLSSATSQSQSGGSGYPQLPTARVLPHAVPTPSG  490

Query  358  VASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            V S    + GTGN  P D DV+++VT MGF RD V+ATV+KL DNGQ+VDLN VLDKLMN
Sbjct  491  V-SDRSGSAGTGNKVPID-DVIDRVTSMGFPRDHVRATVRKLTDNGQAVDLNVVLDKLMN  548

Query  178  N  176
            +
Sbjct  549  D  549



>ref|XP_009766181.1| PREDICTED: programmed cell death 6-interacting protein-like [Nicotiana 
sylvestris]
Length=549

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 85/153 (56%), Gaps = 21/153 (14%)
 Frame = -2

Query  601  YSDFTNQVKPTHHPSGSQYSEFSDSTNKPYGFG----------NYNDTSPFSTMKTSEFS  452
            Y+ ++N  +P   PSG Q S FS +     G G           Y   SPF   K+ + +
Sbjct  395  YAAYSNMFEP---PSGRQVSGFSGAHGSSTGPGESYPYSGSPVQYGSDSPF---KSQQLA  448

Query  451  SPWALDRENQNTQYSHAHKI-LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRM  275
            S  A+ +    + Y H     +LP ALPT S V S   S+  TG   P D DVV+KVT M
Sbjct  449  S-TAMGQSG-GSGYPHLPTARILPQALPTTSAVGSGS-SSPRTGTRVPID-DVVDKVTNM  504

Query  274  GFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            GF RD V+ATV++L +NGQSVDLN VLDKLMNN
Sbjct  505  GFSRDQVRATVRRLTENGQSVDLNVVLDKLMNN  537



>ref|XP_011467000.1| PREDICTED: LOW QUALITY PROTEIN: adhesive plaque matrix protein-like 
[Fragaria vesca subsp. vesca]
Length=246

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 95/181 (52%), Gaps = 15/181 (8%)
 Frame = -2

Query  691  EERTYTP-HSYNPTITESPFKYPGG-QFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNK  518
            EE  Y P  +Y P++ + P + P G   +Q  Y+  +N  +P   PS    S FS     
Sbjct  47   EETHYVPSQTYPPSLRQPPSQTPTGLPPSQQYYNPTSNVYEP---PSSRPNSGFSSGYGP  103

Query  517  PYGF-------GNYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASF  359
            P G        G+ +     S+MK  + SS  +  +   +         +LPH +PT S 
Sbjct  104  PSGLKEPYHYGGSPSQYGGTSSMKP-QLSSATSQSQSGGSGYPQLPTARVLPHVVPTPSG  162

Query  358  VASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            V S    + GTGN  P D DV ++VT MGF RD V+ATV+KL DNGQ+VDLN VLDKLMN
Sbjct  163  V-SDRSGSAGTGNKVPID-DVXDRVTSMGFPRDHVRATVQKLTDNGQAVDLNVVLDKLMN  220

Query  178  N  176
            +
Sbjct  221  D  221



>ref|XP_004298978.1| PREDICTED: uncharacterized protein LOC101312152 [Fragaria vesca 
subsp. vesca]
Length=522

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 7/78 (9%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPND------EDVVEKVTRMGFRRDLVKATVKKLA  230
            +LP+ALP A+ V   E   GGTGN  P D      ++V++KV  MGFRRD+V+ATV+K+ 
Sbjct  441  VLPYALPMAASV-DKESDAGGTGNRVPLDNVRIPVDNVIDKVVSMGFRRDVVRATVRKMT  499

Query  229  DNGQSVDLNEVLDKLMNN  176
            +NGQSVDLN VLDKLMN+
Sbjct  500  ENGQSVDLNVVLDKLMNS  517



>ref|XP_002318061.2| hypothetical protein POPTR_0012s08510g [Populus trichocarpa]
 gb|EEE96281.2| hypothetical protein POPTR_0012s08510g [Populus trichocarpa]
Length=514

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = -2

Query  514  YGFGNYNDTSPFSTMKTSE-FSSPWALDRENQNTQYSHAHKILLPHALPTASFV-ASTEP  341
            YG    N+ S  S++K S+   SP  L  E+   Q   A   LLP+A+P+AS V A +  
Sbjct  405  YGASPCNNGS--SSIKPSQPIPSPPVLAGESIYKQLPTAR--LLPNAIPSASNVDAGSGS  460

Query  340  STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
             +GG+GN  P D DVV+KV  MGFRRDLV+ATV+KL DNGQSVDLN VLDKLMN
Sbjct  461  GSGGSGNRIPVD-DVVDKVATMGFRRDLVRATVRKLTDNGQSVDLNTVLDKLMN  513



>ref|XP_010663116.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663117.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663118.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663119.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
Length=469

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 93/183 (51%), Gaps = 31/183 (17%)
 Frame = -2

Query  670  HSYNPTITESPFKYPGG-----QFAQ------------HPYSDFTNQVKPTHHPSGSQYS  542
             SY P+  + PF+ P       QF +             P S+F     PT + +   Y+
Sbjct  288  QSYPPSFHQPPFRPPSSVPSTQQFYKGSTLKMDEEPPSRPNSEF-----PTGYGTPPAYA  342

Query  541  EFSDSTNKPYGFGNYNDTSPFSTMKTSEFSSPWALDRENQN-TQYSHAHKILLPHALPTA  365
              SD     Y     N  S  STMK  +FS   ++     + TQ   A   +LPHALPTA
Sbjct  343  HLSDF----YARSGSNSYSNDSTMKPLQFSPLASVPSGGTSYTQLPTAQ--ILPHALPTA  396

Query  364  SFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKL  185
            S V         TGN   +D DVV+KV  MGFRRDLV+ATV+KL +NGQS DLN VLDKL
Sbjct  397  SSVGGGS-GPSVTGNRISSD-DVVDKVAAMGFRRDLVRATVRKLTENGQSADLNVVLDKL  454

Query  184  MNN  176
            MN+
Sbjct  455  MND  457



>ref|XP_010663115.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 isoform 
X1 [Vitis vinifera]
Length=524

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 93/183 (51%), Gaps = 31/183 (17%)
 Frame = -2

Query  670  HSYNPTITESPFKYPGG-----QFAQ------------HPYSDFTNQVKPTHHPSGSQYS  542
             SY P+  + PF+ P       QF +             P S+F     PT + +   Y+
Sbjct  343  QSYPPSFHQPPFRPPSSVPSTQQFYKGSTLKMDEEPPSRPNSEF-----PTGYGTPPAYA  397

Query  541  EFSDSTNKPYGFGNYNDTSPFSTMKTSEFSSPWALDRENQN-TQYSHAHKILLPHALPTA  365
              SD     Y     N  S  STMK  +FS   ++     + TQ   A   +LPHALPTA
Sbjct  398  HLSDF----YARSGSNSYSNDSTMKPLQFSPLASVPSGGTSYTQLPTAQ--ILPHALPTA  451

Query  364  SFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKL  185
            S V         TGN   +D DVV+KV  MGFRRDLV+ATV+KL +NGQS DLN VLDKL
Sbjct  452  SSVGGGS-GPSVTGNRISSD-DVVDKVAAMGFRRDLVRATVRKLTENGQSADLNVVLDKL  509

Query  184  MNN  176
            MN+
Sbjct  510  MND  512



>gb|KJB40752.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=519

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPT S     E +  G GN  P D DVV+KVT MGF RD V+ATV+KL +NGQSV
Sbjct  438  VLPHALPTVSG-GGGESAPSGPGNRVPID-DVVDKVTGMGFPRDHVRATVRKLTENGQSV  495

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  496  DLNVVLDKLMND  507



>ref|XP_006374537.1| hypothetical protein POPTR_0015s09340g [Populus trichocarpa]
 gb|ERP52334.1| hypothetical protein POPTR_0015s09340g [Populus trichocarpa]
Length=380

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = -2

Query  478  STMKTSE-FSSPWALDRENQNTQYSHAHKILLPHALPTASFV-ASTEPSTGGTGNTAPND  305
            S++K S+ F SP  L  E+  TQ   A   +LPHA+PTAS V A +   +GG+GN  P D
Sbjct  280  SSIKPSQPFPSPTVLGGESNYTQLPTAR--ILPHAIPTASNVDAGSGSGSGGSGNRRPVD  337

Query  304  EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
             DV++ V  MGF RDLV+ TV KL +NGQSVDLN VLDKLMN
Sbjct  338  -DVIDNVAAMGFHRDLVRETVIKLMENGQSVDLNAVLDKLMN  378



>gb|KJB40753.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=565

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPT S     E +  G GN  P D DVV+KVT MGF RD V+ATV+KL +NGQSV
Sbjct  484  VLPHALPTVSG-GGGESAPSGPGNRVPID-DVVDKVTGMGFPRDHVRATVRKLTENGQSV  541

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  542  DLNVVLDKLMND  553



>gb|KJB40754.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=566

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPT S     E +  G GN  P D DVV+KVT MGF RD V+ATV+KL +NGQSV
Sbjct  485  VLPHALPTVSG-GGGESAPSGPGNRVPID-DVVDKVTGMGFPRDHVRATVRKLTENGQSV  542

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  543  DLNVVLDKLMND  554



>emb|CAJ44247.1| hypothetical protein [Cocos nucifera]
Length=120

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 50/72 (69%), Gaps = 7/72 (10%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            LLP ALP  S       S+  TGN  P D DVV+KV  MGF RD V+ATV+KL +NGQSV
Sbjct  39   LLPQALPAES------SSSESTGNRMPID-DVVDKVVTMGFSRDQVRATVRKLTENGQSV  91

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  92   DLNVVLDKLMND  103



>ref|XP_011016820.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Populus euphratica]
Length=308

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 7/114 (6%)
 Frame = -2

Query  514  YGFGNYNDTSPFSTMKTSE-FSSPWALDRENQNTQYSHAHKILLPHALPTASFV-ASTEP  341
            YG    N+    S++K S+   SP  L  E+   Q   A   LLP+A+P+AS V A +  
Sbjct  199  YGASPCNNG--ISSIKPSQPIPSPPVLTGESIYKQLPTAR--LLPNAIPSASNVDAGSGS  254

Query  340  STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
             +GG+GN  P D D V++V  MGF RDLV+ATV+KL +NGQSVDLN VLDKLMN
Sbjct  255  GSGGSGNRIPVD-DFVDRVATMGFHRDLVRATVRKLMENGQSVDLNTVLDKLMN  307



