BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004D08

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010535069.1|  PREDICTED: 40S ribosomal protein S18 isoform X1    276   7e-91   Tarenaya hassleriana [spider flower]
ref|XP_010666932.1|  PREDICTED: 40S ribosomal protein S18               276   8e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010534126.1|  PREDICTED: 40S ribosomal protein S18               275   2e-90   Tarenaya hassleriana [spider flower]
ref|XP_004139687.1|  PREDICTED: 40S ribosomal protein S18-like          274   3e-90   Cucumis sativus [cucumbers]
gb|KHN46413.1|  40S ribosomal protein S18                               274   3e-90   Glycine soja [wild soybean]
ref|XP_007019598.1|  S18 ribosomal protein                              274   4e-90   Theobroma cacao [chocolate]
ref|XP_002524340.1|  40S ribosomal protein S18, putative                274   4e-90   Ricinus communis
ref|NP_001238100.1|  uncharacterized protein LOC100306646               273   5e-90   Glycine max [soybeans]
ref|XP_002307515.1|  40S ribosomal protein S18                          273   7e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010692226.1|  PREDICTED: 40S ribosomal protein S18-like          273   7e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007225841.1|  hypothetical protein PRUPE_ppa011659mg             275   7e-90   
emb|CDO99058.1|  unnamed protein product                                275   9e-90   Coffea canephora [robusta coffee]
ref|XP_010542963.1|  PREDICTED: 40S ribosomal protein S18               273   9e-90   Tarenaya hassleriana [spider flower]
ref|XP_004496437.1|  PREDICTED: 40S ribosomal protein S18-like          273   1e-89   Cicer arietinum [garbanzo]
ref|XP_006288747.1|  hypothetical protein CARUB_v10002063mg             274   1e-89   
gb|KDP36554.1|  hypothetical protein JCGZ_08321                         272   2e-89   Jatropha curcas
ref|NP_001236608.1|  uncharacterized protein LOC100500087               272   2e-89   Glycine max [soybeans]
ref|NP_173692.1|  40S ribosomal protein S18                             272   3e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090421.1|  40S ribosomal protein S18                          275   3e-89   
gb|KHN17014.1|  40S ribosomal protein S18                               272   3e-89   Glycine soja [wild soybean]
ref|XP_011044275.1|  PREDICTED: 40S ribosomal protein S18               271   3e-89   Populus euphratica
emb|CDX86893.1|  BnaA09g22830D                                          273   3e-89   
ref|XP_006574786.1|  PREDICTED: 40S ribosomal protein S18               271   3e-89   Glycine max [soybeans]
ref|XP_004489927.1|  PREDICTED: 40S ribosomal protein S18-like          271   4e-89   Cicer arietinum [garbanzo]
ref|XP_008224314.1|  PREDICTED: 40S ribosomal protein S18               271   4e-89   Prunus mume [ume]
ref|XP_010932756.1|  PREDICTED: 40S ribosomal protein S18               271   5e-89   Elaeis guineensis
ref|XP_006434520.1|  hypothetical protein CICLE_v10002764mg             271   5e-89   Citrus clementina [clementine]
emb|CDY28390.1|  BnaA05g18500D                                          273   5e-89   Brassica napus [oilseed rape]
ref|NP_001235572.1|  uncharacterized protein LOC100306474               271   6e-89   
ref|XP_010057300.1|  PREDICTED: 40S ribosomal protein S18-like          271   7e-89   Eucalyptus grandis [rose gum]
ref|XP_006305745.1|  hypothetical protein CARUB_v10010553mg             271   7e-89   Capsella rubella
gb|AFK43302.1|  unknown                                                 271   7e-89   Lotus japonicus
emb|CDX90736.1|  BnaA03g24160D                                          272   7e-89   
ref|XP_010256035.1|  PREDICTED: 40S ribosomal protein S18-like          271   8e-89   Nelumbo nucifera [Indian lotus]
ref|XP_010421886.1|  PREDICTED: 40S ribosomal protein S18               270   9e-89   Camelina sativa [gold-of-pleasure]
gb|KFK44369.1|  hypothetical protein AALP_AA1G248300                    270   9e-89   Arabis alpina [alpine rockcress]
gb|AAK43840.1|AF370463_1  S18.A ribosomal protein                       270   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003592517.1|  40S ribosomal protein S18                          270   1e-88   
ref|XP_003592049.1|  40S ribosomal protein S18                          270   1e-88   Medicago truncatula
ref|XP_009134165.1|  PREDICTED: 40S ribosomal protein S18               270   1e-88   Brassica rapa
ref|XP_007143544.1|  hypothetical protein PHAVU_007G080500g             270   2e-88   Phaseolus vulgaris [French bean]
ref|XP_007200472.1|  hypothetical protein PRUPE_ppa012853mg             270   2e-88   Prunus persica
ref|XP_008368832.1|  PREDICTED: 40S ribosomal protein S18-like          270   2e-88   
ref|XP_010498762.1|  PREDICTED: 40S ribosomal protein S18-like          270   2e-88   Camelina sativa [gold-of-pleasure]
gb|KFK25815.1|  hypothetical protein AALP_AA8G165100                    269   3e-88   Arabis alpina [alpine rockcress]
gb|AFK36754.1|  unknown                                                 269   3e-88   Lotus japonicus
ref|XP_004249887.1|  PREDICTED: 40S ribosomal protein S18-like          269   3e-88   
ref|XP_010063827.1|  PREDICTED: 40S ribosomal protein S18               269   3e-88   Eucalyptus grandis [rose gum]
ref|XP_010277280.1|  PREDICTED: 40S ribosomal protein S18               269   3e-88   Nelumbo nucifera [Indian lotus]
emb|CDX93735.1|  BnaA09g23350D                                          271   3e-88   
ref|XP_010090917.1|  40S ribosomal protein S18                          269   3e-88   Morus notabilis
gb|KDO83809.1|  hypothetical protein CISIN_1g031787mg                   269   3e-88   Citrus sinensis [apfelsine]
ref|XP_002306780.1|  hypothetical protein POPTR_0005s23280g             269   4e-88   Populus trichocarpa [western balsam poplar]
ref|XP_006419931.1|  hypothetical protein CICLE_v10006140mg             269   4e-88   Citrus clementina [clementine]
ref|XP_008811247.1|  PREDICTED: 40S ribosomal protein S18               269   4e-88   Phoenix dactylifera
ref|XP_010940044.1|  PREDICTED: 40S ribosomal protein S18-like          269   4e-88   Elaeis guineensis
gb|ACJ84050.1|  unknown                                                 269   5e-88   Medicago truncatula
ref|XP_009398529.1|  PREDICTED: 40S ribosomal protein S18               268   5e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412495.1|  PREDICTED: 40S ribosomal protein S18-like          268   5e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004290609.1|  PREDICTED: 40S ribosomal protein S18               268   5e-88   Fragaria vesca subsp. vesca
emb|CDY05078.1|  BnaC03g28760D                                          271   6e-88   
ref|XP_002520719.1|  40S ribosomal protein S18, putative                268   7e-88   Ricinus communis
ref|XP_006350987.1|  PREDICTED: 40S ribosomal protein S18-like          268   8e-88   Solanum tuberosum [potatoes]
gb|AAR83860.1|  putative ribosomal protein                              268   9e-88   Capsicum annuum
ref|XP_002282412.1|  PREDICTED: 40S ribosomal protein S18               268   9e-88   Vitis vinifera
ref|XP_004241401.1|  PREDICTED: 40S ribosomal protein S18-like          268   1e-87   Solanum lycopersicum
ref|XP_010456818.1|  PREDICTED: 40S ribosomal protein S18-like          268   1e-87   
gb|AFK34438.1|  unknown                                                 268   1e-87   Lotus japonicus
ref|XP_002302108.1|  hypothetical protein POPTR_0002s05220g             268   1e-87   Populus trichocarpa [western balsam poplar]
emb|CBI18243.3|  unnamed protein product                                269   1e-87   Vitis vinifera
ref|XP_010437984.1|  PREDICTED: 40S ribosomal protein S18-like          268   1e-87   Camelina sativa [gold-of-pleasure]
ref|XP_009408490.1|  PREDICTED: 40S ribosomal protein S18-like          267   1e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACS96445.1|  S18.A ribosomal protein                                 267   2e-87   Jatropha curcas
ref|XP_009791563.1|  PREDICTED: 40S ribosomal protein S18               267   3e-87   Nicotiana sylvestris
ref|XP_006415047.1|  hypothetical protein EUTSA_v10009003mg             266   3e-87   Eutrema salsugineum [saltwater cress]
ref|NP_001275126.1|  uncharacterized protein LOC102577535               266   3e-87   Solanum tuberosum [potatoes]
emb|CDX73288.1|  BnaC05g28180D                                          268   4e-87   
emb|CDX99504.1|  BnaC09g24880D                                          267   4e-87   
ref|XP_002976683.1|  hypothetical protein SELMODRAFT_175726             266   7e-87   Selaginella moellendorffii
gb|ADR71282.1|  40S ribosomal protein S18C                              265   8e-87   Hevea brasiliensis [jebe]
ref|XP_004235074.1|  PREDICTED: 40S ribosomal protein S18               265   8e-87   Solanum lycopersicum
ref|XP_006844400.1|  hypothetical protein AMTR_s00142p00099380          265   8e-87   
ref|XP_008776934.1|  PREDICTED: 40S ribosomal protein S18-like          265   1e-86   Phoenix dactylifera
ref|XP_011082572.1|  PREDICTED: 40S ribosomal protein S18               265   1e-86   Sesamum indicum [beniseed]
gb|EPS72546.1|  hypothetical protein M569_02206                         265   1e-86   Genlisea aurea
ref|XP_009588399.1|  PREDICTED: 40S ribosomal protein S18-like          265   1e-86   Nicotiana tomentosiformis
ref|XP_009588684.1|  PREDICTED: 40S ribosomal protein S18-like          266   1e-86   Nicotiana tomentosiformis
ref|XP_008812047.1|  PREDICTED: 40S ribosomal protein S18-like          265   2e-86   Phoenix dactylifera
emb|CDY15304.1|  BnaC06g07900D                                          265   2e-86   Brassica napus [oilseed rape]
ref|XP_008355471.1|  PREDICTED: 40S ribosomal protein S18               263   5e-86   
gb|EPS57469.1|  hypothetical protein M569_17345                         263   6e-86   Genlisea aurea
ref|XP_004299120.2|  PREDICTED: 40S ribosomal protein S18-like          265   6e-86   Fragaria vesca subsp. vesca
gb|ACM90157.1|  S18 ribosomal protein                                   263   7e-86   Jatropha curcas
ref|XP_010927869.1|  PREDICTED: 40S ribosomal protein S18-like          263   8e-86   Elaeis guineensis
ref|XP_011079871.1|  PREDICTED: 40S ribosomal protein S18-like          262   1e-85   Sesamum indicum [beniseed]
ref|NP_001151612.1|  40S ribosomal protein S18                          262   1e-85   Zea mays [maize]
gb|EYU40915.1|  hypothetical protein MIMGU_mgv1a015580mg                262   1e-85   Erythranthe guttata [common monkey flower]
ref|XP_006842219.1|  hypothetical protein AMTR_s00078p00178430          262   2e-85   
ref|NP_001141254.1|  ribosomal protein S18                              261   3e-85   Zea mays [maize]
ref|XP_002459401.1|  hypothetical protein SORBIDRAFT_02g004110          261   3e-85   Sorghum bicolor [broomcorn]
ref|NP_001051541.1|  Os03g0794700                                       261   4e-85   
ref|XP_008805387.1|  PREDICTED: 40S ribosomal protein S18-like          260   7e-85   Phoenix dactylifera
ref|XP_006650718.1|  PREDICTED: 40S ribosomal protein S18-like          260   8e-85   Oryza brachyantha
ref|XP_004955596.1|  PREDICTED: 40S ribosomal protein S18-like          260   1e-84   Setaria italica
ref|XP_004967782.1|  PREDICTED: 40S ribosomal protein S18-like          259   3e-84   Setaria italica
ref|XP_001754726.1|  predicted protein                                  259   3e-84   
ref|XP_001764970.1|  predicted protein                                  259   3e-84   
ref|XP_002973168.1|  hypothetical protein SELMODRAFT_267619             259   4e-84   
gb|ADE77437.1|  unknown                                                 259   4e-84   Picea sitchensis
ref|XP_006658321.1|  PREDICTED: 40S ribosomal protein S18-like          259   5e-84   
ref|XP_001754723.1|  predicted protein                                  258   6e-84   
ref|XP_001777119.1|  predicted protein                                  257   2e-83   
ref|XP_003557546.1|  PREDICTED: 40S ribosomal protein S18               256   3e-83   Brachypodium distachyon [annual false brome]
ref|XP_003557516.1|  PREDICTED: 40S ribosomal protein S18-like          256   6e-83   Brachypodium distachyon [annual false brome]
gb|ABK23001.1|  unknown                                                 255   8e-83   Picea sitchensis
pdb|3J60|S  Chain S, Localization Of The Small Subunit Ribosomal ...    255   1e-82   Triticum aestivum [Canadian hard winter wheat]
gb|EMT02406.1|  40S ribosomal protein S18                               256   2e-82   
gb|EMT03027.1|  40S ribosomal protein S18                               254   3e-82   
dbj|BAC24846.1|  putative ribosomal protein S18                         253   5e-82   Oryza sativa Japonica Group [Japonica rice]
emb|CBI28706.3|  unnamed protein product                                270   9e-81   Vitis vinifera
gb|EAY92162.1|  hypothetical protein OsI_13875                          251   1e-80   Oryza sativa Indica Group [Indian rice]
gb|KEH43413.1|  Vps51/Vps67 protein                                     266   1e-78   Medicago truncatula
ref|XP_008368932.1|  PREDICTED: uncharacterized protein LOC103432514    254   2e-78   
ref|XP_005850125.1|  40S ribosomal protein S18                          238   4e-76   Chlorella variabilis
ref|XP_003063790.1|  ribosomal protein S18                              237   7e-76   Micromonas pusilla CCMP1545
ref|XP_001628997.1|  predicted protein                                  235   8e-75   Nematostella vectensis
ref|XP_004140957.1|  PREDICTED: 40S ribosomal protein S18-like          234   9e-75   
ref|XP_005649180.1|  ribosomal protein S18 component of cytosolic...    234   1e-74   Coccomyxa subellipsoidea C-169
gb|KIY98606.1|  40S ribosomal protein S18                               233   7e-74   Monoraphidium neglectum
gb|KJB65872.1|  hypothetical protein B456_010G132100                    232   1e-73   Gossypium raimondii
gb|KJB65873.1|  hypothetical protein B456_010G132100                    232   2e-73   Gossypium raimondii
gb|KJB60026.1|  hypothetical protein B456_009G286200                    231   2e-73   Gossypium raimondii
ref|XP_002505748.1|  ribosomal protein S18                              231   2e-73   Micromonas commoda
gb|KDO83808.1|  hypothetical protein CISIN_1g031787mg                   229   7e-73   Citrus sinensis [apfelsine]
ref|XP_005759979.1|  hypothetical protein EMIHUDRAFT_438587             230   9e-73   Emiliania huxleyi CCMP1516
gb|KJB65871.1|  hypothetical protein B456_010G132100                    229   1e-72   Gossypium raimondii
emb|CEG02178.1|  Ribosomal protein S13                                  229   1e-72   Ostreococcus tauri
gb|KEH43645.1|  ribosomal protein S13P/S18e                             228   2e-72   Medicago truncatula
gb|KDD73975.1|  ribosomal protein S13/S18                               228   3e-72   Helicosporidium sp. ATCC 50920
ref|XP_001422767.1|  Ribosomal protein S18, component of cytosoli...    228   3e-72   Ostreococcus lucimarinus CCE9901
ref|XP_003741117.1|  PREDICTED: 40S ribosomal protein S18-like          228   4e-72   Galendromus occidentalis
gb|KDO74585.1|  hypothetical protein CISIN_1g031812mg                   227   5e-72   Citrus sinensis [apfelsine]
ref|XP_002609941.1|  hypothetical protein BRAFLDRAFT_114927             227   7e-72   Branchiostoma floridae
tpe|CAL69108.1|  TPA: putative 40S ribosomal protein S18                227   9e-72   Spadella cephaloptera
ref|NP_001292296.1|  40S ribosomal protein S18                          227   1e-71   Crassostrea gigas
gb|ABR23395.1|  ribosomal protein S18                                   226   2e-71   Ornithodoros parkeri
gb|AAY66885.1|  ribosomal protein S18                                   226   2e-71   Ixodes scapularis [blacklegged tick]
gb|KFM83326.1|  40S ribosomal protein S18                               226   2e-71   Stegodyphus mimosarum
ref|XP_006306532.1|  hypothetical protein CARUB_v10012556mg             225   2e-71   
ref|XP_002155929.1|  PREDICTED: 40S ribosomal protein S18-like is...    226   3e-71   Hydra vulgaris
sp|Q8IT98.1|RS18_ARGIR  RecName: Full=40S ribosomal protein S18         226   4e-71   Argopecten irradians
ref|XP_010535077.1|  PREDICTED: 40S ribosomal protein S18 isoform X2    224   4e-71   Tarenaya hassleriana [spider flower]
gb|EFX69747.1|  hypothetical protein DAPPUDRAFT_300691                  225   4e-71   Daphnia pulex
ref|XP_010651981.1|  PREDICTED: 40S ribosomal protein S18 isoform X1    225   6e-71   Vitis vinifera
ref|XP_011398352.1|  40S ribosomal protein S18                          224   1e-70   Auxenochlorella protothecoides
gb|KJB28966.1|  hypothetical protein B456_005G077200                    223   2e-70   Gossypium raimondii
gb|AAQ21388.1|  ribosomal protein S18                                   223   3e-70   Ixodes ricinus
ref|XP_002946223.1|  component of cytosolic 80S ribosome and 40S ...    222   7e-70   Volvox carteri f. nagariensis
gb|ACD65147.1|  putative 40S ribosomal protein RPS18                    221   1e-69   Phoronis muelleri
gb|AEB54647.1|  ribosomal protein S18                                   221   2e-69   Procambarus clarkii
gb|AIU94815.1|  40S ribosomal protein                                   221   2e-69   Phragmatopoma lapidosa
gb|ABW90381.1|  putative ribosomal protein S18                          221   2e-69   Sipunculus nudus
gb|ADV40077.1|  ribosomal protein S18                                   221   2e-69   Latrodectus hesperus [black widow]
gb|ELT91955.1|  hypothetical protein CAPTEDRAFT_228718                  221   2e-69   Capitella teleta
ref|XP_794924.2|  PREDICTED: 40S ribosomal protein S18-like             221   3e-69   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003385957.1|  PREDICTED: 40S ribosomal protein S18               221   3e-69   Amphimedon queenslandica
ref|XP_784070.3|  PREDICTED: 40S ribosomal protein S18-like             221   3e-69   
emb|CBN08641.1|  40S ribosomal protein S18                              220   7e-69   Microcosmus squamiger
ref|XP_003460088.1|  PREDICTED: 40S ribosomal protein S18-like          219   1e-68   Oreochromis niloticus
ref|XP_006896042.1|  PREDICTED: 40S ribosomal protein S18-like          219   1e-68   Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CBI26252.3|  unnamed protein product                                218   2e-68   Vitis vinifera
ref|XP_004073779.1|  PREDICTED: 40S ribosomal protein S18               219   2e-68   Oryzias latipes [Japanese rice fish]
ref|XP_006815995.1|  PREDICTED: 40S ribosomal protein S18-like          219   2e-68   Saccoglossus kowalevskii
ref|NP_001119689.1|  ribosomal protein S18                              218   2e-68   Acyrthosiphon pisum
dbj|BAM17725.1|  ribosomal protein S18                                  218   3e-68   Papilio xuthus [Chinese swallowtail]
gb|ACO13080.1|  40S ribosomal protein S18                               218   3e-68   Lepeophtheirus salmonis
gb|AAX48895.1|  S18                                                     218   3e-68   Suberites domuncula
ref|XP_009021356.1|  hypothetical protein HELRODRAFT_157357             218   3e-68   Helobdella robusta
ref|XP_010743696.1|  PREDICTED: 40S ribosomal protein S18               218   4e-68   Larimichthys crocea [croceine croaker]
ref|NP_775341.1|  40S ribosomal protein S18                             218   5e-68   Danio rerio [leopard danio]
gb|AGO46414.1|  ribosomal protein S18                                   218   5e-68   Reticulitermes flavipes
emb|CCD78299.1|  putative 40s ribosomal protein S18                     218   5e-68   Schistosoma mansoni
ref|XP_001696472.1|  ribosomal protein S18, component of cytosoli...    218   6e-68   Chlamydomonas reinhardtii
gb|AAW27232.1|  SJCHGC01887 protein                                     217   6e-68   Schistosoma japonicum
ref|XP_005095271.1|  PREDICTED: 40S ribosomal protein S18-like          217   6e-68   
ref|XP_003969247.1|  PREDICTED: 40S ribosomal protein S18-like          217   7e-68   Takifugu rubripes [tiger puffer]
ref|XP_004673426.1|  PREDICTED: 40S ribosomal protein S18               217   8e-68   Condylura cristata
gb|ACQ58888.1|  40S ribosomal protein S18                               217   8e-68   Anoplopoma fimbria
ref|XP_001099137.1|  PREDICTED: 40S ribosomal protein S18-like is...    217   8e-68   
ref|XP_004349731.1|  ribosomal protein S13p/S18e, putative              217   8e-68   Acanthamoeba castellanii str. Neff
gb|KIP06585.1|  hypothetical protein PHLGIDRAFT_90644                   217   9e-68   Phlebiopsis gigantea 11061_1 CR5-6
ref|NP_001037269.1|  ribosomal protein S18                              217   9e-68   Bombyx mori [silk moth]
ref|XP_005832131.1|  small subunit ribosomal protein S18e_1, cyto...    217   1e-67   Guillardia theta CCMP2712
sp|Q962R1.1|RS18_SPOFR  RecName: Full=40S ribosomal protein S18         217   1e-67   Spodoptera frugiperda
gb|ABO26686.1|  40S ribosomal protein S18                               217   1e-67   Haliotis discus discus
gb|AEE61885.1|  unknown                                                 217   1e-67   Dendroctonus ponderosae
gb|AFK49801.1|  ribosomal protein S18                                   217   1e-67   Cryptocercus punctulatus
gb|EDL00865.1|  mCG114988                                               216   1e-67   Mus musculus [mouse]
gb|ABM55460.1|  ribosomal protein S18                                   216   2e-67   Xenopsylla cheopis
ref|XP_009032954.1|  hypothetical protein AURANDRAFT_20379              216   2e-67   Aureococcus anophagefferens
ref|NP_001187081.1|  40S ribosomal protein S18                          216   2e-67   Ictalurus punctatus
ref|NP_035426.1|  40S ribosomal protein S18                             216   2e-67   Mus musculus [mouse]
gb|ACY71272.1|  ribosomal protein S18                                   216   2e-67   Chrysomela tremula
ref|XP_011505351.1|  PREDICTED: 40S ribosomal protein S18               216   2e-67   Ceratosolen solmsi marchali
ref|XP_006032333.1|  PREDICTED: 40S ribosomal protein S18               216   2e-67   Alligator sinensis
ref|XP_003271942.1|  PREDICTED: 40S ribosomal protein S18 isoform 1     217   2e-67   Nomascus leucogenys [White-cheeked Gibbon]
gb|KGB32353.1|  40S ribosomal protein S18                               217   2e-67   Schistosoma haematobium
gb|ACI70010.1|  40S ribosomal protein S18                               216   3e-67   Salmo salar
emb|CAH04336.1|  S18e ribosomal protein                                 216   3e-67   Cicindela campestris
gb|EYU40914.1|  hypothetical protein MIMGU_mgv1a015580mg                215   3e-67   Erythranthe guttata [common monkey flower]
ref|XP_001826904.1|  40S ribosomal protein S18                          216   3e-67   Aspergillus oryzae RIB40
ref|NP_001290753.1|  ribosomal protein S18                              216   3e-67   Esox lucius
emb|CCQ18669.1|  ribosomal protein S18                                  216   3e-67   Sycon ciliatum
gb|ACO11045.1|  40S ribosomal protein S18                               216   3e-67   Caligus rogercresseyi
ref|XP_007353912.1|  ribosomal protein S13                              216   3e-67   
ref|XP_007397054.1|  hypothetical protein PHACADRAFT_258160             215   4e-67   Phanerochaete carnosa HHB-10118-sp
dbj|BAE35083.1|  unnamed protein product                                215   4e-67   Mus musculus [mouse]
ref|XP_006900748.1|  PREDICTED: 40S ribosomal protein S18-like          216   4e-67   Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CDQ70124.1|  unnamed protein product                                215   4e-67   Oncorhynchus mykiss
ref|XP_005707661.1|  40S ribosomal protein S18                          215   4e-67   Galdieria sulphuraria
ref|XP_002131089.1|  PREDICTED: 40S ribosomal protein S18               215   4e-67   Ciona intestinalis [sea vase]
gb|KIM45047.1|  hypothetical protein M413DRAFT_441693                   215   5e-67   Hebeloma cylindrosporum h7
ref|XP_005558824.1|  PREDICTED: 40S ribosomal protein S18-like          215   5e-67   
ref|XP_002109240.1|  ribosomal protein S18                              215   5e-67   Trichoplax adhaerens
ref|XP_004375591.1|  PREDICTED: 40S ribosomal protein S18-like          215   5e-67   
ref|NP_001084747.1|  ribosomal protein S18                              215   5e-67   Xenopus laevis [clawed frog]
ref|NP_001016358.1|  ribosomal protein S18                              215   6e-67   Xenopus tropicalis [western clawed frog]
gb|EDL11403.1|  mCG9349                                                 214   6e-67   Mus musculus [mouse]