>ref|XP_011098435.1| PREDICTED: protein diaphanous homolog 1-like [Sesamum indicum]
Length=564

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPTAS V     S GG+GN  P D DVV++VT MGF RD V+ATV+KL +NGQ+V
Sbjct  482  ILPQALPTASAVGGGSGSGGGSGNRVPID-DVVDRVTNMGFPRDQVRATVRKLTENGQAV  540

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  541  DLNVVLDKLMND  552



>ref|XP_011046206.1| PREDICTED: uncharacterized protein LOC105140870 [Populus euphratica]
Length=510

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 68/101 (67%), Gaps = 5/101 (5%)
 Frame = -2

Query  478  STMKTSE-FSSPWALDRENQNTQYSHAHKILLPHALPTASFV-ASTEPSTGGTGNTAPND  305
            S++K S+ F SP  L  E+  TQ   A   +LPHA+PTAS V A +   +GG+GN  P D
Sbjct  410  SSIKPSQPFPSPTVLGGESNYTQLPTAR--ILPHAIPTASNVDAGSGSGSGGSGNRRPVD  467

Query  304  EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLM  182
             DV++ V  MGF RDLV+ TV KL +NGQSVDLN VLDKLM
Sbjct  468  -DVIDNVAAMGFHRDLVRETVIKLMENGQSVDLNAVLDKLM  507



>gb|KDP45326.1| hypothetical protein JCGZ_09575 [Jatropha curcas]
Length=579

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPTAS V S    + GTGN  P D DVV+KVT MGF R+ V+ATV+KL +NGQ V
Sbjct  498  VLPHALPTASGVGSGS-GSSGTGNRVPID-DVVDKVTNMGFPREHVRATVRKLTENGQQV  555

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  556  DLNIVLDKLMND  567



>ref|XP_009613823.1| PREDICTED: putative uncharacterized protein FLJ22184 isoform 
X2 [Nicotiana tomentosiformis]
Length=461

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPTAS V S   S+  TG   P D DVV+KVT MGF RD V+ATV++L +NGQSV
Sbjct  380  ILPQALPTASVVGSGS-SSPRTGTRVPID-DVVDKVTNMGFSRDQVRATVRRLTENGQSV  437

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMNN
Sbjct  438  DLNVVLDKLMNN  449



>ref|XP_009613822.1| PREDICTED: SH3 domain-containing protein C23A1.17-like isoform 
X1 [Nicotiana tomentosiformis]
Length=552

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPTAS V S   S+  TG   P D DVV+KVT MGF RD V+ATV++L +NGQSV
Sbjct  471  ILPQALPTASVVGSGS-SSPRTGTRVPID-DVVDKVTNMGFSRDQVRATVRRLTENGQSV  528

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMNN
Sbjct  529  DLNVVLDKLMNN  540



>ref|XP_011047825.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
isoform X1 [Populus euphratica]
Length=511

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 5/114 (4%)
 Frame = -2

Query  514  YGFGNYNDTSPFSTMKTSE-FSSPWALDRENQNTQYSHAHKILLPHALPTASFV-ASTEP  341
            Y +G     +  S++K S+   SP  L  E+   Q   A   LLP+A+P+AS V A +  
Sbjct  400  YHYGASPCNNGISSIKPSQPIPSPPVLTGESIYKQLPTAR--LLPNAIPSASNVDAGSGS  457

Query  340  STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
             +GG+GN  P D D V++V  MGF RDLV+ATV+KL +NGQSVDLN VLDKLMN
Sbjct  458  GSGGSGNRIPVD-DFVDRVATMGFHRDLVRATVRKLMENGQSVDLNTVLDKLMN  510



>ref|XP_011047827.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
isoform X2 [Populus euphratica]
Length=486

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 5/114 (4%)
 Frame = -2

Query  514  YGFGNYNDTSPFSTMKTSE-FSSPWALDRENQNTQYSHAHKILLPHALPTASFV-ASTEP  341
            Y +G     +  S++K S+   SP  L  E+   Q   A   LLP+A+P+AS V A +  
Sbjct  375  YHYGASPCNNGISSIKPSQPIPSPPVLTGESIYKQLPTAR--LLPNAIPSASNVDAGSGS  432

Query  340  STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
             +GG+GN  P D D V++V  MGF RDLV+ATV+KL +NGQSVDLN VLDKLMN
Sbjct  433  GSGGSGNRIPVD-DFVDRVATMGFHRDLVRATVRKLMENGQSVDLNTVLDKLMN  485



>emb|CAN60421.1| hypothetical protein VITISV_021069 [Vitis vinifera]
Length=604

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 64/112 (57%), Gaps = 15/112 (13%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTG---NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNG  221
            +LPHALPTAS          G+    N  P D DVV+KVT MGF RD+V+ATV+KL +NG
Sbjct  467  VLPHALPTASGPVGGPGPGSGSSGSGNRVPID-DVVDKVTNMGFPRDVVRATVRKLTENG  525

Query  220  QSVDLNEVLDKLMNN*N-----------MYMGVWLSGMDLSILNQTSSVRSL  98
            QSVDLN VLDKLMN+             +Y    L G  L IL    SV SL
Sbjct  526  QSVDLNVVLDKLMNDGEVQPPRGDKLAAVYSPNGLVGAVLGILFTIKSVDSL  577



>ref|XP_007036361.1| Apoptosis-stimulating of p53 protein 1, putative [Theobroma cacao]
 gb|EOY20862.1| Apoptosis-stimulating of p53 protein 1, putative [Theobroma cacao]
Length=480

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 13/133 (10%)
 Frame = -2

Query  547  YSEFSDSTNKPYGFGNYNDTSPF---------STMKTSEFSSPWALDRENQNTQYSHAHK  395
            Y E     ++P    N N+  P+         S  K S+ S    +   N  ++   A  
Sbjct  349  YKELPSGYSQPQRIHNLNNQYPYGASSSGYNGSPTKPSQLSPSSVVGAGNSYSRLPTAK-  407

Query  394  ILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQS  215
             +LP+ALPTAS V S   S+          +DV++KV  MGFRRDLV+ATV+KL  NGQS
Sbjct  408  -ILPYALPTASSVDSGSNSSESGNRI--RVDDVIDKVVAMGFRRDLVRATVRKLTANGQS  464

Query  214  VDLNEVLDKLMNN  176
            VDLN VLDKLMN+
Sbjct  465  VDLNVVLDKLMNS  477



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 88/170 (52%), Gaps = 8/170 (5%)
 Frame = -2

Query  673  PHSYNPTITE-SPFKYPGGQFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNKPYGFGNY  497
            P SY P+I + +PF  P     Q  Y    N  +P      S    FS     P G G Y
Sbjct  361  PSSYAPSIRQPAPFPQPLTAPPQQFYGPMPNMYEPPASKPSSGLPPFSSGYRPPVGPG-Y  419

Query  496  NDTSPFSTM---KTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASFVASTEPSTGGT  326
            +D+  +S +   ++S  S P  +     +   S+  ++     LP A   A T  ++GG+
Sbjct  420  HDSYGYSGLPSGQSSSASKPLPIASSVSSGGTSNYPRLPTAQILPQA---APTSSASGGS  476

Query  325  GNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
              T    +DVVEKV  MGF RD V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  477  SGTRVAIDDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMND  526



>ref|XP_006833453.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
 gb|ERM98731.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
Length=695

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 4/72 (6%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPTAS   S    + G GN  P D DVV+KVT MGF RD V+ATV+KL +NGQSV
Sbjct  476  ILPHALPTASGGGSG---SSGGGNRVPID-DVVDKVTNMGFSRDQVRATVRKLTENGQSV  531

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  532  DLNVVLDKLMND  543



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 91/177 (51%), Gaps = 18/177 (10%)
 Frame = -2

Query  673  PHSYNPTITE-SPF-KYPGGQFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNKPYGFGN  500
            PHSY  +I + +PF + PGGQ   H Y    N  +P    +GS    FS       G  +
Sbjct  372  PHSYPSSIRQPAPFAQPPGGQPPNHYYGPNPNMYEPATSRAGSGQVPFSAGYGPQVGL-S  430

Query  499  YNDTSPFSTMKTSEFS-----SPWALDRENQNTQYSHAHKI----LLPHALPTASFVAST  347
            ++D+ P+    +   S     SP+A    +     S+  ++    +LP A+P     A +
Sbjct  431  FSDSYPYGGSPSHPSSSAMRPSPFASSAASSGGSSSYPPRLPTAQILPQAVP-----AGS  485

Query  346  EPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
                    N  P D DVVEKV  MGF RD V+ATV+KL ++GQSVDLN VLDKLMN+
Sbjct  486  SSGGSSAKNRLPID-DVVEKVATMGFSRDQVRATVRKLTESGQSVDLNVVLDKLMND  541



>ref|XP_007031556.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
 gb|EOY02482.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
Length=541

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 70/120 (58%), Gaps = 12/120 (10%)
 Frame = -2

Query  520  KPYGFG----NYNDTSPFSTMKTSEF-SSPWALDRENQNTQYSHAHKILLPHALPTASFV  356
            +PY +G     Y   SP   MK  +  SSP      +   Q   A   +LPHALPTAS V
Sbjct  417  EPYAYGGSPSQYGSGSP---MKMQQLPSSPMGQSGGSGYPQLPTAR--ILPHALPTASGV  471

Query  355  ASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
                    G GN  P D DV++KVT MGF RD V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  472  GGGS-GPSGPGNRVPVD-DVIDKVTSMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMND  529



>ref|XP_004232320.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Solanum lycopersicum]
Length=545

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 91/177 (51%), Gaps = 17/177 (10%)
 Frame = -2

Query  685  RTYTPHSYNPTITESPFKYPGGQFAQHPYSDFTNQVKPTHHPSGSQYSEF---SDSTNKP  515
            +TY P    P+I + P    G   +Q  Y    N  +P     G  YS     S     P
Sbjct  367  QTYPP----PSIRQPPHSSSGAPPSQQLYGTPPNIFEPPSSRPGPGYSGVYGPSSMPGDP  422

Query  514  YGF----GNYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASFVAST  347
            Y +    G Y   S   +MK  + S P      +   Q     +IL P ALPTAS V+  
Sbjct  423  YPYSSSPGQYGSGS---SMKPPQVSLPSMGQSGSSGYQQLPTARIL-PQALPTASAVSGG  478

Query  346  EPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
              S+ G+GN  P D DVV+KVT MGF RD V+ATV++L ++GQ+VDLN VLDKLMN+
Sbjct  479  S-SSPGSGNRVPID-DVVDKVTNMGFPRDQVRATVRRLTESGQTVDLNTVLDKLMND  533



>gb|KDO69525.1| hypothetical protein CISIN_1g009789mg [Citrus sinensis]
Length=421

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHA+P AS V S E ++ G+ N  P D+ V +  T MGFRRDLV+ATV+KL +NGQSV
Sbjct  351  ILPHAIPMASSVDS-ESASVGSANRVPVDDVVDKVAT-MGFRRDLVRATVRKLTENGQSV  408

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMNN
Sbjct  409  DLNVVLDKLMNN  420



>ref|XP_002300038.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
 gb|EEE84843.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
Length=337

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 96/179 (54%), Gaps = 13/179 (7%)
 Frame = -2

Query  694  PEERTYTPH-SYNPTITESPFKYPGGQFAQHPYSDFTNQVKP-THHPSG---SQYSEFSD  530
            PEE  + PH SY P++     + P G   Q  Y   +N  +P T  PS    + Y   S 
Sbjct  154  PEETPFIPHQSYPPSLRPLSTQPPSGAPPQPYYGSPSNMYEPPTSRPSSGFSAGYGPPSG  213

Query  529  STNKPYGFGNYNDTSPFS-TMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASFVA  353
            ST +PY +G        S TMK  +      + +   +         +LP ALPTAS + 
Sbjct  214  ST-EPYPYGGSPSQYGISPTMKQQQ----PVMSQSGGSGFPQLPTARILPQALPTASGIG  268

Query  352  STEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            S    + GTGN  P D DVV+KVT MGF R+ V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  269  SGP-GSSGTGNRVPLD-DVVDKVTSMGFPREHVEATVRKLTENGQSVDLNIVLDKLMND  325



>ref|XP_002275607.1| PREDICTED: protein enabled [Vitis vinifera]
Length=563

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTG---NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNG  221
            +LPHALPTAS          G+    N  P D DVV+KVT MGF RD+V+ATV+KL +NG
Sbjct  478  VLPHALPTASGPVGGSGPGSGSSGSGNRVPID-DVVDKVTNMGFPRDVVRATVRKLTENG  536

Query  220  QSVDLNEVLDKLMNN  176
            QSVDLN VLDKLMN+
Sbjct  537  QSVDLNVVLDKLMND  551



>ref|XP_006338590.1| PREDICTED: AT-rich interactive domain-containing protein 1A-like 
[Solanum tuberosum]
Length=549

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 92/177 (52%), Gaps = 17/177 (10%)
 Frame = -2

Query  685  RTYTPHSYNPTITESPFKYPGGQFAQHPYSDFTNQVKPTHHPSGSQYSEF---SDSTNKP  515
            +TY P    P+I + P    G   +Q  Y    N  +P     G  YS     S    +P
Sbjct  371  QTYPP----PSIRQPPHSSSGAPPSQQLYGTPPNIFEPPSSRPGLGYSGVYGPSSVPGEP  426

Query  514  YGF----GNYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASFVAST  347
            Y +    G Y   S   +MK  + S P      +   Q     +IL P ALPTAS V+  
Sbjct  427  YPYSSSPGQYGSGS---SMKPLQVSLPTMGQSGSSGYQQLPTARIL-PQALPTASAVSGG  482

Query  346  EPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
              S+ GTGN  P D DVV+KVT MGF RD V+ATV++L ++GQ+VDLN VLDKLMN+
Sbjct  483  S-SSPGTGNRVPID-DVVDKVTNMGFPRDQVRATVRRLTESGQTVDLNTVLDKLMND  537



>emb|CBI34879.3| unnamed protein product [Vitis vinifera]
Length=465

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTG---NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNG  221
            +LPHALPTAS          G+    N  P D DVV+KVT MGF RD+V+ATV+KL +NG
Sbjct  380  VLPHALPTASGPVGGSGPGSGSSGSGNRVPID-DVVDKVTNMGFPRDVVRATVRKLTENG  438

Query  220  QSVDLNEVLDKLMNN  176
            QSVDLN VLDKLMN+
Sbjct  439  QSVDLNVVLDKLMND  453



>ref|XP_006439889.1| hypothetical protein CICLE_v10019708mg [Citrus clementina]
 gb|ESR53129.1| hypothetical protein CICLE_v10019708mg [Citrus clementina]
Length=525

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHA+P AS V S E ++ G+ N  P D+ V +  T MGFRRDLV+ATV+KL +NGQSV
Sbjct  455  ILPHAIPMASSVDS-ESASVGSANRVPVDDVVDKVAT-MGFRRDLVRATVRKLTENGQSV  512

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMNN
Sbjct  513  DLNVVLDKLMNN  524



>gb|KDO69523.1| hypothetical protein CISIN_1g009789mg [Citrus sinensis]
Length=521

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHA+P AS V S E ++ G+ N  P D+ V +  T MGFRRDLV+ATV+KL +NGQSV
Sbjct  451  ILPHAIPMASSVDS-ESASVGSANRVPVDDVVDKVAT-MGFRRDLVRATVRKLTENGQSV  508

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMNN
Sbjct  509  DLNVVLDKLMNN  520



>gb|KDO69524.1| hypothetical protein CISIN_1g009789mg [Citrus sinensis]
Length=525

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHA+P AS V S E ++ G+ N  P D+ V +  T MGFRRDLV+ATV+KL +NGQSV
Sbjct  455  ILPHAIPMASSVDS-ESASVGSANRVPVDDVVDKVAT-MGFRRDLVRATVRKLTENGQSV  512

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMNN
Sbjct  513  DLNVVLDKLMNN  524



>ref|XP_006476848.1| PREDICTED: AT-rich interactive domain-containing protein 1A-like 
[Citrus sinensis]
Length=525

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHA+P AS V S E ++ G+ N  P D+ V +  T MGFRRDLV+ATV+KL +NGQSV
Sbjct  455  ILPHAIPMASSVDS-ESASVGSANRVPVDDVVDKVAT-MGFRRDLVRATVRKLTENGQSV  512

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMNN
Sbjct  513  DLNVVLDKLMNN  524



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 9/73 (12%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGT-GNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQS  215
            +LP ALP        E S+GGT GN  P D DVV+KV  MGF RD V+A V++L +NGQS
Sbjct  463  VLPQALPA-------ESSSGGTPGNRMPID-DVVDKVATMGFSRDQVRAAVRRLTENGQS  514

Query  214  VDLNEVLDKLMNN  176
            VDLN VLDKLMN+
Sbjct  515  VDLNVVLDKLMND  527



>gb|KHG02060.1| Myosin-2 [Gossypium arboreum]
Length=542

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 74/121 (61%), Gaps = 12/121 (10%)
 Frame = -2

Query  523  NKPYGFG----NYNDTSPFSTMKTSEF-SSPWALDRENQNTQYSHAHKILLPHALPTASF  359
            ++PY +G     Y   +P   MK  +  SSP   +  +   Q   A   +LPHALPTAS 
Sbjct  417  SEPYAYGGSPSQYGSGNP---MKMQQLPSSPMGQNSGSGYPQLPTAK--ILPHALPTASG  471

Query  358  VASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            V+    S  G GN  P D DV++KVT MGF RD V+ATV+KL +NGQSVDLN VLDKLMN
Sbjct  472  VSGGS-SPSGPGNRVPID-DVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMN  529

Query  178  N  176
            +
Sbjct  530  D  530



>ref|XP_010248593.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=554

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPTA+ + S   S+GGTGN  P D DVV+KV  MGF RD V+ATV+KL +NGQSV
Sbjct  474  ILPHALPTATSIGSGS-SSGGTGNRVPID-DVVDKVATMGFSRDQVRATVRKLTENGQSV  531

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  532  DLNVVLDKLMND  543



>gb|KJB75894.1| hypothetical protein B456_012G063600 [Gossypium raimondii]
Length=622

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 74/121 (61%), Gaps = 12/121 (10%)
 Frame = -2

Query  523  NKPYGFG----NYNDTSPFSTMKTSEF-SSPWALDRENQNTQYSHAHKILLPHALPTASF  359
            ++PY +G     Y   +P   MK  +  SSP   +  +   Q   A   +LPHALPTAS 
Sbjct  497  SEPYAYGGSPSQYGSGNP---MKMQQLPSSPMGQNSGSGYPQLPTAK--ILPHALPTASG  551

Query  358  VASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            V+    S  G GN  P D DV++KVT MGF RD V+ATV+KL +NGQSVDLN VLDKLMN
Sbjct  552  VSGGS-SPSGPGNRVPID-DVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMN  609

Query  178  N  176
            +
Sbjct  610  D  610



>ref|XP_010037529.1| PREDICTED: vegetative cell wall protein gp1-like [Eucalyptus 
grandis]
 gb|KCW49241.1| hypothetical protein EUGRSUZ_K02812 [Eucalyptus grandis]
Length=553

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 60/109 (55%), Gaps = 6/109 (6%)
 Frame = -2

Query  505  GNYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTASFVASTEPSTGGT  326
            G YN     S+  TS   +P      N  +Q   A   +LPHALPTAS + S   S    
Sbjct  445  GKYNSGHGNSSTGTSSLPAPGM---GNDYSQLPVAR--ILPHALPTASPIGSDSSSGESR  499

Query  325  GNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            GN  P D DV++K   MGFRRDLV+AT K+L   GQ  DLN +LD LM+
Sbjct  500  GNRGPMD-DVIDKAVAMGFRRDLVRATAKRLEAQGQHPDLNLLLDTLMS  547



>ref|XP_010551915.1| PREDICTED: actin cytoskeleton-regulatory complex protein PAN1 
[Tarenaya hassleriana]
Length=550

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALP AS V+S    +  +GN  P D DVV+KVT MGF R+ VKATV++L +NGQ+V
Sbjct  461  MLPHALPMASAVSSGGSGSPRSGNRVPID-DVVDKVTTMGFPREQVKATVRRLTENGQAV  519

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  520  DLNVVLDKLMN  530



>gb|KHG20812.1| Actin cytoskeleton-regulatory complex PAN1 [Gossypium arboreum]
Length=566

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPT S       ++ G+GN  P D DVV+KVT MGF RD V+ATV+KL +NGQSV
Sbjct  485  VLPHALPTVSGGGGES-ASSGSGNRVPID-DVVDKVTSMGFPRDHVRATVRKLTENGQSV  542