ref|XP_007380884.1|  ribosomal protein S13                              215   6e-67   Punctularia strigosozonata HHB-11173 SS5
emb|CDS03642.1|  Putative 40S ribosomal protein S18                     215   6e-67   Lichtheimia ramosa
gb|KDR22651.1|  40S ribosomal protein S18                               215   6e-67   Zootermopsis nevadensis
ref|XP_004410082.1|  PREDICTED: 40S ribosomal protein S18-like          215   6e-67   
gb|ACG27203.1|  40S ribosomal protein S18                               214   7e-67   Zea mays [maize]
ref|XP_005554553.1|  PREDICTED: 40S ribosomal protein S18-like          215   7e-67   Macaca fascicularis [crab eating macaque]
ref|XP_003400826.1|  PREDICTED: 40S ribosomal protein S18-like          215   7e-67   
gb|EMD37436.1|  hypothetical protein CERSUDRAFT_114091                  215   7e-67   Gelatoporia subvermispora B
gb|KIY74232.1|  ribosomal protein S13                                   214   8e-67   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_004639218.1|  PREDICTED: 40S ribosomal protein S18-like          214   8e-67   
gb|AFK10867.1|  ribosomal protein S18                                   214   8e-67   Callorhinchus milii [Australian ghost shark]
ref|XP_006998989.1|  PREDICTED: 40S ribosomal protein S18-like          215   8e-67   
gb|ACO07574.1|  40S ribosomal protein S18                               214   8e-67   Oncorhynchus mykiss
gb|AGC74031.1|  ribosomal protein S18                                   214   9e-67   Spirometra erinaceieuropaei
emb|CBN75754.1|  conserved unknown protein                              216   1e-66   Ectocarpus siliculosus
ref|XP_001258494.1|  40S ribosomal protein S18                          214   1e-66   Aspergillus fischeri NRRL 181
gb|KDR75450.1|  hypothetical protein GALMADRAFT_70039                   214   1e-66   Galerina marginata CBS 339.88
ref|XP_001392986.1|  40S ribosomal protein S18                          214   1e-66   Aspergillus niger CBS 513.88
ref|XP_011371747.1|  PREDICTED: 40S ribosomal protein S18 isoform X1    215   1e-66   Pteropus vampyrus
ref|XP_001268409.1|  40S ribosomal protein S18                          214   1e-66   Aspergillus clavatus NRRL 1
gb|KJA29077.1|  hypothetical protein HYPSUDRAFT_33600                   214   1e-66   Hypholoma sublateritium FD-334 SS-4
gb|ACO08134.1|  40S ribosomal protein S18                               214   1e-66   Oncorhynchus mykiss
emb|CDQ57410.1|  unnamed protein product                                214   1e-66   Oncorhynchus mykiss
gb|EFB14052.1|  hypothetical protein PANDA_002275                       214   1e-66   Ailuropoda melanoleuca
emb|CCM06370.1|  predicted protein                                      214   1e-66   Fibroporia radiculosa
ref|XP_008475493.1|  PREDICTED: 40S ribosomal protein S18               214   2e-66   Diaphorina citri
ref|XP_973632.1|  PREDICTED: 40S ribosomal protein S18                  214   2e-66   Tribolium castaneum [rust-red flour beetle]
gb|ABW90424.1|  putative ribosomal protein S18                          214   2e-66   Barentsia elongata
ref|XP_004417037.1|  PREDICTED: 40S ribosomal protein S18-like          214   2e-66   Odobenus rosmarus divergens
ref|XP_009044806.1|  hypothetical protein LOTGIDRAFT_198613             214   2e-66   Lottia gigantea
ref|XP_007445325.1|  PREDICTED: 40S ribosomal protein S18-like          214   2e-66   
gb|EAW79789.1|  hCG1777176, isoform CRA_b                               214   2e-66   Homo sapiens [man]
gb|EDL32411.1|  mCG116671                                               214   2e-66   Mus musculus [mouse]
gb|AAA16796.1|  ribosomal protein                                       214   2e-66   Mus musculus [mouse]
ref|XP_011061478.1|  PREDICTED: 40S ribosomal protein S18               213   2e-66   Acromyrmex echinatior
ref|XP_001557449.1|  40S ribosomal protein S18                          213   2e-66   Botrytis cinerea B05.10
ref|XP_002049081.1|  ribosomal protein S18                              213   3e-66   Drosophila virilis
ref|XP_011301543.1|  PREDICTED: 40S ribosomal protein S18               213   3e-66   Fopius arisanus
ref|XP_009238404.1|  PREDICTED: 40S ribosomal protein S18 isoform X1    213   3e-66   
dbj|GAA83121.1|  ribosomal protein S13p/S18e                            213   3e-66   Aspergillus kawachii IFO 4308
ref|XP_005891454.1|  PREDICTED: 40S ribosomal protein S18               213   3e-66   Bos mutus
gb|ELK26125.1|  40S ribosomal protein S18                               213   3e-66   Myotis davidii
ref|XP_007361751.1|  ribosomal protein S13                              213   3e-66   Dichomitus squalens LYAD-421 SS1
emb|CAJ17207.1|  ribosomal protein S18e                                 213   3e-66   Curculio glandium
sp|P49202.1|RS18_CHLRE  RecName: Full=40S ribosomal protein S18         213   3e-66   Chlamydomonas reinhardtii
gb|KIM78961.1|  hypothetical protein PILCRDRAFT_824091                  213   3e-66   Piloderma croceum F 1598
gb|EPS33138.1|  hypothetical protein PDE_08100                          213   3e-66   Penicillium oxalicum 114-2
ref|XP_002063878.1|  ribosomal protein S18                              213   3e-66   Drosophila willistoni
ref|XP_005571688.1|  PREDICTED: 40S ribosomal protein S18-like          213   3e-66   
gb|KDQ57565.1|  hypothetical protein JAAARDRAFT_35261                   213   3e-66   Jaapia argillacea MUCL 33604
ref|XP_001877692.1|  40S ribosomal protein S18                          213   3e-66   Laccaria bicolor S238N-H82
ref|XP_010568221.1|  PREDICTED: 40S ribosomal protein S18               214   3e-66   
ref|XP_008033823.1|  ribosomal protein S13                              213   4e-66   
gb|ELR59500.1|  40S ribosomal protein S18                               213   4e-66   
ref|XP_625104.2|  PREDICTED: 40S ribosomal protein S18                  214   4e-66   
emb|CEJ94964.1|  Putative 40S ribosomal protein S18                     213   5e-66   
gb|KIK46884.1|  hypothetical protein CY34DRAFT_799879                   213   5e-66   
ref|XP_007777709.1|  40S ribosomal protein S18                          214   5e-66   
gb|KDQ27849.1|  hypothetical protein PLEOSDRAFT_1089494                 213   5e-66   
ref|XP_007766863.1|  ribosomal protein S13                              213   5e-66   
ref|XP_007864522.1|  ribosomal protein S13                              213   6e-66   
ref|XP_006682076.1|  hypothetical protein BATDEDRAFT_91663              213   6e-66   
gb|AGH70203.1|  40S ribosomal protein S18                               212   6e-66   
emb|CCO29414.1|  40S ribosomal protein S18                              212   6e-66   
ref|XP_003029969.1|  40S ribosomal protein S18                          212   6e-66   
emb|CDW57924.1|  40S ribosomal protein S18                              212   7e-66   
ref|XP_009547441.1|  hypothetical protein HETIRDRAFT_320181             212   7e-66   
emb|CCE33710.1|  probable RPS18A-ribosomal protein S18.e.c4             212   7e-66   
gb|KII92342.1|  hypothetical protein PLICRDRAFT_37107                   212   8e-66   
gb|KIM64969.1|  hypothetical protein SCLCIDRAFT_1212645                 212   8e-66   
gb|EPS99864.1|  hypothetical protein FOMPIDRAFT_1024012                 212   9e-66   
ref|XP_002564133.1|  Pc22g00880                                         212   9e-66   
gb|KIL68961.1|  hypothetical protein M378DRAFT_158114                   212   9e-66   
ref|XP_007812475.1|  40S ribosomal protein S18                          212   9e-66   
ref|XP_008158316.1|  PREDICTED: 40S ribosomal protein S18               213   9e-66   
ref|XP_007725293.1|  40S ribosomal protein S18                          212   9e-66   
gb|ERZ95860.1|  hypothetical protein GLOINDRAFT_307424                  212   1e-65   
emb|CAH04337.1|  S18e ribosomal protein                                 212   1e-65   
ref|XP_002471572.1|  40S ribosomal protein S18                          212   1e-65   
ref|XP_002911694.1|  40S ribosomal protein S18                          212   1e-65   
gb|KIK03532.1|  hypothetical protein K443DRAFT_473112                   212   1e-65   
ref|XP_007317883.1|  hypothetical protein SERLADRAFT_388198             212   1e-65   
gb|KEZ42914.1|  hypothetical protein SAPIO_CDS5355                      211   1e-65   
ref|XP_007587552.1|  putative 40s ribosomal protein s18 protein         211   1e-65   
gb|AAW25879.1|  unknown                                                 211   1e-65   
ref|XP_006732184.1|  PREDICTED: 40S ribosomal protein S18-like          211   1e-65   
gb|ABM55667.1|  putative ribosomal protein S18                          211   1e-65   
gb|KIE00057.1|  40S ribosomal protein S18                               211   1e-65   
ref|XP_007922640.1|  hypothetical protein MYCFIDRAFT_59626              211   1e-65   
ref|XP_001995231.1|  GH23036                                            212   2e-65   
ref|XP_004036040.1|  PREDICTED: 40S ribosomal protein S18-like is...    211   2e-65   
gb|AFQ22730.1|  ribosomal protein S18                                   211   2e-65   
emb|CDS04881.1|  Putative 40S ribosomal protein S18                     211   2e-65   
ref|XP_008547170.1|  PREDICTED: 40S ribosomal protein S18               211   2e-65   
gb|ABN14904.1|  ribosomal protein S18                                   211   2e-65   
dbj|BAN20294.1|  ribosomal protein S18                                  211   2e-65   
ref|XP_007680706.1|  hypothetical protein BAUCODRAFT_126295             211   2e-65   
emb|CCG83472.1|  Ribosomal protein S13p/S18e                            211   2e-65   
ref|XP_002006530.1|  GI21106                                            211   2e-65   
gb|KIY50194.1|  40s ribosomal protein                                   211   2e-65   
ref|NP_001291790.1|  ribosomal protein S18                              211   2e-65   
ref|XP_004036041.1|  PREDICTED: 40S ribosomal protein S18-like is...    211   2e-65   
emb|CEL61026.1|  40S ribosomal protein S18 OS=Branchiostoma belch...    212   2e-65   
ref|XP_007801819.1|  40S ribosomal protein S18                          211   3e-65   
ref|XP_006671062.1|  40S ribosomal protein S18                          211   3e-65   
ref|XP_004590517.1|  PREDICTED: 40S ribosomal protein S18               213   3e-65   
gb|ESZ93507.1|  40S ribosomal protein S18                               211   3e-65   
gb|EPQ08797.1|  40S ribosomal protein S18                               213   3e-65   
gb|ELK16636.1|  40S ribosomal protein S18                               211   3e-65   
dbj|GAN01528.1|  40S ribosomal protein S18                              210   3e-65   
gb|KDB13450.1|  40S ribosomal protein S18                               211   3e-65   
ref|XP_005084907.1|  PREDICTED: 40S ribosomal protein S18 isoform X1    210   3e-65   
dbj|GAM42554.1|  ribosomal protein                                      210   3e-65   
gb|KIJ61360.1|  hypothetical protein HYDPIDRAFT_116124                  210   4e-65   
gb|KIN06077.1|  hypothetical protein OIDMADRAFT_24414                   210   4e-65   
emb|CDO76708.1|  hypothetical protein BN946_scf184796.g2                210   4e-65   
gb|EKV07047.1|  Ribosomal protein S13p/S18e                             210   4e-65   
ref|XP_001959038.1|  ribosomal protein S18                              210   4e-65   
ref|XP_002145841.1|  40S ribosomal protein S18                          210   4e-65   
gb|ACO25361.1|  40S ribosomal protein S18                               210   4e-65   
gb|EQL02096.1|  40S ribosomal protein S18                               210   4e-65   
emb|CDJ04819.1|  40S ribosomal protein S18                              210   4e-65   
emb|CAH04338.1|  S18e ribosomal protein                                 210   5e-65   
gb|EIE76259.1|  40S ribosomal protein S18                               210   5e-65   
gb|KIK27779.1|  hypothetical protein PISMIDRAFT_674700                  210   5e-65   
ref|NP_476964.1|  ribosomal protein S18, isoform A                      210   5e-65   
gb|KIW28684.1|  40S ribosomal protein S18                               210   5e-65   
gb|KFH67472.1|  40S ribosomal protein S18                               210   6e-65   
ref|XP_006461024.1|  hypothetical protein AGABI2DRAFT_136076            210   6e-65   
ref|XP_008601677.1|  40S ribosomal protein S18                          210   6e-65   
ref|XP_001536346.1|  40S ribosomal protein S18                          210   6e-65   
gb|EUC64359.1|  40s ribosomal protein S18                               210   6e-65   
gb|KIO10113.1|  hypothetical protein M404DRAFT_996071                   210   6e-65   
gb|EUB62489.1|  40S ribosomal protein S18                               209   6e-65   
gb|KIJ18787.1|  hypothetical protein PAXINDRAFT_167314                  210   6e-65   
gb|EMF15810.1|  40S ribosomal protein S18                               210   7e-65   
ref|XP_001361051.1|  GA21399                                            209   7e-65   
ref|XP_006889117.1|  PREDICTED: 40S ribosomal protein S18-like          211   7e-65   
ref|XP_004522823.1|  PREDICTED: 40S ribosomal protein S18-like          209   7e-65   
ref|XP_005714060.1|  unnamed protein product                            212   8e-65   
ref|XP_002835588.1|  40S ribosomal protein S18                          212   8e-65   
ref|XP_007756029.1|  40S ribosomal protein S18                          209   8e-65   
gb|ACJ13227.1|  FI09342p                                                210   8e-65   
emb|CDH51726.1|  40s ribosomal protein s18                              211   9e-65   
gb|KIK81182.1|  hypothetical protein PAXRUDRAFT_833032                  209   9e-65   
ref|XP_008214012.1|  PREDICTED: 40S ribosomal protein S18               210   9e-65   
ref|XP_001229652.1|  40S ribosomal protein S18                          209   1e-64   
gb|KIJ49643.1|  hypothetical protein M422DRAFT_161274                   209   1e-64   
ref|XP_663045.1|  hypothetical protein AN5441.2                         209   1e-64   
ref|XP_009155864.1|  40S ribosomal protein S18                          210   1e-64   
ref|XP_007308255.1|  40s ribosomal protein                              209   1e-64   
ref|XP_004649849.1|  PREDICTED: 40S ribosomal protein S18               213   1e-64   
ref|XP_005893298.1|  PREDICTED: 40S ribosomal protein S18-like          209   1e-64   
ref|XP_002794968.1|  40S ribosomal protein S18                          209   1e-64   
emb|CEP10226.1|  hypothetical protein                                   211   1e-64   
gb|EYE97130.1|  ribosomal protein S13                                   209   1e-64   
gb|EPY49731.1|  40S ribosomal protein S18                               209   1e-64   
ref|XP_006091663.1|  PREDICTED: 40S ribosomal protein S18-like          209   1e-64   
ref|XP_005185456.1|  PREDICTED: 40S ribosomal protein S18               209   2e-64   
gb|EPB81165.1|  40S ribosomal protein S18                               209   2e-64   
ref|XP_007414719.1|  hypothetical protein MELLADRAFT_91715              209   2e-64   
ref|XP_007748596.1|  40S ribosomal protein S18                          209   2e-64   
ref|XP_001249043.1|  40S ribosomal protein S18                          209   2e-64   
gb|KDQ21191.1|  hypothetical protein BOTBODRAFT_149940                  209   2e-64   
gb|EEH16763.1|  40S ribosomal protein S18                               210   2e-64   
ref|XP_002620807.1|  40S ribosomal protein S18                          208   2e-64   
ref|XP_010761686.1|  40S ribosomal protein S18                          210   2e-64   
gb|KIW43127.1|  40S ribosomal protein S18                               208   2e-64   
gb|KDE09772.1|  40S ribosomal protein S18                               208   3e-64   
ref|XP_003322588.2|  40S ribosomal protein S18                          208   3e-64   
ref|XP_004346885.1|  ribosomal protein S18                              208   3e-64   
gb|KIV96731.1|  40S ribosomal protein S18                               208   3e-64   
gb|ERG79404.1|  40s ribosomal protein s18                               208   3e-64   
gb|AAG47944.1|  ribosomal protein S18                                   207   3e-64   
ref|XP_003173423.1|  40S ribosomal protein S18                          208   3e-64   
gb|KFY75806.1|  hypothetical protein V499_04242                         209   3e-64   
dbj|GAN01168.1|  40S ribosomal protein S18                              209   3e-64   
emb|CEP18377.1|  hypothetical protein                                   208   4e-64   
gb|KGG51946.1|  hypothetical protein DI09_23p210                        215   4e-64   
ref|XP_001792669.1|  hypothetical protein SNOG_02050                    207   4e-64   
gb|EPB86574.1|  30S ribosomal protein S18e                              208   4e-64   
gb|KIW11063.1|  40S ribosomal protein S18                               207   4e-64   
ref|XP_002543505.1|  40S ribosomal protein S18                          207   4e-64   
ref|XP_007734095.1|  small subunit ribosomal protein S18e               209   4e-64   
emb|CAJ17208.1|  ribosomal protein S18e                                 207   5e-64   
gb|KHN72598.1|  40S ribosomal protein S18                               207   5e-64   
ref|XP_001212580.1|  40S ribosomal protein S18                          207   5e-64   
gb|KFX44146.1|  40S ribosomal protein S18                               208   5e-64   
ref|XP_003855088.1|  40S ribosomal protein S18                          207   5e-64   
ref|XP_003843065.1|  hypothetical protein LEMA_P088250.1                210   5e-64   
ref|XP_006963908.1|  ribosomal protein S18, S13 family                  207   5e-64   
gb|KIY48974.1|  hypothetical protein FISHEDRAFT_42292                   209   6e-64   
emb|CEG67924.1|  Putative 40S ribosomal protein S18                     207   6e-64   
emb|CDH51725.1|  40s ribosomal protein s18                              208   6e-64   
gb|AIY34643.1|  ribosomal protein                                       207   7e-64   
ref|XP_002478105.1|  40S ribosomal protein S18                          207   7e-64   
gb|EPY53735.1|  40S ribosomal protein S18                               207   7e-64   
gb|EKG12572.1|  Ribosomal protein S13                                   207   7e-64   
gb|AAM48463.1|  RH43343p                                                207   7e-64   
ref|XP_003012230.1|  hypothetical protein ARB_01490                     207   8e-64   
gb|EWM23897.1|  40s ribosomal protein s18                               211   8e-64   
ref|XP_002632603.1|  C. briggsae CBR-RPS-18 protein                     207   8e-64   
gb|KEQ77552.1|  ribosomal protein S13                                   207   8e-64   
gb|KHN79831.1|  40S ribosomal protein S18                               207   9e-64   
ref|XP_001085646.1|  PREDICTED: 40S ribosomal protein S18-like is...    207   9e-64   
gb|EPX70911.1|  40S ribosomal protein S18                               207   1e-63   
ref|XP_008084994.1|  S13-like H2TH                                      207   1e-63   
gb|ELR03350.1|  40S ribosomal protein S18                               207   1e-63   
ref|XP_008720110.1|  40S ribosomal protein S18                          207   1e-63   
ref|XP_001908038.1|  hypothetical protein                               209   1e-63   
ref|XP_009263158.1|  hypothetical protein FPSE_11766                    207   1e-63   
gb|KIV82408.1|  40S ribosomal protein S18                               206   1e-63   
gb|KJE94571.1|  ribosomal protein S18                                   207   1e-63   
ref|XP_007793832.1|  putative 40s ribosomal protein s18 protein         206   1e-63   
gb|ETN74504.1|  ribosomal protein S13p/S18e                             206   1e-63   
gb|KEQ67331.1|  ribosomal protein S13                                   206   1e-63   
gb|EYC34968.1|  hypothetical protein Y032_1224g3767                     206   1e-63   
ref|XP_003710559.1|  40S ribosomal protein S18                          206   1e-63   
ref|XP_002287127.1|  RS18, ribosomal protein 18 40S small ribosom...    206   2e-63   
emb|CDP32181.1|  Putative cytosolic 40S ribosomal protein Rps18         206   2e-63   
ref|XP_002845129.1|  40S ribosomal protein S18                          206   2e-63   
dbj|BAC56379.1|  similar to 40S ribosomal protein S18                   205   2e-63   
ref|XP_003143525.1|  40S ribosomal protein S18                          206   2e-63   
gb|KFY41976.1|  hypothetical protein V494_02668                         207   2e-63   
emb|CEG68275.1|  Putative 30S ribosomal protein S18e                    206   2e-63   
ref|XP_009217383.1|  40S ribosomal protein S18                          206   2e-63   
ref|XP_003655125.1|  40S ribosomal protein S18                          206   2e-63   
gb|EYC34969.1|  hypothetical protein Y032_1224g3767                     206   2e-63   
emb|CDR35987.1|  RHTO0S01e11628g1_1                                     206   3e-63   
ref|XP_006693104.1|  putative ribosomal protein                         206   3e-63   
gb|KFY16020.1|  hypothetical protein V492_01622                         207   3e-63   
gb|KIX92301.1|  40S ribosomal protein S18                               206   3e-63   
ref|NP_596506.1|  40S ribosomal protein S18                             205   3e-63   
ref|XP_005590547.1|  PREDICTED: 40S ribosomal protein S18-like is...    205   4e-63   
ref|XP_001940789.1|  40S ribosomal protein S18                          205   4e-63   
ref|NP_502794.1|  Protein RPS-18                                        205   4e-63   
gb|AEK48265.1|  ribosomal protein L32e                                  205   5e-63   
gb|KIW04836.1|  40S ribosomal protein S18                               205   5e-63   
ref|XP_002174049.1|  40S ribosomal protein S18                          205   5e-63   
ref|XP_956794.2|  40S ribosomal protein S18                             205   5e-63   
gb|AHL21607.1|  ribosomal protein S18                                   205   5e-63   
dbj|GAN03332.1|  40S ribosomal protein S18                              207   5e-63   
gb|KIM30717.1|  hypothetical protein M408DRAFT_328230                   205   6e-63   
ref|XP_007707932.1|  hypothetical protein COCCADRAFT_22727              205   6e-63   
gb|EHH30448.1|  hypothetical protein EGK_11121                          204   6e-63   
ref|XP_007849039.1|  40s ribosomal protein s18                          204   7e-63   
ref|XP_001900844.1|  40S ribosomal protein S18                          204   7e-63   
ref|XP_007834807.1|  40S ribosomal protein S18                          204   7e-63   
gb|KIW88905.1|  40S ribosomal protein S18                               205   9e-63   
gb|EJU04466.1|  40s ribosomal protein                                   204   9e-63   
gb|EMS24561.1|  40S ribosomal protein s18                               204   9e-63   
emb|CEI86008.1|  Putative 30S ribosomal protein S18e                    204   1e-62   
emb|CDJ97946.1|  Ribosomal protein S13 domain containing protein        204   1e-62   
ref|XP_007266340.1|  40s ribosomal protein                              204   1e-62   
ref|XP_004409843.1|  PREDICTED: 40S ribosomal protein S18-like          204   1e-62   
ref|XP_005535118.1|  40S ribosomal protein S18                          204   1e-62   
ref|XP_003088206.1|  hypothetical protein CRE_02774                     204   1e-62   
emb|CBY18237.1|  unnamed protein product                                203   2e-62   
dbj|GAM23004.1|  hypothetical protein SAMD00019534_061790               204   2e-62   
emb|CDP95567.1|  Protein BM-RPS-18, isoform c                           204   2e-62   
ref|XP_503080.2|  40S ribosomal protein S18                             203   2e-62   
emb|CDS31408.1|  40S ribosomal protein S18                              203   2e-62   
ref|XP_004058669.1|  PREDICTED: 40S ribosomal protein S18-like          207   2e-62   
gb|EME47068.1|  hypothetical protein DOTSEDRAFT_165834                  203   2e-62   
gb|KFY85570.1|  hypothetical protein V500_08304                         208   2e-62   
gb|KIW74604.1|  40S ribosomal protein S18                               204   2e-62   
ref|XP_007687976.1|  hypothetical protein COCMIDRAFT_36772              203   2e-62   
ref|XP_009163741.1|  hypothetical protein T265_01451                    204   2e-62   
ref|XP_011124432.1|  hypothetical protein AOL_s00097g297                203   3e-62   
ref|XP_626806.1|  ribosomal protein S18A, rps18ap, HhH domain           203   3e-62   
gb|EPY84280.1|  beta-1,3-galactosyltransferase 4-like protein           214   3e-62   
gb|ACS68665.1|  ribosomal protein S18                                   201   3e-62   



>ref|XP_010535069.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Tarenaya hassleriana]
Length=152

 Score =   276 bits (705),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010666932.1| PREDICTED: 40S ribosomal protein S18 [Beta vulgaris subsp. vulgaris]
Length=152

 Score =   276 bits (705),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFAMTSIKGIGRR+ANICCKKADIDMNKRAGELT
Sbjct  1    MSLVANEEFQHILRLLNTNVDGKQKIMFAMTSIKGIGRRYANICCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMTVVANPRQFKVPDWFLNRQKDYKDG YSQV+SN LDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTVVANPRQFKVPDWFLNRQKDYKDGRYSQVLSNQLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010534126.1| PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana]
 ref|XP_010538910.1| PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana]
Length=152

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus]
 ref|XP_004169553.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus]
 ref|XP_008456747.1| PREDICTED: 40S ribosomal protein S18 [Cucumis melo]
 ref|XP_008461916.1| PREDICTED: 40S ribosomal protein S18 [Cucumis melo]
 gb|KGN44457.1| hypothetical protein Csa_7G293750 [Cucumis sativus]
 gb|KGN46116.1| hypothetical protein Csa_6G055370 [Cucumis sativus]
Length=152

 Score =   274 bits (701),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM VVANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|KHN46413.1| 40S ribosomal protein S18 [Glycine soja]
Length=152

 Score =   274 bits (701),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D++MTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_007019598.1| S18 ribosomal protein [Theobroma cacao]
 ref|XP_007019599.1| S18 ribosomal protein isoform 1 [Theobroma cacao]
 ref|XP_007019600.1| S18 ribosomal protein isoform 1 [Theobroma cacao]
 gb|EOY16823.1| S18 ribosomal protein [Theobroma cacao]
 gb|EOY16824.1| S18 ribosomal protein isoform 1 [Theobroma cacao]
 gb|EOY16825.1| S18 ribosomal protein isoform 1 [Theobroma cacao]
 gb|KHG02167.1| 40S ribosomal S18 -like protein [Gossypium arboreum]
 gb|KHG03705.1| 40S ribosomal S18 -like protein [Gossypium arboreum]
 gb|KHG04314.1| 40S ribosomal S18 -like protein [Gossypium arboreum]
 gb|KJB28965.1| hypothetical protein B456_005G077200 [Gossypium raimondii]
 gb|KJB59488.1| hypothetical protein B456_009G258700 [Gossypium raimondii]
 gb|KJB60024.1| hypothetical protein B456_009G286200 [Gossypium raimondii]
 gb|KJB60025.1| hypothetical protein B456_009G286200 [Gossypium raimondii]
 gb|KJB65874.1| hypothetical protein B456_010G132100 [Gossypium raimondii]
Length=152

 Score =   274 bits (700),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AQELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus communis]
 gb|EEF38080.1| 40S ribosomal protein S18, putative [Ricinus communis]
Length=152

 Score =   274 bits (700),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMVIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|NP_001238100.1| uncharacterized protein LOC100306646 [Glycine max]
 gb|ACU14930.1| unknown [Glycine max]
 gb|KHN17038.1| 40S ribosomal protein S18 [Glycine soja]
Length=152

 Score =   273 bits (699),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFAMTSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D++MTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_002307515.1| 40S ribosomal protein S18 [Populus trichocarpa]
 gb|EEE94511.1| 40S ribosomal protein S18 [Populus trichocarpa]
Length=152

 Score =   273 bits (699),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRF+NI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFSNIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010692226.1| PREDICTED: 40S ribosomal protein S18-like [Beta vulgaris subsp. 
vulgaris]
Length=152

 Score =   273 bits (699),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFAMTSIKGIGRR+ANICCKKADIDMNKRAGELT
Sbjct  1    MSLVANEEFQHILRLLNTNVDGKQKIMFAMTSIKGIGRRYANICCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMTVVANPRQFK+PDWFLNRQKDYKDG +SQV+SN LDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTVVANPRQFKIPDWFLNRQKDYKDGRFSQVLSNQLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_007225841.1| hypothetical protein PRUPE_ppa011659mg [Prunus persica]
 gb|EMJ27040.1| hypothetical protein PRUPE_ppa011659mg [Prunus persica]
Length=202

 Score =   275 bits (703),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 158/178 (89%), Gaps = 4/178 (2%)
 Frame = -2

Query  675  EPQPFVHSSGIQFSGERERGEK-AIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIK  499
             P    H+       +RER    A  MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIK
Sbjct  28   SPGALAHTHA---ESQRERANPNAATMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIK  84

Query  498  GIGRRFANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGN  319
            GIGRRFANI CKKAD+DMNKRAGEL+AAE+DNLMT+VANPRQFK+PDWFLNR+KDYKDG 
Sbjct  85   GIGRRFANIVCKKADVDMNKRAGELSAAELDNLMTIVANPRQFKIPDWFLNRKKDYKDGK  144

Query  318  YSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            YSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  145  YSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  202



>emb|CDO99058.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   275 bits (703),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  612  KAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRA  433
            K + M+LVANE+FQHILRI NTNVDGKQK+MFA+TSIKGIGRRFANI CKKAD+DMNKRA
Sbjct  51   KTLTMALVANEEFQHILRIQNTNVDGKQKVMFALTSIKGIGRRFANIICKKADVDMNKRA  110

Query  432  GELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKK  253
            GEL+AAEIDNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKK
Sbjct  111  GELSAAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKK  170

Query  252  IRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            IRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  171  IRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  206



>ref|XP_010542963.1| PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana]
 ref|XP_010530129.1| PREDICTED: 40S ribosomal protein S18-like [Tarenaya hassleriana]
Length=152

 Score =   273 bits (698),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMT+VANPRQFK+PDWFLNRQKDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004496437.1| PREDICTED: 40S ribosomal protein S18-like [Cicer arietinum]
 ref|XP_004496465.1| PREDICTED: 40S ribosomal protein S18-like [Cicer arietinum]
Length=152

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMTVVANPRQFK+PDWFLNR+KDYKDG +SQVVSN+LDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTVVANPRQFKIPDWFLNRKKDYKDGKFSQVVSNSLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006288747.1| hypothetical protein CARUB_v10002063mg, partial [Capsella rubella]
 gb|EOA21645.1| hypothetical protein CARUB_v10002063mg, partial [Capsella rubella]
Length=183

 Score =   274 bits (700),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  606  IIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            I MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGE
Sbjct  30   IKMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIACKKADVDMNKRAGE  89

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            L+AAEIDNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  90   LSAAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  149

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  150  NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  183



>gb|KDP36554.1| hypothetical protein JCGZ_08321 [Jatropha curcas]
Length=152

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMVIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycine max]
 gb|ACU14871.1| unknown [Glycine max]
 gb|KHN46390.1| 40S ribosomal protein S18 [Glycine soja]
Length=152

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFAMTSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D++MTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana]
 ref|NP_192718.1| 40S ribosomal protein S18 [Arabidopsis thaliana]
 ref|NP_564434.1| 40S ribosomal protein S18 [Arabidopsis thaliana]
 ref|XP_002872461.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002890533.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002893800.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010460045.1| PREDICTED: 40S ribosomal protein S18 [Camelina sativa]
 sp|P34788.1|RS18_ARATH RecName: Full=40S ribosomal protein S18 [Arabidopsis thaliana]
 gb|AAG12534.1|AC015446_15 ribosomal protein S18 [Arabidopsis thaliana]
 gb|AAG12853.1|AC079286_10 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana]
 gb|AAK62386.1|AF386941_1 S18.A ribosomal protein [Arabidopsis thaliana]
 gb|AAL06471.1|AF411781_1 At1g22780/T22J18_5 [Arabidopsis thaliana]
 emb|CAA80684.1| ribosomal protein S18A [Arabidopsis thaliana]
 emb|CAA82273.1| S18 ribosomal protein [Arabidopsis thaliana]
 emb|CAA82274.1| S18 ribosomal protein [Arabidopsis thaliana]
 emb|CAA82275.1| S18 ribosomal protein [Arabidopsis thaliana]
 emb|CAA72909.1| ribosomal protein S18A [Arabidopsis thaliana]
 gb|AAC25506.1| Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from 
A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 
come from this gene [Arabidopsis thaliana]
 emb|CAB39647.1| S18.A ribosomal protein [Arabidopsis thaliana]
 emb|CAB78103.1| S18.A ribosomal protein [Arabidopsis thaliana]
 gb|AAK59471.1| putative ribosomal protein S18 [Arabidopsis thaliana]
 gb|AAL47500.1| putative ribosomal protein S18 [Arabidopsis thaliana]
 gb|AAM63849.1| ribosomal protein S18, putative [Arabidopsis thaliana]
 gb|AAM64403.1| ribosomal protein S18, putative [Arabidopsis thaliana]
 gb|AAM64976.1| ribosomal protein S18, putative [Arabidopsis thaliana]
 gb|AAP21347.1| At4g09800 [Arabidopsis thaliana]
 gb|AAV84519.1| At1g22780 [Arabidopsis thaliana]
 gb|ABF59028.1| At1g22780 [Arabidopsis thaliana]
 gb|ABP96570.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96571.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96572.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96573.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96574.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96575.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96576.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96577.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96578.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96579.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96580.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96581.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96582.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96583.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96584.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96585.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96586.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96587.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96588.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96589.1| pointed first leaf [Arabidopsis thaliana]
 gb|ABP96590.1| pointed first leaf [Arabidopsis thaliana]
 gb|EFH48720.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66792.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70059.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30287.1| 40S ribosomal protein S18 [Arabidopsis thaliana]
 gb|AEE31659.1| 40S ribosomal protein S18 [Arabidopsis thaliana]
 gb|AEE82800.1| 40S ribosomal protein S18 [Arabidopsis thaliana]
Length=152