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  543  DLNVVLDKLMND  554



>gb|KFK37621.1| hypothetical protein AALP_AA3G007100 [Arabis alpina]
Length=508

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPHALP AS V+S   S+  + +  P D DV+++VT MGF RD V+ATV+KL +NGQ+VD
Sbjct  424  LPHALPMASAVSSGGSSSPRSESRVPID-DVIDRVTTMGFPRDQVRATVRKLTENGQAVD  482

Query  208  LNEVLDKLMNN*NMYMGVWL  149
            LN VLDKLMN      G WL
Sbjct  483  LNVVLDKLMNEGGAPPGGWL  502



>ref|XP_002440684.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
 gb|EES19114.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
Length=582

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = -2

Query  382  HALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLN  203
              LP A+ V ST PS+G +G   P D DV+EKV  MGF ++ V+ATV+KL +NGQ+VDLN
Sbjct  504  QVLPQAAPVRST-PSSGSSGARVPID-DVIEKVATMGFSKEQVRATVRKLTENGQNVDLN  561

Query  202  EVLDKLMNN  176
             VLDKLMN+
Sbjct  562  VVLDKLMND  570



>ref|XP_002524656.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF37675.1| DNA binding protein, putative [Ricinus communis]
Length=568

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPTAS        + GTGN  P D DVV+KV+ MGF R+ V+ATV+KL +NGQ+V
Sbjct  487  ILPHALPTASGTGGGS-GSSGTGNRVPID-DVVDKVSNMGFPREHVRATVRKLTENGQAV  544

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  545  DLNTVLDKLMND  556



>ref|XP_006341319.1| PREDICTED: trithorax group protein osa-like [Solanum tuberosum]
Length=526

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPTAS V+S   S+  TG+  P D DVV+KVT MGF RD V+ATV++L +NGQSV
Sbjct  456  ILPQALPTASAVSSGS-SSPRTGSRVPID-DVVDKVTNMGFPRDQVRATVRRLTENGQSV  513

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  514  DLNVVLDKLMN  524



>ref|XP_011047322.1| PREDICTED: vacuolar protein sorting-associated protein 37C [Populus 
euphratica]
Length=552

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 94/180 (52%), Gaps = 15/180 (8%)
 Frame = -2

Query  694  PEERTYTPH-SYNPTITESPFKYPGGQFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNK  518
            PEE  + PH SY P++     + P G   Q  Y   +N  +P   P+    S FS     
Sbjct  369  PEETAFIPHQSYPPSLRPLSTQPPSGAPPQPYYGSPSNMYEP---PTSRTSSGFSAGYGP  425

Query  517  PYGFGNYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAH------KILLPHALPTASFV  356
            P G     +  P+    +   +SP    ++   +Q   +         +LP ALPTAS +
Sbjct  426  PSG---STEPYPYGGSPSQYGNSPTMKQQQPTMSQSGGSGFPQLPTARILPQALPTASGI  482

Query  355  ASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
             S    + GTGN  P D DVV+KVT MGF R+ V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  483  GSGP-GSSGTGNRVPLD-DVVDKVTTMGFPREHVEATVRKLTENGQSVDLNVVLDKLMND  540



>ref|XP_009611188.1| PREDICTED: transcriptional regulator DEF1 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 96/182 (53%), Gaps = 17/182 (9%)
 Frame = -2

Query  691  EERTYTPHSYN---PTITESPFKYPGGQFAQHPYSDFTNQVKPTHHPSGSQYSEF---SD  530
            EE ++ P S N   P+I + P    G   +Q  Y+   N  +P     G  YS     S 
Sbjct  359  EETSFVP-SQNYPPPSIRQPPHPSSGAPPSQQLYAAPPNMFEPPPSRPGPGYSGVYPPSS  417

Query  529  STNKPYGF----GNYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTAS  362
               +PY +    G Y   S   +MK  + + P A+ +   +         +LP ALPTAS
Sbjct  418  VHGEPYPYSSSPGQYGSGS---SMKPPQVNLP-AMGQSGGSGYQQLPTARILPQALPTAS  473

Query  361  FVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLM  182
             V+S   S+ GTG   P D DVV+KVT MGF RD V+ TV++L ++GQ+VDLN VLDKLM
Sbjct  474  AVSSGS-SSPGTGIRVPID-DVVDKVTNMGFSRDQVRETVRRLTESGQAVDLNTVLDKLM  531

Query  181  NN  176
            N+
Sbjct  532  ND  533



>ref|XP_010694912.1| PREDICTED: putative uncharacterized protein FLJ22184 [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+PTA+ ++    S+GG+GN  P D DV++KVT MGF +D V+ATV+KL +NGQSV
Sbjct  513  ILPAAIPTAAGISGGS-SSGGSGNKVPID-DVIDKVTNMGFPKDHVRATVRKLTENGQSV  570

Query  211  DLNEVLDKLMNN*NMY--MGVWL  149
            DLN VLDKLMN+ ++    G W 
Sbjct  571  DLNIVLDKLMNDGDIQPPRGGWF  593



>ref|XP_009611187.1| PREDICTED: transcriptional regulator DEF1 isoform X1 [Nicotiana 
tomentosiformis]
Length=551

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 96/182 (53%), Gaps = 17/182 (9%)
 Frame = -2

Query  691  EERTYTPHSYN---PTITESPFKYPGGQFAQHPYSDFTNQVKPTHHPSGSQYSEF---SD  530
            EE ++ P S N   P+I + P    G   +Q  Y+   N  +P     G  YS     S 
Sbjct  365  EETSFVP-SQNYPPPSIRQPPHPSSGAPPSQQLYAAPPNMFEPPPSRPGPGYSGVYPPSS  423

Query  529  STNKPYGF----GNYNDTSPFSTMKTSEFSSPWALDRENQNTQYSHAHKILLPHALPTAS  362
               +PY +    G Y   S   +MK  + + P A+ +   +         +LP ALPTAS
Sbjct  424  VHGEPYPYSSSPGQYGSGS---SMKPPQVNLP-AMGQSGGSGYQQLPTARILPQALPTAS  479

Query  361  FVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLM  182
             V+S   S+ GTG   P D DVV+KVT MGF RD V+ TV++L ++GQ+VDLN VLDKLM
Sbjct  480  AVSSGS-SSPGTGIRVPID-DVVDKVTNMGFSRDQVRETVRRLTESGQAVDLNTVLDKLM  537

Query  181  NN  176
            N+
Sbjct  538  ND  539



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALP AS V +    + GTGN  P D DV++KVT MGF RD V+ATV+KL +NGQSV
Sbjct  510  VLPHALPAASTVGAGS-GSSGTGNRVPID-DVIDKVTTMGFPRDHVRATVRKLTENGQSV  567

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  568  DLNVVLDKLMN  578



>ref|XP_010230500.1| PREDICTED: uncharacterized protein LOC100838076 [Brachypodium 
distachyon]
Length=961

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -2

Query  376  LPTASFVASTEPS----TGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPTA  +    P     TG +GN     +DVVEKV+ MGF R+ V+ATV++L +NGQ+VD
Sbjct  525  LPTAQILPQAAPVSSSPTGSSGNNRVAIDDVVEKVSTMGFSREQVRATVRRLTENGQNVD  584

Query  208  LNEVLDKLMNN  176
            LN VLDKLMN+
Sbjct  585  LNVVLDKLMND  595



>ref|XP_010496293.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Camelina 
sativa]
Length=478

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPHALP AS V+S   S+     +    +DV+++VT MGF RD V+ATV+KL +NGQ+VD
Sbjct  396  LPHALPMASAVSSGGGSSSPRSESRVPIDDVIDRVTTMGFPRDQVRATVRKLTENGQAVD  455

Query  208  LNEVLDKLMNN*NMYMGVWLSG  143
            LN VLDKLMN      G W  G
Sbjct  456  LNVVLDKLMNEGAAPPGGWSGG  477



>ref|XP_009403230.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Musa acuminata subsp. malaccensis]
Length=550

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 7/72 (10%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A  TAS   S+ PS    G   P D DVVEKV  MGF RD V+ATV+KL +NGQSV
Sbjct  485  ILPQAPQTAS--GSSSPS----GTRLPID-DVVEKVATMGFSRDQVRATVRKLTENGQSV  537

Query  211  DLNEVLDKLMNN  176
            DLN VLD+LMN+
Sbjct  538  DLNVVLDRLMND  549



>gb|EMS67668.1| hypothetical protein TRIUR3_30524 [Triticum urartu]
Length=566

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 47/70 (67%), Gaps = 5/70 (7%)
 Frame = -2

Query  376  LPTASFVASTEPS----TGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPTA  +   EP     T  +GN    D DVVEKV  MGF R+ V+ATV++L +NGQ+VD
Sbjct  497  LPTARILPQAEPVSSSPTAASGNRVALD-DVVEKVATMGFSREQVRATVRRLTENGQNVD  555

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  556  LNVVLDKLMN  565



>ref|XP_010435634.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Camelina 
sativa]
Length=478

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPHALP AS V+S   S+     +    +DV+++VT MGF RD V+ATV+KL +NGQ+VD
Sbjct  396  LPHALPMASAVSSGGGSSSPRSESRVPIDDVIDRVTTMGFPRDQVRATVRKLTENGQAVD  455

Query  208  LNEVLDKLMNN*NMYMGVWLSG  143
            LN VLDKLMN      G W  G
Sbjct  456  LNVVLDKLMNEGGAPPGGWSGG  477



>emb|CDM81418.1| unnamed protein product [Triticum aestivum]
Length=603

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 47/70 (67%), Gaps = 5/70 (7%)
 Frame = -2

Query  376  LPTASFVASTEPS----TGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPTA  +   EP     T  +GN    D DVVEKV  MGF R+ V+ATV++L +NGQ+VD
Sbjct  534  LPTARILPQAEPVSSSPTAASGNRVALD-DVVEKVATMGFSREQVRATVRRLTENGQNVD  592

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  593  LNVVLDKLMN  602



>ref|XP_002884275.1| hypothetical protein ARALYDRAFT_477359 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60534.1| hypothetical protein ARALYDRAFT_477359 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = -2

Query  388  LPHALP--TASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQS  215
            LPHALP   ++  +    S+    + AP D DV+++VT MGF RD V+ATV+KL +NGQ+
Sbjct  391  LPHALPIMVSAVSSGGGSSSPRLESRAPID-DVIDRVTTMGFPRDQVRATVRKLTENGQA  449