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010090421.1| 40S ribosomal protein S18 [Morus notabilis]
 gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis]
Length=225

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 157/175 (90%), Gaps = 7/175 (4%)
 Frame = -2

Query  669  QPFVHSSGIQFSGERERGEKAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIG  490
            +P +H S   F  E      A+ MSLV NEDFQHILR+LNTNVDGKQKIMFA+TSIKGIG
Sbjct  58   RPHIHRSSF-FRSE------ALAMSLVTNEDFQHILRVLNTNVDGKQKIMFALTSIKGIG  110

Query  489  RRFANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQ  310
            RRFANI CKKAD+DMNKRAGEL+AAE+D LMT+VANPRQFK+PDWFLNR+KDYKDG YSQ
Sbjct  111  RRFANIVCKKADVDMNKRAGELSAAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQ  170

Query  309  VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  171  VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  225



>gb|KHN17014.1| 40S ribosomal protein S18 [Glycine soja]
Length=152

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFAMTSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D++MTVVANPRQFK+P+WFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSVMTVVANPRQFKIPNWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_011044275.1| PREDICTED: 40S ribosomal protein S18 [Populus euphratica]
Length=152

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRF+NI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFSNIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AVELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CDX86893.1| BnaA09g22830D [Brassica napus]
Length=187

 Score =   273 bits (698),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  606  IIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            I MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGE
Sbjct  34   ITMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGE  93

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            L+AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  94   LSAAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  153

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  154  NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  187



>ref|XP_006574786.1| PREDICTED: 40S ribosomal protein S18 [Glycine max]
 gb|KHN00737.1| 40S ribosomal protein S18 [Glycine soja]
Length=152

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D++MTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AIELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004489927.1| PREDICTED: 40S ribosomal protein S18-like [Cicer arietinum]
Length=152

 Score =   271 bits (694),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIACKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DN+MTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSN+LDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNIMTVVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNSLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_008224314.1| PREDICTED: 40S ribosomal protein S18 [Prunus mume]
 ref|XP_008390888.1| PREDICTED: 40S ribosomal protein S18 [Malus domestica]
 ref|XP_008340984.1| PREDICTED: 40S ribosomal protein S18 [Malus domestica]
 ref|XP_009369842.1| PREDICTED: 40S ribosomal protein S18 [Pyrus x bretschneideri]
 ref|XP_009344099.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344100.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Pyrus x bretschneideri]
Length=152

 Score =   271 bits (694),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTIVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010932756.1| PREDICTED: 40S ribosomal protein S18 [Elaeis guineensis]
 ref|XP_010911769.1| PREDICTED: 40S ribosomal protein S18 [Elaeis guineensis]
Length=152

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLIANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTVVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citrus clementina]
 ref|XP_006473109.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis]
 gb|ESR47760.1| hypothetical protein CICLE_v10002764mg [Citrus clementina]
 gb|KDO83807.1| hypothetical protein CISIN_1g031787mg [Citrus sinensis]
Length=152

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM VVANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CDY28390.1| BnaA05g18500D [Brassica napus]
Length=209

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 5/172 (3%)
 Frame = -2

Query  660  VHSSGIQFSGERERGEKAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRF  481
             HSS    S  R+R      MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR 
Sbjct  43   THSSPSGTSSLRDR-----TMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRL  97

Query  480  ANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVS  301
            ANI CKKAD+DMNKRAGEL+AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVS
Sbjct  98   ANIVCKKADVDMNKRAGELSAAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVS  157

Query  300  NALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            NALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  158  NALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  209



>ref|NP_001235572.1| uncharacterized protein LOC100306474 [Glycine max]
 gb|ACU14674.1| unknown [Glycine max]
Length=152

 Score =   271 bits (693),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRF+NICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFSNICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D++MTVVANPRQ K+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSVMTVVANPRQLKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010057300.1| PREDICTED: 40S ribosomal protein S18-like [Eucalyptus grandis]
 ref|XP_010057419.1| PREDICTED: 40S ribosomal protein S18-like [Eucalyptus grandis]
 gb|KCW74416.1| hypothetical protein EUGRSUZ_E03104 [Eucalyptus grandis]
 gb|KCW74583.1| hypothetical protein EUGRSUZ_E03299 [Eucalyptus grandis]
Length=152

 Score =   271 bits (692),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMVIVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006305745.1| hypothetical protein CARUB_v10010553mg [Capsella rubella]
 gb|EOA38643.1| hypothetical protein CARUB_v10010553mg [Capsella rubella]
Length=152

 Score =   271 bits (692),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIACKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLM++VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMSIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|AFK43302.1| unknown [Lotus japonicus]
Length=152

 Score =   271 bits (692),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DN+MTVVANP+QFK+PDWFLNR+KDYKDG Y QVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNVMTVVANPKQFKIPDWFLNRKKDYKDGKYHQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CDX90736.1| BnaA03g24160D [Brassica napus]
Length=185

 Score =   272 bits (695),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  606  IIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            I MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGE
Sbjct  32   ITMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGE  91

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            L+AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  92   LSAAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  151

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  152  NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  185



>ref|XP_010256035.1| PREDICTED: 40S ribosomal protein S18-like [Nelumbo nucifera]
Length=152

 Score =   271 bits (692),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010421886.1| PREDICTED: 40S ribosomal protein S18 [Camelina sativa]
Length=152

 Score =   270 bits (691),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLM++VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMSIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|KFK44369.1| hypothetical protein AALP_AA1G248300 [Arabis alpina]
Length=152

 Score =   270 bits (691),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+ NTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVYNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQV+SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVISNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|AAK43840.1|AF370463_1 S18.A ribosomal protein [Arabidopsis thaliana]
 gb|AAL47385.1| S18.A ribosomal protein [Arabidopsis thaliana]
Length=152

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKK D+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKTDVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_003592517.1| 40S ribosomal protein S18 [Medicago truncatula]
 gb|AFK42264.1| unknown [Medicago truncatula]
 gb|KEH26049.1| ribosomal protein S13P/S18e [Medicago truncatula]
Length=152

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKI FAMTSIKGIGRRFANICCKKAD+DMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIQFAMTSIKGIGRRFANICCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++N+MTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSN LDMKLRDDLERLKKIRNH
Sbjct  61   AAELENIMTVVANPRQFKVPDWFLNRKKDYKDGKFSQVVSNQLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_003592049.1| 40S ribosomal protein S18 [Medicago truncatula]
 ref|XP_003592054.1| 40S ribosomal protein S18 [Medicago truncatula]
 gb|ACJ85981.1| unknown [Medicago truncatula]
 gb|AES62300.1| ribosomal protein S13P/S18e [Medicago truncatula]
 gb|AES62305.1| ribosomal protein S13P/S18e [Medicago truncatula]
 gb|AFK46616.1| unknown [Medicago truncatula]
Length=152

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKI FAMTSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIQFAMTSIKGIGRRFANICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DN+MTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSN LDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNIMTVVANPRQFKVPDWFLNRKKDYKDGKFSQVVSNQLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_009134165.1| PREDICTED: 40S ribosomal protein S18 [Brassica rapa]
 ref|XP_009145157.1| PREDICTED: 40S ribosomal protein S18 [Brassica rapa]
 ref|XP_009113572.1| PREDICTED: 40S ribosomal protein S18 [Brassica rapa]
 ref|XP_009114767.1| PREDICTED: 40S ribosomal protein S18 [Brassica rapa]
Length=152

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_007143544.1| hypothetical protein PHAVU_007G080500g [Phaseolus vulgaris]
 ref|XP_007143576.1| hypothetical protein PHAVU_007G083400g [Phaseolus vulgaris]
 gb|ESW15538.1| hypothetical protein PHAVU_007G080500g [Phaseolus vulgaris]
 gb|ESW15570.1| hypothetical protein PHAVU_007G083400g [Phaseolus vulgaris]
Length=152

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+LVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFAN+ CKKAD+DMNKRAGEL+
Sbjct  1    MALVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANMVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTVVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_007200472.1| hypothetical protein PRUPE_ppa012853mg [Prunus persica]
 ref|XP_008235305.1| PREDICTED: 40S ribosomal protein S18-like [Prunus mume]
 gb|EMJ01671.1| hypothetical protein PRUPE_ppa012853mg [Prunus persica]
Length=152

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGK+KIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKKKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_008368832.1| PREDICTED: 40S ribosomal protein S18-like [Malus domestica]
 ref|XP_008386481.1| PREDICTED: 40S ribosomal protein S18-like [Malus domestica]
 ref|XP_009367625.1| PREDICTED: 40S ribosomal protein S18-like [Pyrus x bretschneideri]
 ref|XP_009370808.1| PREDICTED: 40S ribosomal protein S18-like [Pyrus x bretschneideri]
Length=152

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D LMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010498762.1| PREDICTED: 40S ribosomal protein S18-like [Camelina sativa]
 ref|XP_010499943.1| PREDICTED: 40S ribosomal protein S18-like [Camelina sativa]
 ref|XP_010461222.1| PREDICTED: 40S ribosomal protein S18-like [Camelina sativa]
 ref|XP_010477547.1| PREDICTED: 40S ribosomal protein S18-like [Camelina sativa]
 ref|XP_010478821.1| PREDICTED: 40S ribosomal protein S18-like [Camelina sativa]
Length=152

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMNIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|KFK25815.1| hypothetical protein AALP_AA8G165100 [Arabis alpina]
 gb|KFK32045.1| hypothetical protein AALP_AA6G193000 [Arabis alpina]
Length=152

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMNIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|AFK36754.1| unknown [Lotus japonicus]
Length=152

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANICCKK D+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKTDVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DN+MTVVANP+QFK+PDWFLNR+KDYKDG Y QVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNVMTVVANPKQFKIPDWFLNRKKDYKDGKYHQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004249887.1| PREDICTED: 40S ribosomal protein S18-like [Solanum lycopersicum]
Length=152

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010063827.1| PREDICTED: 40S ribosomal protein S18 [Eucalyptus grandis]
 gb|KCW71091.1| hypothetical protein EUGRSUZ_F04189 [Eucalyptus grandis]
Length=152

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMVIVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010277280.1| PREDICTED: 40S ribosomal protein S18 [Nelumbo nucifera]
 ref|XP_010261022.1| PREDICTED: 40S ribosomal protein S18 [Nelumbo nucifera]
 ref|XP_010268582.1| PREDICTED: 40S ribosomal protein S18 [Nelumbo nucifera]
Length=152

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CDX93735.1| BnaA09g23350D [Brassica napus]
Length=199

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  48   MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  107

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  108  AAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  167

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  168  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  199



>ref|XP_010090917.1| 40S ribosomal protein S18 [Morus notabilis]
 gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis]
Length=152

 Score =   269 bits (687),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AQELDTLMTIVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|KDO83809.1| hypothetical protein CISIN_1g031787mg [Citrus sinensis]
Length=153

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+A
Sbjct  3    SLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSA  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
            AE+DNLM VVANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNHR
Sbjct  63   AELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  123  GLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  153



>ref|XP_002306780.1| hypothetical protein POPTR_0005s23280g [Populus trichocarpa]
 ref|XP_011032690.1| PREDICTED: 40S ribosomal protein S18-like [Populus euphratica]
 gb|ABK92692.1| unknown [Populus trichocarpa]
 gb|EEE93776.1| hypothetical protein POPTR_0005s23280g [Populus trichocarpa]
Length=152

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AEELDKLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citrus clementina]
 ref|XP_006489386.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis]
 gb|ESR33171.1| hypothetical protein CICLE_v10006140mg [Citrus clementina]
 gb|KDO74584.1| hypothetical protein CISIN_1g031812mg [Citrus sinensis]
Length=152

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D LM VVANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDQLMVVVANPRQFKIPDWFLNRQKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_008811247.1| PREDICTED: 40S ribosomal protein S18 [Phoenix dactylifera]
Length=152

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ NEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLIVNEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010940044.1| PREDICTED: 40S ribosomal protein S18-like [Elaeis guineensis]
Length=152

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ANEDFQHILR+LNTNVDGKQKIM A+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLIANEDFQHILRVLNTNVDGKQKIMIALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTVVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|ACJ84050.1| unknown [Medicago truncatula]
Length=152

 Score =   269 bits (687),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKI FAMTSIKGIGRRFANICCKKAD+DMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIQFAMTSIKGIGRRFANICCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
             AE++N+MTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSN LDMKLRDDLERLKKIRNH
Sbjct  61   VAELENIMTVVANPRQFKVPDWFLNRKKDYKDGKFSQVVSNQLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_009398529.1| PREDICTED: 40S ribosomal protein S18 [Musa acuminata subsp. malaccensis]
Length=152

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGE++
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGEIS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_009412495.1| PREDICTED: 40S ribosomal protein S18-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418949.1| PREDICTED: 40S ribosomal protein S18-like [Musa acuminata subsp. 
malaccensis]
Length=152

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMTVVANPRQFK+PDWFLNR+KDYKDG YSQ+VSN+LDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTVVANPRQFKIPDWFLNRKKDYKDGRYSQIVSNSLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004290609.1| PREDICTED: 40S ribosomal protein S18 [Fragaria vesca subsp. vesca]
Length=152

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFAMTSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLMT+V NPRQFK+PDWFLNR+KDYKDG YSQVV+NALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMTIVGNPRQFKIPDWFLNRKKDYKDGRYSQVVANALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CDY05078.1| BnaC03g28760D [Brassica napus]
Length=232

 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  606  IIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            I MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGE
Sbjct  79   ITMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGE  138

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            L+AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  139  LSAAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  198

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  199  NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  232



>ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus communis]
 gb|EEF41681.1| 40S ribosomal protein S18, putative [Ricinus communis]
 gb|ADR71281.1| 40S ribosomal protein S18A [Hevea brasiliensis]
Length=152

 Score =   268 bits (686),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AEELDKLMVIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006350987.1| PREDICTED: 40S ribosomal protein S18-like [Solanum tuberosum]
Length=152

 Score =   268 bits (685),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|AAR83860.1| putative ribosomal protein [Capsicum annuum]
Length=152

 Score =   268 bits (685),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_002282412.1| PREDICTED: 40S ribosomal protein S18 [Vitis vinifera]
 ref|XP_002262702.1| PREDICTED: 40S ribosomal protein S18 [Vitis vinifera]
 ref|XP_003632303.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Vitis vinifera]
Length=152

 Score =   268 bits (685),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004241401.1| PREDICTED: 40S ribosomal protein S18-like [Solanum lycopersicum]
Length=152

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDM+KRAGELT
Sbjct  1    MSLVANEDFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010456818.1| PREDICTED: 40S ribosomal protein S18-like [Camelina sativa]
Length=153

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -2

Query  603  IMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGEL  424
            + SLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL
Sbjct  1    MQSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGEL  60

Query  423  TAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRN  244
            +AAEIDNLM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRN
Sbjct  61   SAAEIDNLMNIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRN  120

Query  243  HRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  153



>gb|AFK34438.1| unknown [Lotus japonicus]
Length=152

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DN+MTVVANP+QFK+PDWFLNR+KDYKDG Y QVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNVMTVVANPKQFKIPDWFLNRKKDYKDGKYHQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLR RGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRGRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_002302108.1| hypothetical protein POPTR_0002s05220g [Populus trichocarpa]
 ref|XP_011026149.1| PREDICTED: 40S ribosomal protein S18-like [Populus euphratica]
 gb|ABK92651.1| unknown [Populus trichocarpa]
 gb|EEE81381.1| hypothetical protein POPTR_0002s05220g [Populus trichocarpa]
Length=152

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+LVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MALVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AEELDKLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CBI18243.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  609  AIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            A  MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAG
Sbjct  40   ASTMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAG  99

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL+AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKI
Sbjct  100  ELSAAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKI  159

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  160  RNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  194



>ref|XP_010437984.1| PREDICTED: 40S ribosomal protein S18-like [Camelina sativa]
Length=152

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEID LM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDTLMNIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_009408490.1| PREDICTED: 40S ribosomal protein S18-like [Musa acuminata subsp. 
malaccensis]
Length=152

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGE++
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGEIS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMTVVANPRQFK+PDWFLNR+KDYKDG YSQ+VSN+LDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTVVANPRQFKIPDWFLNRKKDYKDGRYSQIVSNSLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|ACS96445.1| S18.A ribosomal protein [Jatropha curcas]
 gb|KDP21443.1| hypothetical protein JCGZ_21914 [Jatropha curcas]
Length=152

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AEELDKLMVIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_009791563.1| PREDICTED: 40S ribosomal protein S18 [Nicotiana sylvestris]
Length=152

 Score =   267 bits (682),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006415047.1| hypothetical protein EUTSA_v10009003mg [Eutrema salsugineum]
 ref|XP_006397143.1| hypothetical protein EUTSA_v10029039mg [Eutrema salsugineum]
 gb|ESQ33400.1| hypothetical protein EUTSA_v10009003mg [Eutrema salsugineum]
 gb|ESQ38596.1| hypothetical protein EUTSA_v10029039mg [Eutrema salsugineum]
Length=152

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRMANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQV+SN LDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVLSNGLDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|NP_001275126.1| uncharacterized protein LOC102577535 [Solanum tuberosum]
 gb|ABA46765.1| unknown [Solanum tuberosum]
Length=152

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDM+KRAGELT
Sbjct  1    MSLVANEEFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CDX73288.1| BnaC05g28180D [Brassica napus]
Length=188

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVAN++FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  37   MSLVANDEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  96

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  97   AAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  156

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  157  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  188



>emb|CDX99504.1| BnaC09g24880D [Brassica napus]
Length=187

 Score =   267 bits (683),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  609  AIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            A  +SLVAN++FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAG
Sbjct  33   ATAISLVANDEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAG  92

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL+AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKI
Sbjct  93   ELSAAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKI  152

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  153  RNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  187



>ref|XP_002976683.1| hypothetical protein SELMODRAFT_175726 [Selaginella moellendorffii]
 gb|EFJ22352.1| hypothetical protein SELMODRAFT_175726 [Selaginella moellendorffii]
Length=152

 Score =   266 bits (679),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV+NE+FQHILR+LNTNVDG+QKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVSNEEFQHILRVLNTNVDGRQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVV+NALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVANALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKR  152



>gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis]
Length=152

 Score =   265 bits (678),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AEELDKLMVIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG RHYWGLRVRGQHTKT GRRGKTVGVSKKR
Sbjct  121  RGFRHYWGLRVRGQHTKTPGRRGKTVGVSKKR  152



>ref|XP_004235074.1| PREDICTED: 40S ribosomal protein S18 [Solanum lycopersicum]
 ref|XP_006355143.1| PREDICTED: 40S ribosomal protein S18-like [Solanum tuberosum]
 ref|XP_009599634.1| PREDICTED: 40S ribosomal protein S18 [Nicotiana tomentosiformis]
 ref|XP_009784270.1| PREDICTED: 40S ribosomal protein S18-like [Nicotiana sylvestris]
Length=152

 Score =   265 bits (678),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+ NTNVDGKQKIMFA+TSIKGIGRRFANI CKKADIDMNKRAGELT
Sbjct  1    MSLVANEEFQHILRVQNTNVDGKQKIMFALTSIKGIGRRFANIACKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D++M VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSVMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006844400.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda]
 gb|ERN06075.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda]
Length=152

 Score =   265 bits (678),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ANEDFQHILR+LNTNVDG+QKIMFA+TSIKGIGRRFANI CKKADIDMNKRAGELT
Sbjct  1    MSLIANEDFQHILRVLNTNVDGRQKIMFALTSIKGIGRRFANIVCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+++LM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELESLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHWWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_008776934.1| PREDICTED: 40S ribosomal protein S18-like [Phoenix dactylifera]
Length=152

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQ +MFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQNVMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E++NLM VVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AEELENLMVVVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_011082572.1| PREDICTED: 40S ribosomal protein S18 [Sesamum indicum]
Length=152

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+ NTNVDGKQKIMFA+TSIKGIGRRFANI CKKADIDMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVQNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAEID+LM +VANPRQFK+PDWFLNR+KDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAEIDSLMVIVANPRQFKIPDWFLNRKKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|EPS72546.1| hypothetical protein M569_02206 [Genlisea aurea]
Length=152