Query  214  VDLNEVLDKLMNN*NMYMGVWLSG  143
            VDLN VLDKLMN      G W  G
Sbjct  450  VDLNVVLDKLMNEGGAPPGGWFDG  473



>ref|XP_008801957.1| PREDICTED: LOW QUALITY PROTEIN: atherin-like [Phoenix dactylifera]
Length=316

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 9/73 (12%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGT-GNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQS  215
            +LP ALP        E S+GG+ GN  P D DV +KV  +GF RD V+ATV++L +NGQS
Sbjct  240  ILPQALPA-------ESSSGGSPGNRMPID-DVADKVATVGFSRDQVRATVRRLTENGQS  291

Query  214  VDLNEVLDKLMNN  176
            V+LN VLDKLMN+
Sbjct  292  VNLNVVLDKLMND  304



>ref|XP_006408524.1| hypothetical protein EUTSA_v10020517mg [Eutrema salsugineum]
 gb|ESQ49977.1| hypothetical protein EUTSA_v10020517mg [Eutrema salsugineum]
Length=519

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPHALP A+ V ++  S+ G+ +  P D DV+++VT MGF RD V+ATV+KL ++GQ+VD
Sbjct  443  LPHALPMAAAV-NSGSSSSGSESRVPVD-DVIDRVTTMGFPRDQVRATVRKLTEDGQAVD  500

Query  208  LNEVLDKLMNN  176
            LN VLDKLMNN
Sbjct  501  LNVVLDKLMNN  511



>ref|XP_001784568.1| predicted protein [Physcomitrella patens]
 gb|EDQ50633.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = -2

Query  376  LPTASFVASTEPSTGGTGNTAPND---EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDL  206
            LPTA  +  +  STGGT   A N    ++V++KV  MGF RD V+A V+KL +NG +VDL
Sbjct  291  LPTARSIQPSSLSTGGTAPVAANRVSIDEVIDKVASMGFGRDQVRAIVRKLMENGTTVDL  350

Query  205  NEVLDKLMN  179
            N VLDKLMN
Sbjct  351  NVVLDKLMN  359



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 6/72 (8%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+PT S   S+        N  P D DVVEKV  MGF RD V+ATV+KL +NGQSV
Sbjct  472  ILPQAVPTGSSSGSSS-----GKNRLPID-DVVEKVATMGFSRDQVRATVRKLTENGQSV  525

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  526  DLNVVLDKLMND  537



>dbj|BAK07367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 47/70 (67%), Gaps = 5/70 (7%)
 Frame = -2

Query  376  LPTASFVASTEPS----TGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPTA  +   EP     T  +GN    D DVVEKV  MGF R+ V+ATV++L +NGQ+VD
Sbjct  526  LPTAWILPQAEPVSSSPTAASGNRVALD-DVVEKVATMGFSREQVRATVRRLTENGQNVD  584

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  585  LNVVLDKLMN  594



>ref|XP_001758183.1| predicted protein [Physcomitrella patens]
 gb|EDQ77005.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = -2

Query  382  HALPTASFVASTEPSTGGT---GNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            HA+PTA      +PS+G T    N    DE V++KV  MGF +D V+A V++L +NGQSV
Sbjct  353  HAMPTAREREGAQPSSGATPLSTNRLSIDE-VIDKVAVMGFSKDQVRAVVRRLTENGQSV  411

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN 
Sbjct  412  DLNVVLDKLMNG  423



>ref|XP_001770189.1| predicted protein [Physcomitrella patens]
 gb|EDQ65023.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = -2

Query  376  LPTASFVASTEPSTGG----TGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPTA  V  +  S GG      N  P DE V++KV  MGF RD V+ATV+KL +NG SVD
Sbjct  316  LPTARPVQPSMGSQGGPTPVAANRVPVDE-VIDKVASMGFGRDQVRATVRKLTENGTSVD  374

Query  208  LNEVLDKLMNN  176
            LN VLDKLMN 
Sbjct  375  LNVVLDKLMNG  385



>ref|XP_009377181.1| PREDICTED: protein transport protein SEC31-like [Pyrus x bretschneideri]
Length=552

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 93/182 (51%), Gaps = 17/182 (9%)
 Frame = -2

Query  691  EERTYTP-HSYNPTITESPFKYPGGQF-AQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNK  518
            EE  Y P  +Y P + + P   P G   +Q  YS  +N  +P   PS    + +    N 
Sbjct  366  EESPYIPSQNYPPILRQPPSHTPSGHPPSQQYYSPASNAYEP---PSSRPSAGYPSGYNP  422

Query  517  PYGFG-NYNDTSP------FSTMKTSEFSSPWALDRENQNTQYSHAHKI-LLPHALPTAS  362
            P G G +Y    P       S+MK    SS  +   ++  + Y       +LPHA PT S
Sbjct  423  PSGLGESYQYGGPPSQYGGSSSMKPQHHSS--SATAQSGGSGYPQLPTARVLPHANPTPS  480

Query  361  FVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLM  182
             V  + PS+G     A   +DV+++V  MGF RD V+A V+KL D+GQSVDLN VLDKLM
Sbjct  481  GVGGSSPSSGSGSRVA--IDDVIDQVATMGFSRDQVRAAVRKLTDSGQSVDLNVVLDKLM  538

Query  181  NN  176
            N+
Sbjct  539  ND  540



>ref|NP_186805.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE73688.1| uncharacterized protein AT3G01560 [Arabidopsis thaliana]
Length=511

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPHALP  S V+S   S+     +    +DV+++VT MGF RD V+ATV+KL +NGQ+VD
Sbjct  429  LPHALPMVSAVSSGGGSSSPRSESRAPIDDVIDRVTTMGFPRDQVRATVRKLTENGQAVD  488

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  489  LNVVLDKLMN  498



>gb|AAF01541.1|AC009325_11 unknown protein [Arabidopsis thaliana]
Length=493

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPHALP  S V+S   S+     +    +DV+++VT MGF RD V+ATV+KL +NGQ+VD
Sbjct  411  LPHALPMVSAVSSGGGSSSPRSESRAPIDDVIDRVTTMGFPRDQVRATVRKLTENGQAVD  470

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  471  LNVVLDKLMN  480



>ref|XP_009334114.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Pyrus 
x bretschneideri]
Length=583

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 93/183 (51%), Gaps = 17/183 (9%)
 Frame = -2

Query  694  PEERTYTP-HSYNPTITESPFKYPGG-QFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTN  521
            PEE  Y P  +Y P + + P   P      Q  YS   N  +P   PS    S +    N
Sbjct  396  PEESPYIPSQNYPPGLRQPPSHTPSSLPPPQQYYSPAANVYEP---PSSRPSSGYPSGYN  452

Query  520  KPYGFG-NYNDTSP------FSTMKTSEFSSPWALDRENQNTQYSHAHKI-LLPHALPTA  365
             P G G +Y  + P       S+MK    SS  A   ++  + Y       +LPHA PT 
Sbjct  453  PPSGLGESYQYSGPPSQYGGSSSMKPQHHSS--ATTAQSGGSGYPQLPTARVLPHANPTP  510

Query  364  SFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKL  185
            S    +   + G+G+ AP D DV+++V  MGF RD V+A V+KL D+GQSVDLN VLDKL
Sbjct  511  SGPGGSS-PSSGSGSRAPID-DVIDQVATMGFSRDQVRAAVRKLTDSGQSVDLNVVLDKL  568

Query  184  MNN  176
            MN+
Sbjct  569  MND  571



>ref|XP_004489226.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Cicer arietinum]
Length=550

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+PTAS V+    S G     +   +DVV+KV  MGF RD V+ATV+KL +NGQSV
Sbjct  468  ILPQAIPTASSVSGGSGSPGNGNRVS--IDDVVDKVATMGFPRDHVRATVRKLTENGQSV  525

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  526  DLNTVLDKLMN  536



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+PTAS V+     + G GN  P D D+VEKV  MGF RD V+ATV+KL +NGQ+V
Sbjct  481  VLPQAIPTASAVSGGS-GSPGAGNRVPVD-DIVEKVATMGFPRDHVRATVRKLTENGQAV  538

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  539  DLNTVLDKLMN  549



>gb|ACN27117.1| unknown [Zea mays]
Length=233

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+P +S   S       +GN  P D DVVEKV  MGF R+ V+ATV++L +NGQ+V
Sbjct  168  MLPQAVPISSSSTSGS-----SGNRVPLD-DVVEKVATMGFSREQVRATVRRLTENGQNV  221

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  222  DLNVVLDKLMN  232



>ref|XP_004960805.1| PREDICTED: protein diaphanous homolog 1-like [Setaria italica]
Length=568

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = -2

Query  376  LPTASFVASTEP---STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDL  206
            LPTA  +    P   + GG+  T    +DV++KV  MGF ++ V+ATV+KL +NGQ+VDL
Sbjct  487  LPTAQVLPQAAPVSSAPGGSSGTRVPIDDVIDKVATMGFSKEQVRATVRKLTENGQNVDL  546

Query  205  NEVLDKLMNN  176
            N VLDKLMN+
Sbjct  547  NMVLDKLMND  556



>ref|XP_008230557.1| PREDICTED: protein transport protein SEC31 [Prunus mume]
Length=581

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPT S       ++ GTGN  P  EDV++ VT MGF RD V+ATV+K+ D+GQSV
Sbjct  500  VLPQALPTPSGAGGGS-ASAGTGNRVP-IEDVIDTVTTMGFPRDYVRATVRKMTDSGQSV  557

Query  211  DLNEVLDKLMNN  176
            D+N VLDKL N+
Sbjct  558  DVNVVLDKLTND  569



>ref|XP_007217219.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
 gb|EMJ18418.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
Length=575

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPT S       ++ GTGN  P  EDV++ VT MGF RD V+ATV+K+ D+GQSV
Sbjct  494  VLPQALPTPSGAGGGS-ASAGTGNRVP-IEDVIDTVTTMGFPRDYVRATVRKMTDSGQSV  551

Query  211  DLNEVLDKLMNN  176
            D+N VLDKL N+
Sbjct  552  DVNVVLDKLTND  563



>ref|XP_008784980.1| PREDICTED: uncharacterized protein LOC103703781 [Phoenix dactylifera]
Length=875

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 7/72 (10%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPT S    +      +GN  P D DVVEKV  MGF RD V+ATV+KL +NG+SV
Sbjct  447  ILPQALPTGSSSGGS------SGNRVPID-DVVEKVATMGFSRDQVRATVRKLTENGKSV  499