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+ NTNVDGKQKIMFA+TSIKGIGRRFAN+ CKKADIDMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVQNTNVDGKQKIMFALTSIKGIGRRFANVVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM +VANPRQFK+PDWFLNR+KDYKDG YSQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDNLMIIVANPRQFKIPDWFLNRKKDYKDGKYSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_009588399.1| PREDICTED: 40S ribosomal protein S18-like [Nicotiana tomentosiformis]
 ref|XP_009781245.1| PREDICTED: 40S ribosomal protein S18-like [Nicotiana sylvestris]
Length=152

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDM+KRAGEL+
Sbjct  1    MSLVANEEFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_009588684.1| PREDICTED: 40S ribosomal protein S18-like [Nicotiana tomentosiformis]
Length=190

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  621  RGEKAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMN  442
            +  + + MSLVANE+FQHILR+ NTNVDGKQKIMFAMTSIKGIGRRFANI CKKADIDMN
Sbjct  32   QSSETLAMSLVANEEFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADIDMN  91

Query  441  KRAGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLER  262
            KRAGEL++AE+D+LM VVANPRQFK+PDWFLNRQKDYKDG +SQV SNALDMKLRDDLER
Sbjct  92   KRAGELSSAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSNALDMKLRDDLER  151

Query  261  LKKIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            LKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  152  LKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  190



>ref|XP_008812047.1| PREDICTED: 40S ribosomal protein S18-like [Phoenix dactylifera]
Length=152

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ANEDFQHILR+LNTNVDGK KI  A+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLIANEDFQHILRVLNTNVDGKHKITIALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMTVVANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTVVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>emb|CDY15304.1| BnaC06g07900D [Brassica napus]
Length=173

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 149/153 (97%), Gaps = 1/153 (1%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  21   MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  80

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI-RN  244
            AAEIDNLMT+VANP+Q+K+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKI RN
Sbjct  81   AAEIDNLMTIVANPKQYKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKISRN  140

Query  243  HRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  141  HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  173



>ref|XP_008355471.1| PREDICTED: 40S ribosomal protein S18 [Malus domestica]
Length=152

 Score =   263 bits (673),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+ SIKGIGRRFANI CKKAD+DMNK+AGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALXSIKGIGRRFANIVCKKADVDMNKKAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+D LMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
             GLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  XGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|EPS57469.1| hypothetical protein M569_17345, partial [Genlisea aurea]
Length=151

 Score =   263 bits (673),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLVANE+FQHILR+ NTNVDGKQKIMFA+TSIKGIGRRFAN+ CKKADIDMNKRAGEL+A
Sbjct  1    SLVANEEFQHILRVQNTNVDGKQKIMFALTSIKGIGRRFANVVCKKADIDMNKRAGELSA  60

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
            AE+DNLM +VANPRQFK+PDWFLNR+KDYKDG YSQV SNALDMKLRDDLERLKKIRNHR
Sbjct  61   AELDNLMVIVANPRQFKIPDWFLNRKKDYKDGKYSQVTSNALDMKLRDDLERLKKIRNHR  120

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  GLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  151



>ref|XP_004299120.2| PREDICTED: 40S ribosomal protein S18-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   265 bits (676),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  609  AIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            A  MSLVANE+FQHILR++NTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAG
Sbjct  34   AATMSLVANEEFQHILRVMNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAG  93

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL+A EI+NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVV+NALDMKLRDDLERLKKI
Sbjct  94   ELSAQEIENLMHIVANPRQFKIPDWFLNRKKDYKDGKYSQVVANALDMKLRDDLERLKKI  153

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  154  RNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  188



>gb|ACM90157.1| S18 ribosomal protein [Jatropha curcas]
Length=152

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LM +VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRN 
Sbjct  61   AEELDKLMVIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNP  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_010927869.1| PREDICTED: 40S ribosomal protein S18-like [Elaeis guineensis]
Length=152

 Score =   263 bits (672),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQ +MFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQNVMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E++NLM VVANPRQFK+PDWFLNR+KD+KDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AEELENLMVVVANPRQFKIPDWFLNRKKDHKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_011079871.1| PREDICTED: 40S ribosomal protein S18-like [Sesamum indicum]
Length=152

 Score =   262 bits (670),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+ NTNVDGKQKIMFA+TSIKGIGRRFANI CKKADIDMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVQNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
             AEID+LM +VANPRQFK+PDWFLNR+KDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   NAEIDSLMVIVANPRQFKIPDWFLNRKKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|NP_001151612.1| 40S ribosomal protein S18 [Zea mays]
 ref|XP_002463750.1| hypothetical protein SORBIDRAFT_01g005360 [Sorghum bicolor]
 gb|ACF88479.1| unknown [Zea mays]
 gb|ACG24818.1| 40S ribosomal protein S18 [Zea mays]
 gb|ACG30924.1| 40S ribosomal protein S18 [Zea mays]
 gb|ACG31938.1| 40S ribosomal protein S18 [Zea mays]
 gb|ACG43516.1| 40S ribosomal protein S18 [Zea mays]
 gb|ACR35285.1| unknown [Zea mays]
 gb|EER90748.1| hypothetical protein SORBIDRAFT_01g005360 [Sorghum bicolor]
 tpg|DAA51879.1| TPA: 40S ribosomal protein S18 [Zea mays]
Length=152

 Score =   262 bits (670),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A EDFQHILR+LNTNVDGKQKIMFAMTSIKG+GRRF+NI CKKADIDMNKRAGELT
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFAMTSIKGVGRRFSNIVCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   PEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|EYU40915.1| hypothetical protein MIMGU_mgv1a015580mg [Erythranthe guttata]
Length=152

 Score =   262 bits (670),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILRI NTNVDGKQKIMFAMTSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRIQNTNVDGKQKIMFAMTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
             AEID+LM +VANPRQFK+PDWFLNR+KDYKDG +SQV SNALDMKLRDDLERLKKIRNH
Sbjct  61   NAEIDSLMVIVANPRQFKIPDWFLNRKKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006842219.1| hypothetical protein AMTR_s00078p00178430 [Amborella trichopoda]
 gb|ERN03894.1| hypothetical protein AMTR_s00078p00178430 [Amborella trichopoda]
Length=152

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ANE+FQHILR+LNTNVDG+QKIMFA+TSIKGIGRRFAN+ CKKADIDMNKRAGEL+
Sbjct  1    MSLIANEEFQHILRVLNTNVDGRQKIMFALTSIKGIGRRFANLVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+++LM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELESLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHHWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|NP_001141254.1| ribosomal protein S18 [Zea mays]
 gb|ACF85865.1| unknown [Zea mays]
 gb|ACG31137.1| 40S ribosomal protein S18 [Zea mays]
 gb|AFR11278.1| ribosomal protein S18 [Zea mays]
 gb|AFW67377.1| 40S ribosomal protein S18 [Zea mays]
Length=152

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A EDFQHILR+LNTNVDGKQKIMFAMTSIKG+GRRF+NI CKKADIDMNKRAGELT
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFAMTSIKGVGRRFSNIVCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   PDELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_002459401.1| hypothetical protein SORBIDRAFT_02g004110 [Sorghum bicolor]
 gb|EER95922.1| hypothetical protein SORBIDRAFT_02g004110 [Sorghum bicolor]
Length=152

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A EDFQHILR+LNTNVDGKQKIMFAMTSIKG+GRRF+NI CKKADIDMNKRAGEL+
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFAMTSIKGVGRRFSNIVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            + E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   SDELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|NP_001051541.1| Os03g0794700 [Oryza sativa Japonica Group]
 ref|NP_001059007.2| Os07g0173700 [Oryza sativa Japonica Group]
 dbj|BAC24844.1| putative ribosomal protein S18 [Oryza sativa Japonica Group]
 gb|AAO37983.1| putative ribosomal protein S18A [Oryza sativa Japonica Group]
 gb|AAT76427.1| putative ribosomal protein S18A [Oryza sativa Japonica Group]
 dbj|BAD30787.1| putative ribosomal protein S18 [Oryza sativa Japonica Group]
 gb|ABF99325.1| 40S ribosomal protein S18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13455.1| Os03g0794700 [Oryza sativa Japonica Group]
 gb|EAZ02936.1| hypothetical protein OsI_25076 [Oryza sativa Indica Group]
 dbj|BAG86825.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87027.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66653.1| hypothetical protein OsJ_23275 [Oryza sativa Japonica Group]
 dbj|BAF20921.2| Os07g0173700 [Oryza sativa Japonica Group]
Length=152

 Score =   261 bits (668),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A EDFQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKRAGELT
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIACKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   PEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_008805387.1| PREDICTED: 40S ribosomal protein S18-like [Phoenix dactylifera]
Length=152

 Score =   260 bits (665),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ANEDFQHILR+LNTNVDGKQ++M A+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLIANEDFQHILRVLNTNVDGKQRVMIALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMTV+ANPRQFK+PDWFLNR+KD KDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMTVIANPRQFKIPDWFLNRKKDCKDGRHSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006650718.1| PREDICTED: 40S ribosomal protein S18-like [Oryza brachyantha]
Length=152

 Score =   260 bits (665),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A EDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRF+NI CKKADIDMNKRAGEL+
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGIGRRFSNIACKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   PEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004955596.1| PREDICTED: 40S ribosomal protein S18-like [Setaria italica]
Length=152

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A EDFQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKRAGELT
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   PDELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_004967782.1| PREDICTED: 40S ribosomal protein S18-like [Setaria italica]
Length=152

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A EDFQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKRAGEL+
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   PDELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_001754726.1| predicted protein [Physcomitrella patens]
 gb|EDQ80696.1| predicted protein [Physcomitrella patens]
Length=152

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A E+FQHILR+LNTNVDG+QKIMFA+TSIKG+GRRFAN+ CKKAD+DM+KRAGEL+
Sbjct  1    MSLIAGEEFQHILRVLNTNVDGRQKIMFALTSIKGVGRRFANLVCKKADVDMSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFKVPDWFLNR+KD+KDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKVPDWFLNRKKDHKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKR  152



>ref|XP_001764970.1| predicted protein [Physcomitrella patens]
 gb|EDQ70186.1| predicted protein [Physcomitrella patens]
Length=152

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVA E+FQHILR+LNTNVDG+QKIMFA+TSIKG+GRRFAN+ CKKAD+DM+KRAGEL+
Sbjct  1    MSLVAGEEFQHILRVLNTNVDGRQKIMFALTSIKGVGRRFANLVCKKADVDMSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNR+KD+KDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDHKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKR  152



>ref|XP_002973168.1| hypothetical protein SELMODRAFT_267619 [Selaginella moellendorffii]
 gb|EFJ25542.1| hypothetical protein SELMODRAFT_267619 [Selaginella moellendorffii]
Length=156

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 148/156 (95%), Gaps = 4/156 (3%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV+NE+FQHILR+LNTNVDG+QKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVSNEEFQHILRVLNTNVDGRQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR--  247
            AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVV+NALDMKLRDDLERLKKIR  
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVANALDMKLRDDLERLKKIRQA  120

Query  246  --NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
              +HRGLRHYWGLRVRGQHTKTT RRG+TVGVSKKR
Sbjct  121  YSDHRGLRHYWGLRVRGQHTKTTERRGRTVGVSKKR  156



>gb|ADE77437.1| unknown [Picea sitchensis]
Length=152

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDG+QKIMFA+TSIKGIGRRFAN+ CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGRQKIMFALTSIKGIGRRFANLVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLMT+V+NP+QFK+P+WFLNRQKDYKDG  +Q+VSNALDM+LRDDLERLKKIRNH
Sbjct  61   AAELENLMTIVSNPKQFKIPEWFLNRQKDYKDGRTNQLVSNALDMRLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_006658321.1| PREDICTED: 40S ribosomal protein S18-like [Oryza brachyantha]
Length=161

 Score =   259 bits (661),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            +SL+A EDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRF+NI CKKADIDMNKRAGEL+
Sbjct  10   LSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGIGRRFSNIACKKADIDMNKRAGELS  69

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  70   PEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  129

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  130  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  161



>ref|XP_001754723.1| predicted protein [Physcomitrella patens]
 ref|XP_001777087.1| predicted protein [Physcomitrella patens]
 ref|XP_001778670.1| predicted protein [Physcomitrella patens]
 gb|EDQ56565.1| predicted protein [Physcomitrella patens]
 gb|EDQ58080.1| predicted protein [Physcomitrella patens]
 gb|EDQ80693.1| predicted protein [Physcomitrella patens]
Length=152

 Score =   258 bits (660),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A E+FQHILR+LNTNVDG+QKIMFA+TSIKG+GRRFAN+ CKKAD+DM+KRAGEL+
Sbjct  1    MSLIAGEEFQHILRVLNTNVDGRQKIMFALTSIKGVGRRFANLVCKKADVDMSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNR+KD+KDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDHKDGRYSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKR  152



>ref|XP_001777119.1| predicted protein [Physcomitrella patens]
 gb|EDQ58112.1| predicted protein [Physcomitrella patens]
Length=152

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A E+FQHILR+LNTNVDG+QKIMFA+TSIKG+GRRFAN+ CKKAD+DM+KRAGEL+
Sbjct  1    MSLIAGEEFQHILRVLNTNVDGRQKIMFALTSIKGVGRRFANLVCKKADVDMSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE++NLM +VANPRQFK+PDWFLNR+KD+KDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDHKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKR  152



>ref|XP_003557546.1| PREDICTED: 40S ribosomal protein S18 [Brachypodium distachyon]
Length=152

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A E+FQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKRAGELT
Sbjct  1    MSLIAGEEFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E+D LM VVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   PEELDRLMHVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWG+RVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR  152



>ref|XP_003557516.1| PREDICTED: 40S ribosomal protein S18-like [Brachypodium distachyon]
Length=152

 Score =   256 bits (653),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+L+A E+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR++NI CKKADIDMNKRAGELT
Sbjct  1    MALIAGEEFQHILRLLNTNVDGKQKIMFALTSIKGIGRRYSNIVCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E+D LM VV+NPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   TEELDRLMVVVSNPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWG+RVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|ABK23001.1| unknown [Picea sitchensis]
 gb|ABK23462.1| unknown [Picea sitchensis]
 gb|ABK23903.1| unknown [Picea sitchensis]
 gb|ABK25635.1| unknown [Picea sitchensis]
 gb|ABK26268.1| unknown [Picea sitchensis]
 gb|ABK26459.1| unknown [Picea sitchensis]
 gb|ABK26933.1| unknown [Picea sitchensis]
 gb|ABR16972.1| unknown [Picea sitchensis]
 gb|ABR17259.1| unknown [Picea sitchensis]
 gb|ACN40152.1| unknown [Picea sitchensis]
Length=152

 Score =   255 bits (652),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+ANE+FQHILR+LNTNVDG+QKIMFA+TSIKGIGRR AN+ CKKAD+DMNKRAGELT
Sbjct  1    MSLIANEEFQHILRVLNTNVDGRQKIMFALTSIKGIGRRLANLVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E++NLM +VANP+QFK+PDWFLNRQKD KDG  +QVVSNALDMKLRDDLERLKKIRNH
Sbjct  61   ALELENLMIIVANPKQFKIPDWFLNRQKDIKDGRTTQVVSNALDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  152



>pdb|3J60|S Chain S, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAM92708.1| putative ribosomal protein S18 [Triticum aestivum]
 gb|EMS64000.1| 40S ribosomal protein S18 [Triticum urartu]
Length=152

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A E+FQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKRAGEL+
Sbjct  1    MSLIAGEEFQHILRVLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+D LM VV NPRQFKVPDWFLNR+KDYKDG +SQVVSNA+DMKLRDDLERLKKIRNH
Sbjct  61   AEEMDRLMAVVHNPRQFKVPDWFLNRKKDYKDGRFSQVVSNAVDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWG+RVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR  152



>gb|EMT02406.1| 40S ribosomal protein S18 [Aegilops tauschii]
Length=190

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  612  KAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRA  433
            +A ++SL A E+FQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKRA
Sbjct  35   EAELLSLSAGEEFQHILRVLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRA  94

Query  432  GELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKK  253
            GEL+A E+D LM VV NPRQFKVPDWFLNR+KDYKDG +SQVVSNA+DMKLRDDLERLKK
Sbjct  95   GELSAEEMDRLMAVVHNPRQFKVPDWFLNRKKDYKDGRFSQVVSNAVDMKLRDDLERLKK  154

Query  252  IRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            IRNHRGLRHYWG+RVRGQHTKTTGRRGKTVGVSKKR
Sbjct  155  IRNHRGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR  190



>gb|EMT03027.1| 40S ribosomal protein S18 [Aegilops tauschii]
Length=152

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+A E+FQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKRAGEL+
Sbjct  1    MSLIAGEEFQHILRVLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            + E+D LM VV NPRQFKVPDWFLNR+KDYKDG +SQVVSNA+DMKLRDDLERLKKIRNH
Sbjct  61   SEEMDRLMAVVHNPRQFKVPDWFLNRKKDYKDGRFSQVVSNAVDMKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWG+RVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR  152



>dbj|BAC24846.1| putative ribosomal protein S18 [Oryza sativa Japonica Group]
 dbj|BAD30789.1| putative ribosomal protein S18 [Oryza sativa Japonica Group]
 gb|EAZ38860.1| hypothetical protein OsJ_23277 [Oryza sativa Japonica Group]
Length=148

 Score =   253 bits (646),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  582  EDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAAEIDN  403
            EDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRF+NI CKKADIDMNKRAGELT  E++ 
Sbjct  3    EDFQHILRLLNTNVDGKQKIMFALTSIKGIGRRFSNIACKKADIDMNKRAGELTPEELER  62

Query  402  LMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRGLRHY  223
            LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNALDMKLRDDLERLKKIRNHRGLRHY
Sbjct  63   LMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNHRGLRHY  122

Query  222  WGLRVRGQHtkttgrrgktvgVSKKR  145
            WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  123  WGLRVRGQHTKTTGRRGKTVGVSKKR  148



>emb|CBI28706.3| unnamed protein product [Vitis vinifera]
Length=912

 Score =   270 bits (691),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  627  RERGEKAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADID  448
            R    + + MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+D
Sbjct  752  RRASSETLTMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD  811

Query  447  MNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDL  268
            MNKRAGEL+AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDL
Sbjct  812  MNKRAGELSAAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDL  871

Query  267  ERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            ERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  872  ERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  912



>gb|EAY92162.1| hypothetical protein OsI_13875 [Oryza sativa Indica Group]
 gb|EAZ28894.1| hypothetical protein OsJ_12934 [Oryza sativa Japonica Group]
Length=170

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 146/170 (86%), Gaps = 18/170 (11%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKR-----  436
            MSL+A EDFQHILR+LNTNVDGKQKIMFA+TSIKG+GRRF+NI CKKADIDMNKR     
Sbjct  1    MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIACKKADIDMNKRQEPPP  60

Query  435  -------------AGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNA  295
                         AGELT  E++ LMTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSNA
Sbjct  61   PPSRRQISVMVGGAGELTPEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNA  120

Query  294  LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  170



>gb|KEH43413.1| Vps51/Vps67 protein [Medicago truncatula]
Length=1094

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKI FAMTSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  794  MSLVANEEFQHILRVLNTNVDGKQKIQFAMTSIKGIGRRFANICCKKADVDMNKRAGELS  853

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DN+M VVANPRQFKVPDWFLNR+KDYKDG +SQVVSN  DMKLRDDLERL+KIRNH
Sbjct  854  AAELDNIMIVVANPRQFKVPDWFLNRKKDYKDGKFSQVVSNQFDMKLRDDLERLEKIRNH  913

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWGLRVRGQH
Sbjct  914  RGLRHYWGLRVRGQH  928



>ref|XP_008368932.1| PREDICTED: uncharacterized protein LOC103432514 [Malus domestica]
Length=467

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 146/170 (86%), Gaps = 17/170 (10%)
 Frame = -2

Query  603  IMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKR----  436
            I SLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNK     
Sbjct  298  ITSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKXCPFS  357

Query  435  -------------AGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNA  295
                         AGEL+AAE+D LMT+VANPRQFK+PDWFLNR+KDYKDG YSQVVSNA
Sbjct  358  STPXLQFRLILCGAGELSAAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNA  417

Query  294  LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            LDMKLRDDLERLKKIRNH GLRHYWGLRV GQHTKTTGRRGKTVGVSKKR
Sbjct  418  LDMKLRDDLERLKKIRNHCGLRHYWGLRVCGQHTKTTGRRGKTVGVSKKR  467



>ref|XP_005850125.1| 40S ribosomal protein S18 [Chlorella variabilis]
 gb|EFN58023.1| 40S ribosomal protein S18 [Chlorella variabilis]
Length=153

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV +++F HILR+LNTNVDGKQKIM+A+T+IKGIGRRF+NICCKKA++D+NKRAGEL+A
Sbjct  3    SLVGSDNFTHILRVLNTNVDGKQKIMYALTAIKGIGRRFSNICCKKAEVDLNKRAGELSA  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++++MT+VANPR +K+PDWFLNRQKD KDG YSQV S+ALD KLRDDLERLKKIRNHR
Sbjct  63   EELESIMTIVANPRAYKIPDWFLNRQKDVKDGRYSQVTSSALDTKLRDDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQH  196
            GLRHYWGL VRGQH
Sbjct  123  GLRHYWGLTVRGQH  136



>ref|XP_003063790.1| ribosomal protein S18 [Micromonas pusilla CCMP1545]
 gb|EEH52163.1| ribosomal protein S18 [Micromonas pusilla CCMP1545]
Length=144

 Score =   237 bits (605),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SL+  +DFQHILR+LNTNVDG+ K+M+A+T I+GIGRRFAN+ CKKA+IDM KRAGEL+A
Sbjct  3    SLIVGDDFQHILRVLNTNVDGRTKVMYALTQIRGIGRRFANVVCKKAEIDMGKRAGELSA  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
            AE+++LM +VANPRQF++PDWFLNRQKDYKDG Y Q+ SNALD KLRDDLERLKKIRNHR
Sbjct  63   AELESLMVIVANPRQFRIPDWFLNRQKDYKDGKYVQLTSNALDTKLRDDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQH  196
            GLRHYWG+RVRGQH
Sbjct  123  GLRHYWGIRVRGQH  136



>ref|XP_001628997.1| predicted protein [Nematostella vectensis]
 gb|EDO36934.1| predicted protein [Nematostella vectensis]
Length=153

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DGKQKIMFAMTSIKG+GRR+ANI CKKADIDMNKRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIKGVGRRYANIVCKKADIDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD+KDG YSQ+++N LD K+R+DLERLKKIR H
Sbjct  61   EDEVERVVTIMQNPRQYKIPDWFLNRQKDHKDGKYSQILANGLDNKMREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWGLRVRGQH
Sbjct  121  RGLRHYWGLRVRGQH  135



>ref|XP_004140957.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus]
Length=137

 Score =   234 bits (597),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 134/152 (88%), Gaps = 15/152 (10%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+L               +IKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVL---------------TIKGIGRRFANIVCKKADVDMNKRAGELT  45

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+DNLM VVANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIRNH
Sbjct  46   AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH  105

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  106  RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  137



>ref|XP_005649180.1| ribosomal protein S18 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE24636.1| ribosomal protein S18 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=153

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SL+A++ FQHILR+LNTNVDGKQKIMFA+T+I+GIGRRF+NI CKKA++DM KRAGEL+A
Sbjct  3    SLIADDAFQHILRVLNTNVDGKQKIMFALTAIRGIGRRFSNIACKKAEVDMRKRAGELSA  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
            AE++ LM +VANPR FK+PDWFLNRQKD+KDG  SQ+ S+ALD KLR+DLERLKKIRNHR
Sbjct  63   AELEQLMVIVANPRTFKIPDWFLNRQKDHKDGKNSQLTSSALDTKLREDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRHYWGLRV+GQHTKTTGRRG+TVGV+KKR
Sbjct  123  GLRHYWGLRVKGQHTKTTGRRGRTVGVAKKR  153



>gb|KIY98606.1| 40S ribosomal protein S18 [Monoraphidium neglectum]
Length=153

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV+ ++FQHILR+LNTNVDGKQK+M+AMT+I+G+GRRF+N+ CKKA++DM KRAGE+TA
Sbjct  3    SLVSGDEFQHILRVLNTNVDGKQKVMYAMTAIRGLGRRFSNLVCKKAEVDMKKRAGEITA  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ +MT+VANPRQ+K+PDWFLNRQKD KDG +SQ+ S+ L+ KLRDDLERLKKIRNHR
Sbjct  63   EELEQMMTIVANPRQYKIPDWFLNRQKDIKDGRFSQITSSGLETKLRDDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQH  196
            GLRHYWGLRV+GQH
Sbjct  123  GLRHYWGLRVKGQH  136



>gb|KJB65872.1| hypothetical protein B456_010G132100 [Gossypium raimondii]
Length=145

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR +
Sbjct  61   AQELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRFN  120

Query  240  R  238
            R
Sbjct  121  R  121



>gb|KJB65873.1| hypothetical protein B456_010G132100 [Gossypium raimondii]
Length=154

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR +
Sbjct  61   AQELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRFN  120

Query  240  RGLRHYWGLRVRG  202
            R     W   + G
Sbjct  121  RFYEPPWAEALLG  133



>gb|KJB60026.1| hypothetical protein B456_009G286200 [Gossypium raimondii]
Length=125

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            A E+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  61   AQELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  118



>ref|XP_002505748.1| ribosomal protein S18 [Micromonas sp. RCC299]
 gb|ACO67006.1| ribosomal protein S18 [Micromonas sp. RCC299]
Length=145

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+  +DFQHILR+LNTNVDG+ K+M+A+T I+GIGRRF+N+ CKKA+IDM KRAGEL+
Sbjct  1    MSLIVGDDFQHILRVLNTNVDGRTKVMYALTQIRGIGRRFSNVVCKKAEIDMGKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+++LM +V+NPRQF++PDWFLNRQK+YKDG Y Q VSN LD  LRDDLERLKKIRNH
Sbjct  61   AAELESLMVIVSNPRQFRIPDWFLNRQKNYKDGKYIQQVSNQLDTSLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWG+RVRGQH
Sbjct  121  RGLRHYWGIRVRGQH  135



>gb|KDO83808.1| hypothetical protein CISIN_1g031787mg [Citrus sinensis]
Length=118

 Score =   229 bits (583),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            AAE+DNLM VVANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  61   AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  118



>ref|XP_005759979.1| hypothetical protein EMIHUDRAFT_438587 [Emiliania huxleyi CCMP1516]
 ref|XP_005776914.1| hypothetical protein EMIHUDRAFT_443828 [Emiliania huxleyi CCMP1516]
 gb|EOD07550.1| hypothetical protein EMIHUDRAFT_438587 [Emiliania huxleyi CCMP1516]
 gb|EOD24485.1| hypothetical protein EMIHUDRAFT_443828 [Emiliania huxleyi CCMP1516]
Length=155

 Score =   230 bits (586),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -2

Query  597  SLVANE-DFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            SL+ NE +FQHILR+LNTN+DGK K+MFA+TSIKG+GRRF+NICCKKA++D+ KRAGELT
Sbjct  3    SLIMNESNFQHILRVLNTNLDGKVKVMFALTSIKGVGRRFSNICCKKAEVDLTKRAGELT  62

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A E++ L+T++ NPRQFKVPDW LNR+KD KDG +SQVVSN LDMKLRDDLERLKKIR H
Sbjct  63   AEEVERLVTIMQNPRQFKVPDWMLNRKKDNKDGKFSQVVSNTLDMKLRDDLERLKKIRAH  122

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQ TKTTGR+G+TVGVSKK+
Sbjct  123  RGLRHYWGLRVRGQRTKTTGRKGRTVGVSKKK  154



>gb|KJB65871.1| hypothetical protein B456_010G132100 [Gossypium raimondii]
Length=150

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGELT
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            A E+DNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  61   AQELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  118



>emb|CEG02178.1| Ribosomal protein S13 [Ostreococcus tauri]
Length=149

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+  +DFQHI+R+LNTNVDG++K+M+++T IKGIGRRF+N+ CKKA+ID+ KRAGEL+
Sbjct  1    MSLIVGDDFQHIIRVLNTNVDGREKVMYSLTKIKGIGRRFSNLVCKKAEIDLGKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+++LM +V+NPRQF++PDWFLNR+ D+KDG +SQVVSN LD KLRDDLERLKKIRNH
Sbjct  61   AAELESLMVIVSNPRQFRIPDWFLNRKHDFKDGKFSQVVSNQLDTKLRDDLERLKKIRNH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWG+RVRGQH
Sbjct  121  RGLRHYWGVRVRGQH  135



>gb|KEH43645.1| ribosomal protein S13P/S18e [Medicago truncatula]
Length=132

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKI FAMTSIKGIGRRFANICCKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIQFAMTSIKGIGRRFANICCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRN  244
            AAE+DN+MTVVANPRQFKVPDWFLNR+KDYKDG +SQVVSN LDMKLRDDLERLKKIR+
Sbjct  61   AAELDNIMTVVANPRQFKVPDWFLNRKKDYKDGKFSQVVSNQLDMKLRDDLERLKKIRS  119



>gb|KDD73975.1| ribosomal protein S13/S18 [Helicosporidium sp. ATCC 50920]
Length=153

 Score =   228 bits (582),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLVANE+F HILR+LNTNVDGK+KI +A+TSI+GIGRRF+NICCKKA+ID+++RAGEL+ 
Sbjct  3    SLVANENFTHILRVLNTNVDGKEKIQYALTSIRGIGRRFSNICCKKAEIDLSRRAGELSP  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++++MT+VANPR +K+PDWFLNRQKD +DG +SQ+ S+A+D KLR+DLERLKKIRNHR
Sbjct  63   EELESIMTIVANPRAYKIPDWFLNRQKDIRDGRFSQITSSAMDTKLREDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLR YWGL+VRGQHTKTTGRRGKTVGVSKK+
Sbjct  123  GLRAYWGLKVRGQHTKTTGRRGKTVGVSKKK  153



>ref|XP_001422767.1| Ribosomal protein S18, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01084.1| Ribosomal protein S18, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=144

 Score =   228 bits (581),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+  +DFQHI+R+LNTNVDG++K+M+++T IKGIGRRF+N+ CKKA+ID+ KRAGEL+
Sbjct  1    MSLIVGDDFQHIIRVLNTNVDGREKVMYSLTKIKGIGRRFSNLVCKKAEIDLGKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            AAE+++LM +V+NPRQF++PDWFLNR+ D+KDG +SQ+VSN LD KLRDDLERLKK+RNH
Sbjct  61   AAELESLMVIVSNPRQFRIPDWFLNRKHDFKDGKFSQLVSNQLDTKLRDDLERLKKMRNH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWG+RVRGQH
Sbjct  121  RGLRHYWGIRVRGQH  135



>ref|XP_003741117.1| PREDICTED: 40S ribosomal protein S18-like [Metaseiulus occidentalis]
Length=153

 Score =   228 bits (581),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+  E FQHILR+LNTN+DG+ K+M+A+TSIKG+GRRFANI CKKAD+D+NKRAGEL+
Sbjct  1    MSLILPEKFQHILRVLNTNIDGQTKVMYALTSIKGVGRRFANIVCKKADVDLNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ANPRQ+K+PDWFLNRQKD  DG YSQVVS+ LD KLR+DLERLKKI+ H
Sbjct  61   EQEVNAIVTILANPRQYKIPDWFLNRQKDIIDGKYSQVVSSTLDTKLREDLERLKKIKAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|KDO74585.1| hypothetical protein CISIN_1g031812mg [Citrus sinensis]
Length=126

 Score =   227 bits (578),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANEDFQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            AAE+D LM VVANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  61   AAELDQLMVVVANPRQFKIPDWFLNRQKDYKDGRYSQVVSNALDMKLRDDLERLKKIR  118



>ref|XP_002609941.1| hypothetical protein BRAFLDRAFT_114927 [Branchiostoma floridae]
 sp|Q8ISP0.1|RS18_BRABE RecName: Full=40S ribosomal protein S18 [Branchiostoma belcheri]
 gb|AAN52390.1| ribosomal protein S18 [Branchiostoma belcheri]
 gb|EEN65951.1| hypothetical protein BRAFLDRAFT_114927 [Branchiostoma floridae]
Length=152

 Score =   227 bits (579),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DG++KIMFA+TSIKG+GRR++NI CKKADID++KRAGEL+
Sbjct  1    MSLVIPEKFQHILRVMNTNIDGRRKIMFALTSIKGVGRRYSNIVCKKADIDLSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N+LD KLR+DLERLKKIR H
Sbjct  61   DEEVERLITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVMANSLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>tpe|CAL69108.1| TPA: putative 40S ribosomal protein S18 [Spadella cephaloptera]
Length=154

 Score =   227 bits (579),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DG++KIMFAMTSIKG GRRF+NI CKKAD+DM KRAGEL+
Sbjct  1    MSLVVPEKFQHILRVMNTNIDGRRKIMFAMTSIKGCGRRFSNIVCKKADVDMTKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV+SN LD KLR+DLERLKKIR H
Sbjct  61   DEEVERVVTIMNNPRQYKIPDWFLNRQKDVKDGKYSQVLSNGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGCTVGVSKKK  152



>ref|NP_001292296.1| 40S ribosomal protein S18 [Crassostrea gigas]
 dbj|BAE16014.1| ribosomal protein S18 [Crassostrea gigas]
Length=152

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+L+  E FQHILRILNTN+DG++KIMFAMT+IKGIGRR+AN+ CKKAD+D+ KRAGEL+
Sbjct  1    MALILPEKFQHILRILNTNIDGRRKIMFAMTAIKGIGRRYANVVCKKADVDITKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              EID ++T++ NPRQ+K+PDWFLNRQKD KDG +SQV+SN LD KLR+DLERLKKIR H
Sbjct  61   EEEIDKIVTIMQNPRQYKIPDWFLNRQKDIKDGKFSQVMSNTLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWGLRVRGQH
Sbjct  121  RGLRHYWGLRVRGQH  135



>gb|ABR23395.1| ribosomal protein S18 [Ornithodoros parkeri]
Length=153

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILR+LNTN+DG++K+MFA+T+IKG+GRRF+N+ CKKAD+D+NKRAGEL+
Sbjct  1    MSLVIPDKFQHILRVLNTNIDGRRKVMFALTAIKGVGRRFSNMVCKKADVDLNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+T+++NPRQ+K+PDWFLNRQKD KDG YSQV SNAL+ KLR+DLERLKKIR H
Sbjct  61   EEEVEKLITIMSNPRQYKIPDWFLNRQKDIKDGKYSQVTSNALENKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|AAY66885.1| ribosomal protein S18, partial [Ixodes scapularis]
Length=153

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILR+LNTN+DG++K+MFA+T+IKG+GRRF+N+ CKKAD+D+NKRAGELT
Sbjct  1    MSLVIPDKFQHILRVLNTNIDGRRKVMFALTAIKGVGRRFSNMVCKKADVDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+T+++NPRQ+K+PDWFLNRQKD KDG +SQV SNAL+ KLR+DLERLKKIR H
Sbjct  61   EEEVEKLITIMSNPRQYKIPDWFLNRQKDIKDGKFSQVTSNALENKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|KFM83326.1| 40S ribosomal protein S18, partial [Stegodyphus mimosarum]
Length=152

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILR++NTN+DG++K+MFA+T+IKG+GRRF+N+ CKKAD+D+NKRAGEL+
Sbjct  1    MSLVIPDKFQHILRVMNTNIDGRRKVMFALTAIKGVGRRFSNLVCKKADVDLNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+T+++NPRQ+K+PDWFLNRQKD KDG YSQV SN L+ KLR+DLERLKKIR H
Sbjct  61   EEEVEKLITIMSNPRQYKIPDWFLNRQKDIKDGKYSQVTSNGLENKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_006306532.1| hypothetical protein CARUB_v10012556mg, partial [Capsella rubella]
 gb|EOA39430.1| hypothetical protein CARUB_v10012556mg, partial [Capsella rubella]
Length=122

 Score =   225 bits (573),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRR ANI CKKAD+DMNKRAGEL+A
Sbjct  7    SLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSA  66

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            AEIDNLMT+VANPRQFK+PDWFLNRQKDYKDG YSQVVSNALDMKLRDDLERLKKI
Sbjct  67   AEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKI  122



>ref|XP_002155929.1| PREDICTED: 40S ribosomal protein S18-like isoform 1 [Hydra vulgaris]
 ref|XP_002155978.1| PREDICTED: 40S ribosomal protein S18-like isoform 2 [Hydra vulgaris]
Length=155

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+  E FQHILR++NTN+DGK KIM+AMTSIKG+GRRF+NIC KKADID+ KRAGELT
Sbjct  1    MSLIVPEKFQHILRVMNTNIDGKTKIMYAMTSIKGVGRRFSNICLKKADIDLKKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PD+FLNRQKD KDG Y+QV++NALD KLR+DLERLKKI+ H
Sbjct  61   DEEVERVITIMQNPRQYKIPDYFLNRQKDIKDGKYTQVLANALDNKLREDLERLKKIKAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGR+G+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRKGRTVGVSKKK  152



>sp|Q8IT98.1|RS18_ARGIR RecName: Full=40S ribosomal protein S18 [Argopecten irradians]
 gb|AAN05613.1| ribosomal protein S18 [Argopecten irradians]
Length=152

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+L+  E FQHILR++NTN+DGK+KIMFAMT+IKG+GRR+AN+ CKKAD+D+ KRAGEL+
Sbjct  1    MALIIPEKFQHILRVMNTNIDGKRKIMFAMTAIKGMGRRYANVVCKKADVDITKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              EI+ ++T+++NPRQ+K+P+WFLNRQKD KDG YSQV+SNALD KLR+DLERLKKIR H
Sbjct  61   EDEIERVITIMSNPRQYKIPNWFLNRQKDVKDGKYSQVMSNALDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWGLRVRGQH
Sbjct  121  RGLRHYWGLRVRGQH  135



>ref|XP_010535077.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Tarenaya hassleriana]
Length=126

 Score =   224 bits (572),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  522  MFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNR  343
            MFA+TSIKGIGRRFANI CKKAD+DMNKRAGELTAAE+DNLMT+VANPRQFK+PDWFLNR
Sbjct  1    MFALTSIKGIGRRFANIVCKKADVDMNKRAGELTAAELDNLMTIVANPRQFKIPDWFLNR  60

Query  342  QKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktv  163
            QKDYKDG YSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV
Sbjct  61   QKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV  120

Query  162  gVSKKR  145
            GVSKKR
Sbjct  121  GVSKKR  126



>gb|EFX69747.1| hypothetical protein DAPPUDRAFT_300691 [Daphnia pulex]
Length=152

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILRILNTN+DGK KIMFA+TSIKG+GRR+AN+  KKADID+ KRAGEL+
Sbjct  1    MSLVLPEKFQHILRILNTNIDGKIKIMFAVTSIKGVGRRYANVVLKKADIDLTKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+T++ANPRQ+K+PDWFLNRQKD KDG +SQV SN L+ KLR+DLERLKKIR H
Sbjct  61   EEEVEKLITIMANPRQYKIPDWFLNRQKDIKDGKFSQVTSNMLENKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_010651981.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Vitis vinifera]
Length=162

 Score =   225 bits (574),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLVANE+FQHILR+LNTNVDGKQKIMFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+
Sbjct  1    MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            AAE++NLM +VANPRQFK+PDWFLNR+KDYKDG YSQVVSNALDMKLRDDLERLKKIR
Sbjct  61   AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIR  118



>ref|XP_011398352.1| 40S ribosomal protein S18 [Auxenochlorella protothecoides]
 gb|KFM25456.1| 40S ribosomal protein S18 [Auxenochlorella protothecoides]
Length=153

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SL+A EDF HILR+LNTNVDGKQKI +A+T+I+GIGRR++NICCKKA++D+ +RAGEL+ 
Sbjct  3    SLLATEDFTHILRVLNTNVDGKQKIQYALTAIRGIGRRYSNICCKKAEVDLTRRAGELSP  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++++MT+VANPR +K+PDWFLNRQKD KDG Y Q+ S+ LD KLRDDLERLKKIRNHR
Sbjct  63   EELESIMTIVANPRAYKIPDWFLNRQKDVKDGKYFQMTSSMLDTKLRDDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLR YWGL VRGQHTKTTGRRGKTVGV+KKR
Sbjct  123  GLRAYWGLTVRGQHTKTTGRRGKTVGVAKKR  153