Query  211  DLNEVLDKLMNN  176
            DLN VLD LMN+
Sbjct  500  DLNVVLDTLMND  511



>ref|XP_009782100.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=545

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPTAS V+S   S+  TGN  P D DVV+KVT MGF RD V+ATV++L ++GQ+V
Sbjct  464  ILPQALPTASAVSSGS-SSPSTGNRVPID-DVVDKVTNMGFSRDQVRATVRRLTESGQAV  521

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  522  DLNTVLDKLMND  533



>ref|XP_008341426.1| PREDICTED: YLP motif-containing protein 1-like [Malus domestica]
Length=552

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 93/182 (51%), Gaps = 17/182 (9%)
 Frame = -2

Query  691  EERTYTP-HSYNPTITESPFKYPGGQF-AQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNK  518
            EE  Y P  +Y P++ + P   P G   +Q  YS  +N  +P   PS    + +    N 
Sbjct  366  EESPYIPSQNYPPSLRQPPSHTPSGHPPSQQYYSPASNAYEP---PSSRPSAGYPSGYNP  422

Query  517  PYGFG-NYNDTSP------FSTMKTSEFSSPWALDRENQNTQYSHAHKI-LLPHALPTAS  362
            P G G +Y    P       STM+    SS  +   ++  + Y       +LPHA PT S
Sbjct  423  PSGLGESYQYGGPPSQYGGSSTMQPQHHSS--SATAQSGGSGYPQLPTARVLPHANPTPS  480

Query  361  FVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLM  182
                +   + G+GN  P D DV+++V  MGF RD V+A V+KL D+GQSVDLN VLDK+M
Sbjct  481  GAGGSP-PSSGSGNRVPID-DVIDQVATMGFSRDQVRAAVRKLTDSGQSVDLNVVLDKMM  538

Query  181  NN  176
             +
Sbjct  539  TD  540



>ref|XP_007222918.1| hypothetical protein PRUPE_ppa003684mg [Prunus persica]
 gb|EMJ24117.1| hypothetical protein PRUPE_ppa003684mg [Prunus persica]
Length=556

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHA PT+S V  +   + GTGN  P D DV++ VT MGF RD V+AT++KL DNGQ+V
Sbjct  475  VLPHASPTSSRVGGSS-GSAGTGNKVPID-DVIDHVTTMGFSRDHVRATIRKLTDNGQAV  532

Query  211  DLNEVLDKLMNN  176
            D+N VLDKLMN+
Sbjct  533  DVNVVLDKLMND  544



>ref|XP_010908580.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Elaeis guineensis]
Length=523

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -2

Query  376  LPTASFVASTEPSTGGTGNTAPND---EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDL  206
            LPTA  +   +P+   +G ++ N    +DVVEKV  MGF RD V+ATV+ L +NG+SVDL
Sbjct  442  LPTAQMLPQPQPTGSSSGGSSGNRVSIDDVVEKVATMGFSRDQVRATVRMLTENGKSVDL  501

Query  205  NEVLDKLMNN  176
            N VLDKLMN+
Sbjct  502  NVVLDKLMND  511



>ref|XP_010906083.1| PREDICTED: protein transport protein SEC31 [Elaeis guineensis]
Length=541

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 8/72 (11%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPT S  + +           P D DVV+KV  MGF RD V+ATV+KL +NGQSV
Sbjct  466  VLPQALPTESSSSEST-------GRVPID-DVVDKVVTMGFSRDQVRATVRKLTENGQSV  517

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  518  DLNVVLDKLMND  529



>ref|XP_006297454.1| hypothetical protein CARUB_v10013474mg [Capsella rubella]
 gb|EOA30352.1| hypothetical protein CARUB_v10013474mg [Capsella rubella]
Length=514

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  304  EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN*NMYMGVWLSG  143
            +DV+++VT MGF RD V ATVKKL +NGQ+VDLN VLDKLMN      G W  G
Sbjct  460  DDVIDRVTTMGFPRDQVGATVKKLTENGQAVDLNVVLDKLMNEGGAPPGGWSGG  513



>gb|KDP31054.1| hypothetical protein JCGZ_11430 [Jatropha curcas]
Length=518

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 83/144 (58%), Gaps = 14/144 (10%)
 Frame = -2

Query  601  YSDFTNQVKPTHHPSGSQYSEFSDSTNKPYGFG--NYNDTSPFSTMKTSEFSSPWALDRE  428
            YSDF    +   HP G  Y+   D     YG+    +N  S    ++ S   +P A   E
Sbjct  386  YSDFAGNSQVQRHPQG--YTNIVDF----YGYTAPTHNSKSIAKPLQPS--PAPVANSGE  437

Query  427  NQNTQYSHAHKILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKA  248
               +Q   A   +L HA+PTAS V S   S+GG+GNT P D+ V +    MGFRRDLV+A
Sbjct  438  ISYSQLPTAR--VLQHAIPTASSVDSES-SSGGSGNTIPVDDVVDKV-VGMGFRRDLVRA  493

Query  247  TVKKLADNGQSVDLNEVLDKLMNN  176
            TVKKL +NGQSVDLN VLDKLM+N
Sbjct  494  TVKKLTENGQSVDLNIVLDKLMHN  517



>gb|EYU44780.1| hypothetical protein MIMGU_mgv1a004985mg [Erythranthe guttata]
Length=501

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  304  EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            +DVV++VT MGF RD V+ATVKKL +NGQ+VDLN VLDKLMN+
Sbjct  450  DDVVDRVTNMGFPRDQVRATVKKLTENGQAVDLNIVLDKLMND  492



>ref|XP_002511348.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51950.1| conserved hypothetical protein [Ricinus communis]
Length=488

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 81/167 (49%), Gaps = 25/167 (15%)
 Frame = -2

Query  619  QFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTN----------KPYGFGNYND------T  488
            Q    P+      V  TH   G Q S F DS +          +P G+ N  D       
Sbjct  327  QLHDRPHPPQVFDVGSTHRTHGCQPSNFFDSESASANLRGQGLQPRGYDNTGDYYYMPTH  386

Query  487  SPFSTMKTSE--FSSPWALDRENQNTQYSHAHKI-LLPHALPTASFVASTEPSTGGTGNT  317
            S  ST+K  +   S P   D  N    YS       LPHA+PTAS V     S G     
Sbjct  387  SGTSTLKPLQPSLSPPVTTDDLN----YSRLPTARTLPHAIPTASAVDGGSSSGGSGNRV  442

Query  316  APNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
                +DVV+KV  MGFRRD V+ATVKKL +NGQSVDLN VLDKLMNN
Sbjct  443  P--VDDVVDKVVGMGFRRDTVRATVKKLTENGQSVDLNVVLDKLMNN  487



>gb|AAM96980.1| putative protein [Arabidopsis thaliana]
 gb|AAO30092.1| putative protein [Arabidopsis thaliana]
Length=357

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 47/75 (63%), Gaps = 5/75 (7%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTG----NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNG  221
            LP  LP AS ++S     G       N AP D DV++KV  MGF RD V+ TV+ L +NG
Sbjct  263  LPQGLPMASAISSGGSGGGSDSPRSGNRAPVD-DVIDKVVSMGFPRDQVRGTVRTLTENG  321

Query  220  QSVDLNEVLDKLMNN  176
            Q+VDLN VLDKLMN 
Sbjct  322  QAVDLNVVLDKLMNG  336



>ref|XP_008379205.1| PREDICTED: protein enabled [Malus domestica]
Length=583

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 92/182 (51%), Gaps = 17/182 (9%)
 Frame = -2

Query  691  EERTYTP-HSYNPTITESPFKYPGG-QFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNK  518
            EE  Y P  +Y PT+ + P   PG    +Q  YS   N  +P   P     S +    N 
Sbjct  397  EESPYIPSQNYPPTLRQPPSHTPGSLPPSQQYYSPAANAYEP---PPSRPSSGYPSGYNP  453

Query  517  PYGFG-NYNDTSP------FSTMKTSEFSSPWALDRENQNTQYSHAHKI-LLPHALPTAS  362
            P G G +Y    P       S+MK    SS  +   ++  + Y       +LPHA PT S
Sbjct  454  PSGLGESYQYGGPPSQYGGSSSMKPQHHSS--SATAQSGGSGYPQLPTARVLPHANPTPS  511

Query  361  FVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLM  182
                +   + G+G+  P D DV+++V  MGF RD V+A V+KL D+GQ+VDLN VLDKLM
Sbjct  512  GPGGSS-PSSGSGSRVPID-DVIDQVATMGFSRDQVRAAVQKLTDSGQAVDLNVVLDKLM  569

Query  181  NN  176
            N+
Sbjct  570  ND  571



>ref|XP_002455112.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
 gb|EES00232.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
Length=571

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = -2

Query  376  LPTASFVASTEP-----STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            LPTA  +    P     ++G +GN  P D DVVEKV  MGF R+ V+ATV++L +NGQ+V
Sbjct  500  LPTAQILPQAVPISSSSTSGSSGNRVPLD-DVVEKVATMGFSREQVRATVRRLTENGQNV  558

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  559  DLNVVLDKLMN  569



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 5/70 (7%)
 Frame = -2

Query  376  LPTASFVASTEP--STGG--TGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LPTA  +    P  ST G  +GN  P D DVV+KV  MGF R+ V+A V++L ++GQ+VD
Sbjct  413  LPTAQMLPQAAPVSSTPGASSGNRVPID-DVVDKVATMGFSREEVRAAVRQLTESGQNVD  471

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  472  LNVVLDKLMN  481



>gb|AFW80147.1| putative DUF1421 domain family protein [Zea mays]
Length=563

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = -2

Query  376  LPTASFVASTEP-----STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            LPTA  +    P     ++G +GN  P D DVVEKV  MGF R+ V+ATV++L +NGQ+V
Sbjct  493  LPTAQMLPQAVPISSSSTSGSSGNRVPLD-DVVEKVATMGFSREQVRATVRRLTENGQNV  551

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  552  DLNVVLDKLMN  562



>ref|XP_010492262.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNT---APNDEDVVEKVTRMGFRRDLVKATVKKLADNG  221
            LLP  LP AS ++S      G+  +   AP D DV++KV  MGF RD V+ TV+ L +NG
Sbjct  454  LLPQGLPMASAISSGGSGGSGSPRSGSRAPVD-DVIDKVVSMGFPRDQVRGTVRTLTENG  512

Query  220  QSVDLNEVLDKLMN  179
            Q+VDLN VLDKLMN
Sbjct  513  QAVDLNVVLDKLMN  526



>ref|NP_196958.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH20220.1| AT5G14540 [Arabidopsis thaliana]
 gb|AED92045.1| uncharacterized protein AT5G14540 [Arabidopsis thaliana]
Length=547