>gb|KJB28966.1| hypothetical protein B456_005G077200 [Gossypium raimondii]
 gb|KJB28967.1| hypothetical protein B456_005G077200 [Gossypium raimondii]
Length=126

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  522  MFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNR  343
            MFA+TSIKGIGRRFANI CKKAD+DMNKRAGELTA E+DNLMT+VANPRQFK+PDWFLNR
Sbjct  1    MFALTSIKGIGRRFANIVCKKADVDMNKRAGELTAQELDNLMTIVANPRQFKIPDWFLNR  60

Query  342  QKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktv  163
            QKDYKDG YSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV
Sbjct  61   QKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV  120

Query  162  gVSKKR  145
            GVSKKR
Sbjct  121  GVSKKR  126



>gb|AAQ21388.1| ribosomal protein S18 [Ixodes ricinus]
Length=152

 Score =   223 bits (568),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            +LV  + FQHILR+LNTN+DG++K+MFA+T+IKG+GRRF+N+ CKKAD+D+NKRAGELT 
Sbjct  2    ALVIPDKFQHILRVLNTNIDGRRKVMFALTAIKGVGRRFSNMVCKKADVDLNKRAGELTE  61

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ L+T+++NPRQ+K+PDWFLNRQKD KDG +SQV SNAL+ KLR+DLERLKKIR HR
Sbjct  62   EEVEKLITIMSNPRQYKIPDWFLNRQKDIKDGKFSQVTSNALENKLREDLERLKKIRAHR  121

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  122  GLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_002946223.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ53218.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=153

 Score =   222 bits (566),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV  +DFQHILR+LNTNVDGK KIM+AMT+IKGIGRRF+N+ CKKA++D+ KRAGE +A
Sbjct  3    SLVQGDDFQHILRLLNTNVDGKNKIMYAMTAIKGIGRRFSNLVCKKAEVDLRKRAGECSA  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ +M +VANPR +K+PDWFLNRQKD+K G YSQ+ S+ LD  LRDDLERLKKIRNHR
Sbjct  63   DELERMMGIVANPRAYKIPDWFLNRQKDHKTGRYSQLTSSGLDTALRDDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRHYWGLRVRGQHTKTTGR GKTVGV+KK+
Sbjct  123  GLRHYWGLRVRGQHTKTTGRAGKTVGVAKKK  153



>gb|ACD65147.1| putative 40S ribosomal protein RPS18 [Phoronis muelleri]
Length=152

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DGK+KIMFAMT+IKGIGRR+A++  KKAD+D+ KRAGEL+
Sbjct  1    MSLVVPEKFQHILRVMNTNIDGKRKIMFAMTAIKGIGRRYAHVVLKKADVDLAKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD KDG  SQV+SN LD KLR+DLERLKKIR H
Sbjct  61   EEEVERVITIMSNPRQYKIPDWFLNRQKDVKDGKTSQVMSNGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|AEB54647.1| ribosomal protein S18 [Procambarus clarkii]
 gb|AIW68599.1| ribosomal protein S18 [Cherax quadricarinatus]
Length=152

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DG++K+MFAMT+IKG+GRR++NI  KKADID +KRAGE+T
Sbjct  1    MSLVVPEKFQHILRLMNTNIDGRRKVMFAMTAIKGVGRRYSNIVLKKADIDQSKRAGEMT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD KDG YSQV+SN L+ KLR+DLER+KKIR H
Sbjct  61   EEEVEKIVTIMSNPRQYKIPDWFLNRQKDIKDGKYSQVMSNNLETKLREDLERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|AIU94815.1| 40S ribosomal protein [Phragmatopoma lapidosa]
Length=152

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DG++KI FAMT+IKGIGRR++++ CKKAD+D +KRAGEL+
Sbjct  1    MSLVVPEKFQHILRVMNTNIDGRRKIAFAMTAIKGIGRRYSHVVCKKADVDTSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG +SQV+SN LD KLR+DLERLKKIR H
Sbjct  61   DEEVEKIITIMTNPRQYKIPDWFLNRQKDIKDGKFSQVMSNTLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ABW90381.1| putative ribosomal protein S18 [Sipunculus nudus]
Length=152

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSL+  E FQHILR++NTN+DGK+KI FAMT+IKG+GRR+A I CKKAD+D+ KRAGEL+
Sbjct  1    MSLIIPEKFQHILRVMNTNIDGKRKIAFAMTAIKGVGRRYATIVCKKADVDVTKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+TV++NPRQ+K+P+WFLNRQKD KDG +SQV+SN LD KLR+DLERLKKIR H
Sbjct  61   DDEVEKLITVMSNPRQYKIPNWFLNRQKDVKDGKFSQVMSNQLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ADV40077.1| ribosomal protein S18 [Latrodectus hesperus]
Length=153

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  591  VANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAAE  412
            V  E FQHILR++NTN+DG++K+MFA+T+IKG+GRRF+N+ CKKAD+D+NKRAGEL+  E
Sbjct  4    VIPEKFQHILRVMNTNIDGRRKVMFALTAIKGVGRRFSNLVCKKADVDLNKRAGELSEEE  63

Query  411  IDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRGL  232
            ++ L+T+++NPRQ+K+PDWFLNRQKD KDG YSQV SN L+ KLR+DLERLKKIR H+GL
Sbjct  64   VEKLITIMSNPRQYKIPDWFLNRQKDIKDGKYSQVTSNGLENKLREDLERLKKIRAHKGL  123

Query  231  RHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  124  RHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ELT91955.1| hypothetical protein CAPTEDRAFT_228718 [Capitella teleta]
Length=152

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DG++KI +A+T+IKGIGRR++++ CKKAD+D+ KRAGEL+
Sbjct  1    MSLVIPEKFQHILRVMNTNIDGQRKIAYALTAIKGIGRRYSHVVCKKADVDLTKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD KDG YSQV++N LD K+RDDLERLKKIR H
Sbjct  61   EEEVEKVITIMSNPRQYKIPDWFLNRQKDVKDGKYSQVMANILDSKIRDDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_794924.2| PREDICTED: 40S ribosomal protein S18-like [Strongylocentrotus 
purpuratus]
Length=153

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            +LV  E FQHILR+LNTN+DG++KIM+A+T+IKG+GRR+ANICC+KADID++KRAGELT 
Sbjct  3    ALVLPEKFQHILRVLNTNIDGRRKIMYALTAIKGVGRRYANICCRKADIDVSKRAGELTD  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ LMT++ NPRQ+K+PDWFLNRQ D KDG Y Q+++N LD KLR+DLERLKKIR HR
Sbjct  63   DEVEKLMTILQNPRQYKIPDWFLNRQMDVKDGKYGQMMANNLDNKLREDLERLKKIRAHR  122

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  123  GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  153



>ref|XP_003385957.1| PREDICTED: 40S ribosomal protein S18 [Amphimedon queenslandica]
Length=152

 Score =   221 bits (562),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+LV  + FQHILR+LNTN+DG+QKIM+ +T IKG+GRR+AN+ CKKA++DMNKRAGELT
Sbjct  1    MALVLPDGFQHILRVLNTNIDGRQKIMYGLTCIKGVGRRYANLVCKKAEVDMNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              EI+ ++T++ NPR +K+PD+FLNRQKD KDG YSQVVSN LD KLR+DLERLKKIR H
Sbjct  61   EEEIERVVTILQNPRPYKIPDYFLNRQKDIKDGKYSQVVSNQLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_784070.3| PREDICTED: 40S ribosomal protein S18-like [Strongylocentrotus 
purpuratus]
Length=160

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            +LV  E FQHILR+LNTN+DG++KIM+A+T+IKG+GRR+ANICC+KADID++KRAGELT 
Sbjct  10   ALVLPEKFQHILRVLNTNIDGRRKIMYALTAIKGVGRRYANICCRKADIDVSKRAGELTD  69

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ LMT++ NPRQ+K+PDWFLNRQ D KDG Y Q+++N LD KLR+DLERLKKIR HR
Sbjct  70   DEVEKLMTILQNPRQYKIPDWFLNRQMDVKDGKYGQMMANNLDNKLREDLERLKKIRAHR  129

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  130  GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  160



>emb|CBN08641.1| 40S ribosomal protein S18 [Microcosmus squamiger]
Length=152

 Score =   220 bits (560),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+LV  E FQHILRI NTN+DG++KIM+AMT++KG+GRRF+N+ CKKAD+D+ KRAGELT
Sbjct  1    MALVIPEKFQHILRISNTNIDGRRKIMYAMTAVKGVGRRFSNLICKKADVDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              EID ++T++ NPRQ+K+PDWFLNRQKD KDG +SQV+SN LD KLR+D ER+KKIR H
Sbjct  61   DDEIDRVVTIMQNPRQYKIPDWFLNRQKDVKDGKFSQVLSNQLDNKLREDTERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_003460088.1| PREDICTED: 40S ribosomal protein S18-like [Oreochromis niloticus]
 ref|XP_004574897.1| PREDICTED: 40S ribosomal protein S18-like [Maylandia zebra]
 ref|XP_005750356.1| PREDICTED: 40S ribosomal protein S18-like [Pundamilia nyererei]
 ref|XP_005945534.1| PREDICTED: 40S ribosomal protein S18-like [Haplochromis burtoni]
Length=152

 Score =   219 bits (558),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+NKRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N+LD KLR+DLERLKKIR H
Sbjct  61   EEEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANSLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_006896042.1| PREDICTED: 40S ribosomal protein S18-like [Elephantulus edwardii]
Length=152

 Score =   219 bits (558),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG+QKI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRQKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EEEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>emb|CBI26252.3| unnamed protein product [Vitis vinifera]
Length=126

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  522  MFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNR  343
            MFA+TSIKGIGRRFANI CKKAD+DMNKRAGEL+AAE++NLM +VANPRQFK+PDWFLNR
Sbjct  1    MFALTSIKGIGRRFANIVCKKADVDMNKRAGELSAAELENLMVIVANPRQFKIPDWFLNR  60

Query  342  QKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktv  163
            +KDYKDG YSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV
Sbjct  61   KKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV  120

Query  162  gVSKKR  145
            GVSKKR
Sbjct  121  GVSKKR  126



>ref|XP_004073779.1| PREDICTED: 40S ribosomal protein S18 [Oryzias latipes]
 ref|XP_005804783.1| PREDICTED: 40S ribosomal protein S18-like [Xiphophorus maculatus]
 ref|XP_007569129.1| PREDICTED: 40S ribosomal protein S18 [Poecilia formosa]
 ref|XP_008302372.1| PREDICTED: 40S ribosomal protein S18 [Stegastes partitus]
 ref|XP_008329044.1| PREDICTED: 40S ribosomal protein S18 [Cynoglossus semilaevis]
 ref|XP_008420837.1| PREDICTED: 40S ribosomal protein S18 [Poecilia reticulata]
Length=152

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+NKRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EEEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_006815995.1| PREDICTED: 40S ribosomal protein S18-like [Saccoglossus kowalevskii]
Length=152

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+LV  E FQHILR++NTN+DG++KIMFA+T+IKG+GRR++N+ CKKAD+D+ KRA +++
Sbjct  1    MTLVIPEKFQHILRVMNTNIDGRRKIMFALTAIKGVGRRYSNVVCKKADVDLTKRAXKIS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A +++ L+T+++NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLER+KKIR H
Sbjct  61   AIQVEKLITIMSNPRQYKIPDWFLNRQKDVKDGKYSQVLANNLDNKLREDLERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|NP_001119689.1| ribosomal protein S18 [Acyrthosiphon pisum]
 gb|ABD72680.1| putative ribosomal protein S18 [Acyrthosiphon pisum]
 dbj|BAH70806.1| ACYPI000081 [Acyrthosiphon pisum]
 dbj|BAJ85454.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88402.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=152

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILRIL+TN+DGK+K+MFAMT+IKGIGRRF+NI  KKAD+D+NKRAGE T
Sbjct  1    MSLVIPEKFQHILRILSTNIDGKRKVMFAMTAIKGIGRRFSNIVLKKADVDLNKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD  DG +SQ+ S+ LD KLR+DLERLKKI+ H
Sbjct  61   DEEVEKIITIMQNPRQYKIPDWFLNRQKDVVDGKFSQLTSSTLDSKLREDLERLKKIKAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>dbj|BAM17725.1| ribosomal protein S18 [Papilio xuthus]
 dbj|BAM19040.1| ribosomal protein S18 [Papilio polytes]
Length=152

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILRI+NTN+DGK+K+MFAMT+IKG+GRR++NI  KKADID++KRAGE T
Sbjct  1    MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLRDDLERLKKIR H
Sbjct  61   EEEVEKIVTIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLRDDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ACO13080.1| 40S ribosomal protein S18 [Lepeophtheirus salmonis]
Length=152

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV +  FQHILR+LNTN+DG++ IMFAMT+IKGIGRR+ANI  KKADID+ KRAGEL+
Sbjct  1    MSLVISPTFQHILRVLNTNIDGRRNIMFAMTAIKGIGRRYANIVLKKADIDLYKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD K+G  SQV+SN+LD+KLR+DLERLKKIR H
Sbjct  61   EDEVEKIVTIMQNPRQYKIPDWFLNRQKDIKEGKTSQVMSNSLDIKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWG+RVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|AAX48895.1| S18 [Suberites domuncula]
Length=152

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+L+  + FQHILR+LNTN+DG QKIMF +T+IKG+GRR+AN+  KKAD+DMNKRAGEL+
Sbjct  1    MALIIPDKFQHILRVLNTNIDGHQKIMFGLTAIKGVGRRYANLVLKKADVDMNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              EI+ ++T++ NPRQ+K+PDWFLNRQKD++DG YSQ+++N L+ KLR+DLERLKKIR H
Sbjct  61   EEEIERVITIMQNPRQYKIPDWFLNRQKDHRDGKYSQILANQLEHKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWG+RVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_009021356.1| hypothetical protein HELRODRAFT_157357 [Helobdella robusta]
 gb|ESO00719.1| hypothetical protein HELRODRAFT_157357 [Helobdella robusta]
Length=153

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DGK+K+ FA+T+IKG+GRR+A++ CKKA++D+ KRAGELT
Sbjct  1    MSLVLPERFQHILRVMNTNIDGKRKVPFALTAIKGVGRRYAHVVCKKANVDVTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+T++ NPRQ+K+PDWFLNRQKD KDG YSQ +SN LD K+R+DLERLKKIR H
Sbjct  61   EEEVEKLVTIMGNPRQYKIPDWFLNRQKDIKDGKYSQAMSNILDSKIREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_010743696.1| PREDICTED: 40S ribosomal protein S18 [Larimichthys crocea]
Length=152

 Score =   218 bits (554),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+NKRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   DEEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|NP_775341.1| 40S ribosomal protein S18 [Danio rerio]
 ref|XP_007238842.1| PREDICTED: 40S ribosomal protein S18 [Astyanax mexicanus]
 sp|Q8JGS9.1|RS18_DANRE RecName: Full=40S ribosomal protein S18 [Danio rerio]
 gb|AAM28205.1| 40S ribosomal protein S18 [Danio rerio]
 gb|AAH62289.1| Ribosomal protein S18 [Danio rerio]
 emb|CAM56557.1| ribosomal protein S18 [Danio rerio]
Length=152

 Score =   218 bits (554),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+NKRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|AGO46414.1| ribosomal protein S18 [Reticulitermes flavipes]
Length=152

 Score =   218 bits (554),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++ TN+DGK+K+MFAMT+IKG+GRR+ANI  KKADID++KRAGE T
Sbjct  1    MSLVIPEKFQHILRVMGTNIDGKRKVMFAMTAIKGVGRRYANIVLKKADIDLDKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ANPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLERLKKIR H
Sbjct  61   DEEVEKIVTIMANPRQYKIPDWFLNRQKDIVDGKYSQLTSSYLDSKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>emb|CCD78299.1| putative 40s ribosomal protein S18 [Schistosoma mansoni]
Length=152

 Score =   218 bits (554),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M L+  E FQHILR++NTN+DG+ KIM+A+TSIKG+GRR+AN+ CKKADID+NKRAGELT
Sbjct  1    MDLMLPEKFQHILRVMNTNIDGQLKIMYAITSIKGVGRRYANVVCKKADIDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+TV++NPRQ+K+PDWFLNRQKD  DG +SQ++S AL+ KLR+DLERLK+IR+H
Sbjct  61   EDEVEKLVTVMSNPRQYKIPDWFLNRQKDVDDGKHSQLMSGALETKLREDLERLKRIRSH  120

Query  240  RGLRHYWGLRVRGQH  196
            RG+RHYWGLRVRGQH
Sbjct  121  RGIRHYWGLRVRGQH  135



>ref|XP_001696472.1| ribosomal protein S18, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP08449.1| ribosomal protein S18 [Chlamydomonas reinhardtii]
Length=153

 Score =   218 bits (554),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV  +DFQHILR+LNTNVDGK KIM+AMT+I+GIGRRF+N+ CKKA++D+ KRAGE +A
Sbjct  3    SLVQGDDFQHILRLLNTNVDGKNKIMYAMTAIRGIGRRFSNLVCKKAEVDLRKRAGECSA  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ +M +VANPR +K+PDWFLNRQKD+K G +SQ+ S+ LD  +RDDLERLKKIRNHR
Sbjct  63   DELERMMGIVANPRAYKIPDWFLNRQKDHKTGRFSQLTSSQLDTVMRDDLERLKKIRNHR  122

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRHYWGLRVRGQHTKTTGR GKTVGV+KK+
Sbjct  123  GLRHYWGLRVRGQHTKTTGRAGKTVGVAKKK  153



>gb|AAW27232.1| SJCHGC01887 protein [Schistosoma japonicum]
 emb|CAX77222.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77223.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77224.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77225.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77226.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77227.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77228.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77229.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX77230.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX71428.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX71429.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX71430.1| ribosomal protein S18 [Schistosoma japonicum]
 emb|CAX71431.1| ribosomal protein S18 [Schistosoma japonicum]
Length=152

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M L+  E FQHILR++NTN+DG+ KIM+A+TSIKG+GRR+AN+ CKKADID+NKRAGELT
Sbjct  1    MDLMLPEKFQHILRVMNTNIDGQLKIMYAITSIKGVGRRYANVVCKKADIDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ L+TV++NPRQ+K+PDWFLNRQKD  DG +SQ++S AL+ KLR+DLERLK+IR+H
Sbjct  61   DDEVEKLVTVMSNPRQYKIPDWFLNRQKDVDDGKHSQLMSAALETKLREDLERLKRIRSH  120

Query  240  RGLRHYWGLRVRGQH  196
            RG+RHYWGLRVRGQH
Sbjct  121  RGIRHYWGLRVRGQH  135



>ref|XP_005095271.1| PREDICTED: 40S ribosomal protein S18-like [Aplysia californica]
Length=152

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DG++KI FA+TSI+G+GRRFA + CKKA++D  KRAGEL+
Sbjct  1    MSLVLPEKFQHILRVMNTNIDGRRKIPFAITSIRGVGRRFAFVVCKKANVDTTKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++TV+ NPRQ+K+PDWFLNRQKD KDG +SQV+SN+LD KLR+DLERLKKIR H
Sbjct  61   EEEVERIITVMTNPRQYKIPDWFLNRQKDIKDGRFSQVLSNSLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWGLRVRGQH
Sbjct  121  RGLRHYWGLRVRGQH  135



>ref|XP_003969247.1| PREDICTED: 40S ribosomal protein S18-like [Takifugu rubripes]
 emb|CAH57704.1| 40S ribosomal protein S18 [Platichthys flesus]
 gb|ABJ98610.1| 40S ribosomal protein S18 [Scophthalmus maximus]
 dbj|BAF45907.1| ribosomal protein S18 [Solea senegalensis]
Length=152

 Score =   217 bits (553),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EEEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_004673426.1| PREDICTED: 40S ribosomal protein S18 [Condylura cristata]
 ref|XP_006882154.1| PREDICTED: 40S ribosomal protein S18 [Elephantulus edwardii]
Length=152