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 47/74 (64%), Gaps = 5/74 (7%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTG----NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNG  221
            LP  LP AS ++S     G       N AP D DV++KV  MGF RD V+ TV+ L +NG
Sbjct  453  LPQGLPMASAISSGGSGGGSDSPRSGNRAPVD-DVIDKVVSMGFPRDQVRGTVRTLTENG  511

Query  220  QSVDLNEVLDKLMN  179
            Q+VDLN VLDKLMN
Sbjct  512  QAVDLNVVLDKLMN  525



>emb|CAB87621.1| putative protein [Arabidopsis thaliana]
Length=530

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 47/74 (64%), Gaps = 5/74 (7%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTG----NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNG  221
            LP  LP AS ++S     G       N AP D DV++KV  MGF RD V+ TV+ L +NG
Sbjct  436  LPQGLPMASAISSGGSGGGSDSPRSGNRAPVD-DVIDKVVSMGFPRDQVRGTVRTLTENG  494

Query  220  QSVDLNEVLDKLMN  179
            Q+VDLN VLDKLMN
Sbjct  495  QAVDLNVVLDKLMN  508



>ref|NP_001147786.1| LOC100281396 [Zea mays]
 gb|ACG28711.1| proline-rich protein [Zea mays]
Length=563

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+P +S   S       +GN  P D DVVEKV  MGF R+ V+ATV++L +NGQ+V
Sbjct  498  MLPQAVPISSSSTSGS-----SGNRVPLD-DVVEKVATMGFSREQVRATVRRLTENGQNV  551

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  552  DLNVVLDKLMN  562



>ref|NP_001140648.1| uncharacterized protein LOC100272723 [Zea mays]
 gb|ACF84264.1| unknown [Zea mays]
 tpg|DAA53270.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=568

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = -2

Query  376  LPTASFVASTEP-----STGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            LPTA  +    P     ++G +GN  P D DVVEKV  MGF R+ V+ATV++L +NGQ+V
Sbjct  497  LPTAQILPQAVPVSSSSTSGASGNRVPLD-DVVEKVATMGFSREQVRATVRRLTENGQNV  555

Query  211  DLNEVLDKLMN  179
            DLN VLDKLMN
Sbjct  556  DLNVVLDKLMN  566



>ref|XP_002985569.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
 gb|EFJ13443.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
Length=538

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = -2

Query  385  PHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDL  206
            PH LPTA  +  + PS      +    +DV++KV  MGF RD V+ATV++L +NGQ+VD+
Sbjct  457  PH-LPTAQPIQQSLPSARPASRSGV--DDVIDKVAAMGFPRDQVRATVQRLTENGQAVDM  513

Query  205  NEVLDKLMN  179
            N VLDKLMN
Sbjct  514  NVVLDKLMN  522



>ref|XP_002987005.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
 gb|EFJ11848.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
Length=548

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = -2

Query  385  PHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDL  206
            PH LPTA  +  + PS      +    +DV++KV  MGF RD V+ATV++L +NGQ+VD+
Sbjct  467  PH-LPTAQPIQQSLPSARPASRSGV--DDVIDKVAAMGFPRDQVRATVQRLTENGQAVDM  523

Query  205  NEVLDKLMN  179
            N VLDKLMN
Sbjct  524  NVVLDKLMN  532



>ref|XP_010910342.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X2 [Elaeis guineensis]
Length=533

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 7/72 (10%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPT       E S+GG+       +DVVEK+  MGF R  V+ATV+KL +NGQSV
Sbjct  461  VLPQALPT-------ESSSGGSTGNGVAIDDVVEKLASMGFSRYQVRATVQKLTENGQSV  513

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  514  DLNIVLDKLMND  525



>ref|XP_010910341.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X1 [Elaeis guineensis]
Length=535

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 7/72 (10%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP ALPT       E S+GG+       +DVVEK+  MGF R  V+ATV+KL +NGQSV
Sbjct  463  VLPQALPT-------ESSSGGSTGNGVAIDDVVEKLASMGFSRYQVRATVQKLTENGQSV  515

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  516  DLNIVLDKLMND  527



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  304  EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            +DVVEKV  MGF R+ V+ATV++L +NGQ+VDLN VLDKLMN+
Sbjct  519  DDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMND  561



>ref|XP_004968338.1| PREDICTED: class E vacuolar protein-sorting machinery protein 
HSE1-like [Setaria italica]
Length=570

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  304  EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            +DVVEKV  MGF R+ V+ATV++L +NGQ+VDLN VLDKLMN
Sbjct  527  DDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMN  568



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -2

Query  322  NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            N  P D DVV KV  MGF RD V+ATV+K+ +NGQSVDLN+VLDKLM++
Sbjct  403  NRVPID-DVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSD  450



>ref|NP_001042136.2| Os01g0169900 [Oryza sativa Japonica Group]
 dbj|BAD68319.1| vegetative cell wall protein gp1 -like [Oryza sativa Japonica 
Group]
 gb|EAY72703.1| hypothetical protein OsI_00570 [Oryza sativa Indica Group]
 gb|EAZ10703.1| hypothetical protein OsJ_00537 [Oryza sativa Japonica Group]
 dbj|BAH00414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04050.2| Os01g0169900 [Oryza sativa Japonica Group]
Length=580

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  304  EDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            +DVVEKV  MGF R+ V+ATV++L +NGQ+VDLN VLDKLMN+
Sbjct  525  DDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMND  567



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  322  NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            N  P D DVV+KV  MGF RD V+ATV+K+ +NGQSVDLN+VLDKLM++
Sbjct  515  NRVPID-DVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSD  562



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  322  NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            N  P D DVV+KV  MGF RD V+ATV+K+ +NGQSVDLN+VLDKLM++
Sbjct  515  NRVPID-DVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSD  562



>ref|XP_008365379.1| PREDICTED: protein enabled-like [Malus domestica]
Length=583

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 90/182 (49%), Gaps = 17/182 (9%)
 Frame = -2

Query  691  EERTYTP-HSYNPTITESPFKYPGG-QFAQHPYSDFTNQVKPTHHPSGSQYSEFSDSTNK  518
            EE  Y P  +Y P + + P   PG    +Q  YS   N  +P   P     S +    N 
Sbjct  397  EESPYIPSQNYPPXLRQPPSHTPGSLPPSQQYYSPAANAYEP---PPSRPSSGYPSGYNP  453

Query  517  PYGFG-NYNDTSP------FSTMKTSEFSSPWALDRENQNTQYSHAHKI-LLPHALPTAS  362
            P G G +Y    P       S MK    SS  +   ++  + Y       +LPHA PT S
Sbjct  454  PSGLGESYQYGGPPSQYGGSSXMKPQHHSS--SATAQSXGSGYPQLPTARVLPHANPTPS  511

Query  361  FVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLM  182
                +   + G+G+  P D DV+++V  MGF RD V+A V+KL D+GQ+VDLN VLDKLM
Sbjct  512  GPGGSS-PSSGSGSRVPID-DVIDQVATMGFSRDQVRAAVQKLTDSGQAVDLNVVLDKLM  569

Query  181  NN  176
            N+
Sbjct  570  ND  571



>ref|XP_010420094.1| PREDICTED: protein transport protein sec31-like [Camelina sativa]
Length=545

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNT---APNDEDVVEKVTRMGFRRDLVKATVKKLADNGQ  218
            LP  LP AS ++S      G+  +   AP D DV++KV  MGF RD V+ TV+ L +NGQ
Sbjct  454  LPQGLPMASAISSGGSGGSGSPRSGSRAPVD-DVIDKVVSMGFPRDQVRGTVRTLTENGQ  512

Query  217  SVDLNEVLDKLMN  179
            +VDLN VLDKLMN
Sbjct  513  AVDLNVVLDKLMN  525



>ref|XP_006289230.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
 gb|EOA22128.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
Length=541

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNT---APNDEDVVEKVTRMGFRRDLVKATVKKLADNGQ  218
            LP  LP AS ++S      G+  +   AP D DV++KV  MGF RD V+ TV+ L +NGQ
Sbjct  451  LPQGLPMASAISSGGSGGSGSPRSGSQAPVD-DVIDKVVTMGFPRDQVRGTVRTLTENGQ  509

Query  217  SVDLNEVLDKLMN  179
            +VDLN VLDKLMN
Sbjct  510  AVDLNVVLDKLMN  522



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -2

Query  322  NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            N  P D DVV KV  MGF RD V+ATV+K+ +NGQSVDLN+VLDKLM++
Sbjct  505  NRVPID-DVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSD  552



>emb|CDX85594.1| BnaA02g02190D [Brassica napus]
Length=487

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 6/70 (9%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LP ALP A+ ++S             + +DV++KV+ MGF RD V+ TV+ L +NGQ+VD
Sbjct  405  LPQALPMATAISSG------GSGGGGSVDDVIDKVSSMGFPRDQVRGTVRALTENGQAVD  458

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  459  LNTVLDKLMN  468



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -2

Query  322  NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            N  P D DVV KV  MGF RD V+ATV+K+ +NGQSVDLN+VLDKLM++
Sbjct  507  NRVPID-DVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSD  554



>emb|CDX91045.1| BnaC02g05520D [Brassica napus]
Length=486

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 6/70 (9%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            LP ALP A+ ++S             + +DV++KV+ MGF RD V+ TV+ L +NGQ+VD
Sbjct  404  LPQALPMATAISSG------GSGGGGSVDDVIDKVSSMGFPRDQVRGTVRALTENGQAVD  457

Query  208  LNEVLDKLMN  179
            LN VLDKLMN
Sbjct  458  LNTVLDKLMN  467



>gb|ADE75761.1| unknown [Picea sitchensis]
Length=534

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -2

Query  382  HALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLN  203
            H+LP A+ ++ +  ++   GN    DE V++KV+ MGF R  V ATV++L + GQ +DLN
Sbjct  455  HSLPVATSISGSSSNSSARGNPVAIDE-VIDKVSAMGFSRGQVTATVQRLMEKGQQIDLN  513

Query  202  EVLDKLMNN  176
             VLDKLMN+
Sbjct  514  IVLDKLMND  522



>gb|KFK25694.1| hypothetical protein AALP_AA8G147000 [Arabis alpina]
Length=530

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  322  NTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            N AP D DV++KVT MGF RD V+ TV+ L ++GQ+VDLN VLDKLMN
Sbjct  463  NRAPVD-DVIDKVTSMGFPRDQVRGTVRTLTESGQAVDLNIVLDKLMN  509



>ref|XP_009125985.1| PREDICTED: WW domain-binding protein 11 isoform X2 [Brassica 
rapa]
Length=536

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNT-----APNDEDVVEKVTRMGFRRDLVKATVKKLADN  224
            LP ALP A+ ++S     GG+G+       P D DV++KV+ MGF RD V+ TV+ L +N
Sbjct  444  LPQALPMATAISSGGSGGGGSGSPRSGSNVPVD-DVIDKVSSMGFPRDQVRGTVRALTEN  502

Query  223  GQSVDLNEVLDKLMN  179
            GQ+VDLN VLDKLMN
Sbjct  503  GQAVDLNTVLDKLMN  517



>ref|XP_009125983.1| PREDICTED: WW domain-binding protein 11 isoform X1 [Brassica 
rapa]
Length=537

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNT-----APNDEDVVEKVTRMGFRRDLVKATVKKLADN  224
            LP ALP A+ ++S     GG+G+       P D DV++KV+ MGF RD V+ TV+ L +N
Sbjct  445  LPQALPMATAISSGGSGGGGSGSPRSGSNVPVD-DVIDKVSSMGFPRDQVRGTVRALTEN  503

Query  223  GQSVDLNEVLDKLMN  179
            GQ+VDLN VLDKLMN
Sbjct  504  GQAVDLNTVLDKLMN  518



>ref|XP_010453577.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  316  APNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            AP D DV++KV  MGF RD V+ TV+ L +NGQ+VDLN VLDKLMN
Sbjct  482  APVD-DVIDKVVSMGFPRDQVRGTVRTLTENGQAVDLNVVLDKLMN  526



>ref|NP_001054762.2| Os05g0169400 [Oryza sativa Japonica Group]
 dbj|BAF16676.2| Os05g0169400, partial [Oryza sativa Japonica Group]
Length=536

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  325  GNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            GN  P D DVV+KV  MGF R+ V+A V++L ++GQ+VDLN VLDK+MN 
Sbjct  476  GNRVPID-DVVDKVATMGFSREQVRAAVRQLTESGQNVDLNMVLDKVMNG  524



>gb|EAY96697.1| hypothetical protein OsI_18619 [Oryza sativa Indica Group]
 gb|EEE62479.1| hypothetical protein OsJ_17276 [Oryza sativa Japonica Group]
Length=574

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  325  GNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            GN  P D DVV+KV  MGF R+ V+A V++L ++GQ+VDLN VLDK+MN 
Sbjct  514  GNRVPID-DVVDKVATMGFSREQVRAAVRQLTESGQNVDLNMVLDKVMNG  562



>gb|KHN27460.1| hypothetical protein glysoja_022169 [Glycine soja]
Length=573

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+PTAS V+    STG  G  +   +DVV+KV  MGF RD V+ATV+KL +NGQSV
Sbjct  492  VLPQAIPTASAVSGGSGSTGTGGRVS--VDDVVDKVATMGFPRDHVRATVRKLTENGQSV  549

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  550  DLNAVLDKLMND  561



>ref|XP_003525675.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Glycine max]
Length=573

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+PTAS V+    STG  G  +   +DVV+KV  MGF RD V+ATV+KL +NGQSV
Sbjct  492  VLPQAIPTASAVSGGSGSTGTGGRVS--VDDVVDKVATMGFPRDHVRATVRKLTENGQSV  549

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  550  DLNAVLDKLMND  561



>ref|XP_010033310.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Eucalyptus grandis]
 gb|KCW52919.1| hypothetical protein EUGRSUZ_J02234 [Eucalyptus grandis]
Length=576

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPTAS ++    S+G         +DVV+KVT MGF RD V+ TV++L +NGQ V
Sbjct  495  VLPHALPTASAMSGNSGSSGTGNRVP--VDDVVDKVTSMGFPRDQVRGTVRRLTENGQPV  552

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  553  DLNIVLDKLMND  564



>emb|CDP02078.1| unnamed protein product [Coffea canephora]
Length=551

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LP A+PTAS V+    S+G         +DVV+KVT MGF RD V+ATV+KL +NGQSV
Sbjct  470  ILPQAIPTASGVSGGSGSSGSGNRVP--VDDVVDKVTNMGFPRDQVRATVRKLTENGQSV  527

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  528  DLNVVLDKLMND  539



>ref|XP_006603779.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X2 [Glycine max]
Length=466

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  277  MGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            MGF RD V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  421  MGFPRDHVRATVRKLTENGQSVDLNAVLDKLMND  454



>gb|KCW54142.1| hypothetical protein EUGRSUZ_I00119 [Eucalyptus grandis]
Length=435

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -2

Query  391  LLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSV  212
            +LPHALPTAS V+    S+G       +D   V+ VT MG  RD ++ TV++L +NGQ V
Sbjct  351  VLPHALPTASAVSGNSGSSGTGNRVPVDDV--VDNVTSMGLTRDQIRGTVRRLTENGQPV  408

Query  211  DLNEVLDKLMNN  176
            DLN VLDKLMN+
Sbjct  409  DLNIVLDKLMND  420



>ref|XP_003554822.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X1 [Glycine max]
 gb|KHN19672.1| hypothetical protein glysoja_037174 [Glycine soja]
Length=578

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  277  MGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            MGF RD V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  533  MGFPRDHVRATVRKLTENGQSVDLNAVLDKLMND  566



>ref|XP_007150938.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
 gb|ESW22932.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
Length=575

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  277  MGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            MGF RD V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  530  MGFPRDHVRATVRKLTENGQSVDLNTVLDKLMND  563



>gb|ACZ74657.1| hypothetical protein [Phaseolus vulgaris]
Length=574

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  277  MGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            MGF RD V+ATV+KL +NGQSVDLN VLDKLMN+
Sbjct  529  MGFPRDHVRATVRKLTENGQSVDLNTVLDKLMND  562



>gb|AEW09170.1| hypothetical protein CL4474Contig1_03, partial [Pinus radiata]
 gb|AFG55800.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55801.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55802.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55803.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55804.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55805.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55806.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55807.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55808.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55809.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55810.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55811.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55812.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
 gb|AFG55813.1| hypothetical protein CL4474Contig1_03, partial [Pinus taeda]
Length=46

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  277  MGFRRDLVKATVKKLADNGQSVDLNEVLDKLMN  179
            MGF RD VK  V+KL +NGQ+VDLN VLDKLMN
Sbjct  1    MGFSRDQVKVVVRKLTENGQTVDLNIVLDKLMN  33



>gb|AEW08657.1| hypothetical protein CL1065Contig1_02, partial [Pinus radiata]
 gb|AFG58085.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58086.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58087.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58088.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58089.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58090.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58091.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58092.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58093.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58094.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58095.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58097.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58098.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58099.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58100.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58101.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
 gb|AFG58102.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
Length=83

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            + H+LP AS +  +  ++   GN    DE V++ V++MG+ R  V ATV++L + GQ +D
Sbjct  13   VQHSLPVASSITGSSSNSSAHGNQVGVDE-VIDNVSKMGYSRGQVTATVQRLMEKGQQID  71

Query  208  LNEVLDKL  185
            +N VLDKL
Sbjct  72   VNVVLDKL  79



>gb|AFG58096.1| hypothetical protein CL1065Contig1_02, partial [Pinus taeda]
Length=83

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = -2

Query  388  LPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVD  209
            + H+LP AS +  +  ++   GN    DE V++ V++MG+ R  V ATV++L + GQ +D
Sbjct  13   VQHSLPVASSITGSSSNSSAHGNQVGVDE-VIDNVSKMGYSRGQVTATVQRLMEKGQQID  71

Query  208  LNEVLDKL  185
            +N VLDKL
Sbjct  72   VNIVLDKL  79



>gb|EMT01630.1| hypothetical protein F775_09697 [Aegilops tauschii]
Length=574

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  397  KILLPHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQ  218
            K+     LP A+ V+ST   +  +GN    D+ V +  T MGF ++ V+ATV++L +NGQ
Sbjct  491  KLPTAQILPQAAPVSST--PSASSGNRVAVDDVVDKVST-MGFSKEQVRATVRRLTENGQ  547

Query  217  SVDLNEVLDKLMNN  176
            +VDLN VLDKLMN+
Sbjct  548  NVDLNVVLDKLMND  561



>ref|XP_003568842.1| PREDICTED: zyxin-like [Brachypodium distachyon]
Length=573

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = -2

Query  376  LPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEV  197
            LP A+ V+ST   +  +GN    D+ V +  T MGF ++ V+ATV++L +NGQ+VDLN V
Sbjct  497  LPQAAPVSST--PSASSGNRVAVDDVVDKVST-MGFSKEQVRATVRRLTENGQNVDLNVV  553

Query  196  LDKLMNN  176
            LDKLMN+
Sbjct  554  LDKLMND  560



>dbj|BAK01901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  277  MGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            MGF ++ V+ATV++L +NGQ+VDLN VLDKLMN+
Sbjct  525  MGFSKEQVRATVRRLTENGQNVDLNVVLDKLMND  558



>gb|EMS54596.1| Tryptophan aminotransferase 1 [Triticum urartu]
Length=891

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  277  MGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            MGF ++ V+ATV++L +NGQ+VDLN VLDKLMN+
Sbjct  491  MGFSKEQVRATVRRLTENGQNVDLNVVLDKLMND  524



>ref|XP_011400494.1| hypothetical protein F751_5373 [Auxenochlorella protothecoides]
 gb|KFM27517.1| hypothetical protein F751_5373 [Auxenochlorella protothecoides]
Length=339

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -2

Query  385  PHALPTASFVASTEPSTGGTGNTAPNDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDL  206
            P   P++S     E +    G  A   E V++ V  MGF R+ V+  +K+L ++GQSVDL
Sbjct  270  PGPAPSSSSFTRNEEAPSADGGQAVPIEKVIDDVAVMGFSREEVRRVLKQLMESGQSVDL  329

Query  205  NEVLDKL  185
            N VLD+L
Sbjct  330  NVVLDRL  336



>ref|XP_002508487.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69745.1| predicted protein [Micromonas sp. RCC299]
Length=364

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  310  NDEDVVEKVTRMGFRRDLVKATVKKLADNGQSVDLNEVLDKLMNN  176
            N E  ++    MGF RD V+  +++L+D+GQ+VD N VLD+LMN+
Sbjct  318  NVERFIDDFASMGFTRDQVRGVIRELSDSGQTVDTNVVLDRLMNS  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340