 Score =   217 bits (553),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EEEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ACQ58888.1| 40S ribosomal protein S18 [Anoplopoma fimbria]
 gb|AEG78402.1| 40S ribosomal protein S18 [Epinephelus coioides]
Length=152

 Score =   217 bits (553),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+NKRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   DDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_001099137.1| PREDICTED: 40S ribosomal protein S18-like isoform 2 [Macaca mulatta]
 ref|XP_001099240.1| PREDICTED: 40S ribosomal protein S18-like isoform 3 [Macaca mulatta]
 ref|XP_002804060.1| PREDICTED: 40S ribosomal protein S18-like [Macaca mulatta]
 ref|XP_002804061.1| PREDICTED: 40S ribosomal protein S18-like [Macaca mulatta]
Length=152

 Score =   217 bits (553),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG+QKI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRQKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQH KTTGR G+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHAKTTGRCGRTVGVSKKK  152



>ref|XP_004349731.1| ribosomal protein S13p/S18e, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22609.1| ribosomal protein S13p/S18e, putative [Acanthamoeba castellanii 
str. Neff]
Length=162

 Score =   217 bits (553),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            +LV  +DFQHILR+LNTN+DGKQKI+FA+T+IKG+GRRFAN+ CKKAD+D+NKRAGEL+ 
Sbjct  9    ALVQQDDFQHILRVLNTNIDGKQKIVFALTAIKGVGRRFANVVCKKADVDLNKRAGELSN  68

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E+D ++ ++ +PRQFK+PDWFLNR+KD KDG Y+Q  SN LD KLR+D ERLK++R HR
Sbjct  69   DEVDKIVNIIQHPRQFKIPDWFLNRKKDIKDGKYTQAYSNILDQKLREDFERLKRMRCHR  128

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRH+WGLRVRGQHTKTTGR+G+T+GVSKKR
Sbjct  129  GLRHFWGLRVRGQHTKTTGRKGRTMGVSKKR  159



>gb|KIP06585.1| hypothetical protein PHLGIDRAFT_90644 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=156

 Score =   217 bits (553),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+K+M+A+T IKG+GRR+AN+ CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKVMYALTEIKGVGRRYANLVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL + E++ L+T++ NP QFK+P WFLNRQ+D  DG  SQ++SNA+D KLRDDLERLKKI
Sbjct  61   ELNSDELERLVTIIQNPTQFKIPTWFLNRQRDIVDGKNSQILSNAVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>ref|NP_001037269.1| ribosomal protein S18 [Bombyx mori]
 dbj|BAD26676.1| Ribosomal protein S18 [Plutella xylostella]
 gb|AAV34876.1| ribosomal protein S18 [Bombyx mori]
 gb|AEL28845.1| ribosomal protein S18 [Heliconius melpomene cythera]
Length=152

 Score =   217 bits (552),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILRI+NTN+DGK+K+MFAMT+IKG+GRR++NI  KKADID++KRAGE T
Sbjct  1    MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLERLKKIR H
Sbjct  61   EEEVEKIITIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_005832131.1| small subunit ribosomal protein S18e_1, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX45151.1| small subunit ribosomal protein S18e_1, cytoplasmic [Guillardia 
theta CCMP2712]
Length=155

 Score =   217 bits (552),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = -2

Query  600  MSLVANE--DFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            MSL   +  DFQHILRIL TN+DGKQK+M+AMTS+KGIGRRF+NI CKKAD+DM+KRAGE
Sbjct  1    MSLTIKDGGDFQHILRILGTNIDGKQKVMYAMTSVKGIGRRFSNIVCKKADVDMDKRAGE  60

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            LT  E+D+L+TV+  P +FK+P W LNR+KD+KDG  SQ+ SN +D K+RDDLERLKKI+
Sbjct  61   LTQKEMDDLVTVIQVPHEFKIPAWMLNRRKDFKDGKTSQLSSNQIDQKMRDDLERLKKIK  120

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKK+
Sbjct  121  NHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKK  154



>sp|Q962R1.1|RS18_SPOFR RecName: Full=40S ribosomal protein S18 [Spodoptera frugiperda]
 gb|AAK92187.1|AF400215_1 ribosomal protein S18 [Spodoptera frugiperda]
 dbj|BAD23920.1| ribosomal protein S18 [Antheraea yamamai]
 gb|ACY95313.1| ribosomal protein S18 [Manduca sexta]
 gb|ADT80664.1| ribosomal protein S18 [Euphydryas aurinia]
 gb|AJG43846.1| ribosomal protein rps18 [Bicyclus anynana]
Length=152

 Score =   217 bits (552),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILRI+NTN+DGK+K+MFAMT+IKG+GRR++NI  KKADID++KRAGE T
Sbjct  1    MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLERLKKIR H
Sbjct  61   EEEVEKIVTIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ABO26686.1| 40S ribosomal protein S18 [Haliotis discus discus]
 gb|AEW42983.1| putative 40S ribosomal protein S18 [Haliotis diversicolor]
Length=154

 Score =   217 bits (552),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV  E FQHILR++NTN+DG+ KIMFA+T+IKG+GRRF+N+  KKA+ID+ KRAGEL+ 
Sbjct  4    SLVIPEKFQHILRVMNTNIDGRTKIMFALTAIKGMGRRFSNVVLKKANIDLTKRAGELSD  63

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E+D ++TV+ NPRQ+K+PDWFLNRQKD KDG ++QV++N LD KLR+DLERLKKIRNHR
Sbjct  64   EEVDRVITVMTNPRQYKIPDWFLNRQKDVKDGKFNQVLANMLDNKLREDLERLKKIRNHR  123

Query  237  GLRHYWGLRVRGQH  196
            GLRHYWGLRVRGQH
Sbjct  124  GLRHYWGLRVRGQH  137



>gb|AEE61885.1| unknown [Dendroctonus ponderosae]
 gb|ENN78677.1| hypothetical protein YQE_04849, partial [Dendroctonus ponderosae]
 gb|ERL95232.1| hypothetical protein D910_12499 [Dendroctonus ponderosae]
Length=152

 Score =   217 bits (552),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILRIL TN+DGK+K+MFA+T+IKG+GRR++NI  KKAD+D+NKRAGE +
Sbjct  1    MSLVIPEKFQHILRILGTNIDGKRKVMFALTAIKGVGRRYSNIVLKKADVDLNKRAGECS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD  DG YSQ+ S++LD KLR+DLER+KKIR H
Sbjct  61   EEEVEKIITIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSSLDSKLREDLERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|AFK49801.1| ribosomal protein S18 [Cryptocercus punctulatus]
Length=152

 Score =   217 bits (552),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++ TN+DGK+K+MFAMT+IKG+GRR+ANI  KKADID++KRAGE T
Sbjct  1    MSLVIPEKFQHILRVMGTNIDGKRKVMFAMTAIKGVGRRYANIVLKKADIDLDKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLERLKKIR H
Sbjct  61   DEEVEKIITIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSYLDSKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|EDL00865.1| mCG114988 [Mus musculus]
Length=152

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGQTVGVSKKK  152



>gb|ABM55460.1| ribosomal protein S18 [Xenopsylla cheopis]
Length=152

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILRI++TN+DGK+K+MFAMT+IKG+GRR+ANI  KKAD+D+NKRAGE T
Sbjct  1    MSLVIPDKFQHILRIMSTNIDGKRKVMFAMTAIKGVGRRYANIVLKKADVDLNKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++ PRQFK+PDWFLNRQKD  DG YSQ+ S++LD KLR+DLER+KKI+ H
Sbjct  61   EEEVEKIVTIMSTPRQFKIPDWFLNRQKDIVDGRYSQLTSSSLDSKLREDLERMKKIKAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_009032954.1| hypothetical protein AURANDRAFT_20379 [Aureococcus anophagefferens]
 gb|EGB11831.1| hypothetical protein AURANDRAFT_20379 [Aureococcus anophagefferens]
Length=154

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV + DFQHILR+LNTN+DG++K+MFA+TSI G+GRRF+N+ CKKA +D +KRAGELTA
Sbjct  5    SLVISPDFQHILRVLNTNIDGRRKVMFALTSIPGVGRRFSNVVCKKAAVDAHKRAGELTA  64

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ L+ ++ NP+QFK+P WFLNRQKDYK G YSQ  +N L  KLR+DLERLKKIR HR
Sbjct  65   DEVEKLVAIIQNPKQFKIPAWFLNRQKDYKTGKYSQAFANTLQQKLREDLERLKKIRAHR  124

Query  237  GLRHYWGLRVRGQH  196
            GLRHYWG+RVRGQH
Sbjct  125  GLRHYWGIRVRGQH  138



>ref|NP_001187081.1| 40S ribosomal protein S18 [Ictalurus punctatus]
 sp|Q90YQ5.1|RS18_ICTPU RecName: Full=40S ribosomal protein S18 [Ictalurus punctatus]
 gb|AAK95201.1|AF402827_1 40S ribosomal protein S18 [Ictalurus punctatus]
Length=152

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|NP_035426.1| 40S ribosomal protein S18 [Mus musculus]
 ref|NP_072045.1| 40S ribosomal protein S18 [Homo sapiens]
 ref|NP_998722.1| 40S ribosomal protein S18 [Rattus norvegicus]
 ref|NP_999105.1| 40S ribosomal protein S18 [Sus scrofa]
 ref|NP_001028786.1| 40S ribosomal protein S18 [Bos taurus]
 ref|NP_001041547.1| 40S ribosomal protein S18 [Canis lupus familiaris]
 ref|NP_001232160.1| putative ribosomal protein S18 [Taeniopygia guttata]
 ref|NP_001272568.1| 40S ribosomal protein S18 [Capra hircus]
 ref|XP_001170296.1| PREDICTED: 40S ribosomal protein S18 [Pan troglodytes]
 ref|XP_001497114.1| PREDICTED: 40S ribosomal protein S18 [Equus caballus]
 ref|XP_002714578.1| PREDICTED: 40S ribosomal protein S18 [Oryctolagus cuniculus]
 ref|XP_002720764.1| PREDICTED: 40S ribosomal protein S18 [Oryctolagus cuniculus]
 ref|XP_002724624.1| PREDICTED: 40S ribosomal protein S18 [Rattus norvegicus]
 ref|XP_002727879.1| PREDICTED: 40S ribosomal protein S18 [Rattus norvegicus]
 ref|XP_002746441.1| PREDICTED: 40S ribosomal protein S18 [Callithrix jacchus]
 ref|XP_002809198.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Pongo abelii]
 ref|XP_003473973.1| PREDICTED: 40S ribosomal protein S18 [Cavia porcellus]
 ref|XP_003768998.1| PREDICTED: 40S ribosomal protein S18-like [Sarcophilus harrisii]
 ref|XP_003772957.1| PREDICTED: 40S ribosomal protein S18-like [Sarcophilus harrisii]
 ref|XP_003789133.1| PREDICTED: 40S ribosomal protein S18 [Otolemur garnettii]
 ref|XP_003808634.1| PREDICTED: 40S ribosomal protein S18 [Pan paniscus]
 ref|XP_003897490.1| PREDICTED: 40S ribosomal protein S18 [Papio anubis]
 ref|XP_003923191.1| PREDICTED: 40S ribosomal protein S18 [Saimiri boliviensis boliviensis]
 ref|XP_003986056.1| PREDICTED: 40S ribosomal protein S18 [Felis catus]
 ref|XP_004018794.1| PREDICTED: 40S ribosomal protein S18 [Ovis aries]
 ref|XP_004043854.1| PREDICTED: 40S ribosomal protein S18 [Gorilla gorilla gorilla]
 ref|XP_004267792.1| PREDICTED: 40S ribosomal protein S18 [Orcinus orca]
 ref|XP_004319469.1| PREDICTED: 40S ribosomal protein S18 [Tursiops truncatus]
 ref|XP_004389860.1| PREDICTED: 40S ribosomal protein S18 [Trichechus manatus latirostris]
 ref|XP_004407753.1| PREDICTED: 40S ribosomal protein S18 [Odobenus rosmarus divergens]
 ref|XP_004424338.1| PREDICTED: 40S ribosomal protein S18 [Ceratotherium simum simum]
 ref|XP_004479851.1| PREDICTED: 40S ribosomal protein S18 [Dasypus novemcinctus]
 ref|XP_004617727.1| PREDICTED: 40S ribosomal protein S18 [Sorex araneus]
 ref|XP_004624304.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Octodon degus]
 ref|XP_004624305.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Octodon degus]
 ref|XP_004711801.1| PREDICTED: 40S ribosomal protein S18 [Echinops telfairi]
 ref|XP_004770658.1| PREDICTED: 40S ribosomal protein S18 [Mustela putorius furo]
 ref|XP_004817268.1| PREDICTED: 40S ribosomal protein S18 [Mustela putorius furo]
 ref|XP_004890139.1| PREDICTED: 40S ribosomal protein S18 [Heterocephalus glaber]
 ref|XP_004846880.1| PREDICTED: 40S ribosomal protein S18 [Heterocephalus glaber]
 ref|XP_005084908.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Mesocricetus 
auratus]
 ref|XP_005313224.1| PREDICTED: 40S ribosomal protein S18 [Chrysemys picta bellii]
 ref|XP_005360465.1| PREDICTED: 40S ribosomal protein S18 [Microtus ochrogaster]
 ref|XP_005364840.1| PREDICTED: 40S ribosomal protein S18-like [Microtus ochrogaster]
 ref|XP_005318881.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Ictidomys tridecemlineatus]
 ref|XP_005318882.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Ictidomys tridecemlineatus]
 ref|XP_005389536.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Chinchilla lanigera]
 ref|XP_005389537.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Chinchilla lanigera]
 ref|XP_005534438.1| PREDICTED: 40S ribosomal protein S18 [Pseudopodoces humilis]
 ref|XP_005553384.1| PREDICTED: 40S ribosomal protein S18 [Macaca fascicularis]
 ref|XP_005571496.1| PREDICTED: 40S ribosomal protein S18-like [Macaca fascicularis]
 ref|XP_005868003.1| PREDICTED: 40S ribosomal protein S18 [Myotis brandtii]
 ref|XP_005979830.1| PREDICTED: 40S ribosomal protein S18 [Pantholops hodgsonii]
 ref|XP_006130689.1| PREDICTED: 40S ribosomal protein S18-like [Pelodiscus sinensis]
 ref|XP_006105528.1| PREDICTED: 40S ribosomal protein S18 [Myotis lucifugus]
 ref|XP_006180572.1| PREDICTED: 40S ribosomal protein S18 [Camelus ferus]
 ref|XP_006202192.1| PREDICTED: 40S ribosomal protein S18 [Vicugna pacos]
 ref|XP_006144296.1| PREDICTED: 40S ribosomal protein S18 [Tupaia chinensis]
 ref|XP_006769211.1| PREDICTED: 40S ribosomal protein S18 [Myotis davidii]
 ref|XP_006738128.1| PREDICTED: 40S ribosomal protein S18 [Leptonychotes weddellii]
 ref|XP_006860416.1| PREDICTED: 40S ribosomal protein S18 [Chrysochloris asiatica]
 ref|XP_006907446.1| PREDICTED: 40S ribosomal protein S18 [Pteropus alecto]
 ref|XP_006996627.1| PREDICTED: 40S ribosomal protein S18 [Peromyscus maniculatus 
bairdii]
 ref|XP_007093286.1| PREDICTED: 40S ribosomal protein S18 [Panthera tigris altaica]
 ref|XP_007128883.1| PREDICTED: 40S ribosomal protein S18 [Physeter catodon]
 ref|XP_006048351.1| PREDICTED: 40S ribosomal protein S18-like [Bubalus bubalis]
 ref|XP_006050373.1| PREDICTED: 40S ribosomal protein S18 [Bubalus bubalis]
 ref|XP_007186963.1| PREDICTED: 40S ribosomal protein S18 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007460886.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Lipotes vexillifer]
 ref|XP_007460887.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Lipotes vexillifer]
 ref|XP_007527489.1| PREDICTED: 40S ribosomal protein S18 [Erinaceus europaeus]
 ref|XP_007649606.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Cricetulus griseus]
 ref|XP_007623241.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Cricetulus griseus]
 ref|XP_007937513.1| PREDICTED: 40S ribosomal protein S18 [Orycteropus afer afer]
 ref|XP_007971148.1| PREDICTED: 40S ribosomal protein S18 [Chlorocebus sabaeus]
 ref|XP_008121456.1| PREDICTED: 40S ribosomal protein S18 [Anolis carolinensis]
 ref|XP_008058435.1| PREDICTED: 40S ribosomal protein S18 [Tarsius syrichta]
 ref|XP_008541947.1| PREDICTED: 40S ribosomal protein S18 [Equus przewalskii]
 ref|XP_008580050.1| PREDICTED: 40S ribosomal protein S18 [Galeopterus variegatus]
 ref|XP_008691661.1| PREDICTED: 40S ribosomal protein S18 [Ursus maritimus]
 ref|XP_008838402.1| PREDICTED: 40S ribosomal protein S18 [Nannospalax galili]
 ref|XP_008960219.1| PREDICTED: 40S ribosomal protein S18 [Pan paniscus]
 ref|XP_009437255.1| PREDICTED: 40S ribosomal protein S18 [Pan troglodytes]
 ref|XP_010356159.1| PREDICTED: 40S ribosomal protein S18 [Rhinopithecus roxellana]
 ref|XP_010603572.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Fukomys damarensis]
 ref|XP_010603573.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Fukomys damarensis]
 ref|XP_010846899.1| PREDICTED: 40S ribosomal protein S18 [Bison bison bison]
 ref|XP_010947396.1| PREDICTED: 40S ribosomal protein S18 [Camelus bactrianus]
 ref|XP_010992862.1| PREDICTED: 40S ribosomal protein S18 [Camelus dromedarius]
 ref|XP_011216871.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Ailuropoda melanoleuca]
 ref|XP_011371748.1| PREDICTED: 40S ribosomal protein S18 isoform X2 [Pteropus vampyrus]
 sp|P62271.3|RS18_RAT RecName: Full=40S ribosomal protein S18 [Rattus norvegicus]
 sp|P62269.3|RS18_HUMAN RecName: Full=40S ribosomal protein S18; AltName: Full=Ke-3; 
Short=Ke3 [Homo sapiens]
 sp|P62272.3|RS18_PIG RecName: Full=40S ribosomal protein S18 [Sus scrofa]
 sp|P62270.3|RS18_MOUSE RecName: Full=40S ribosomal protein S18; AltName: Full=Ke-3; 
Short=Ke3 [Mus musculus]
 sp|Q5TJE9.3|RS18_CANFA RecName: Full=40S ribosomal protein S18 [Canis lupus familiaris]
 sp|Q3T0R1.3|RS18_BOVIN RecName: Full=40S ribosomal protein S18 [Bos taurus]
 sp|A5JST6.1|RS18_CAPHI RecName: Full=40S ribosomal protein S18 [Capra hircus]
 pdb|2ZKQ|MM Chain m, Structure Of A Mammalian Ribosomal 40s Subunit Within 
An 80s Complex Obtained By Docking Homology Models Of The 
Rna And Proteins Into An 8.7 A Cryo-em Map
 pdb|3J3A|S Chain S, Structure Of The Human 40s Ribosomal Proteins
 pdb|4KZX|S Chain S, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|S Chain S, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|S Chain S, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|S Chain S, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|S Chain S, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|S Chain S, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4W23|S Chain S, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|S Chain S, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 pdb|4D5L|S Chain S, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 pdb|4D61|S Chain S, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 gb|AAA16795.1| ribosomal protein [Mus musculus]
 emb|CAA40750.1| ribosomal protein S18 [Rattus rattus]
 dbj|BAA19211.1| ribosomal protein [Sus scrofa]
 gb|AAC69898.1| ribosomal protein subunit S18 [Mus musculus]
 emb|CAA20231.1| ribosomal protein S18 [Homo sapiens]
 gb|AAC97978.1| RPS18 [Mus musculus]
 emb|CAB56794.1| ribosomal protein S18 [Homo sapiens]
 dbj|BAC34350.1| unnamed protein product [Mus musculus]
 emb|CAE83925.1| ribosomal protein S18 [Rattus norvegicus]
 gb|AAH81459.1| Ribosomal protein S18 [Mus musculus]
 gb|AAH81458.1| Ribosomal protein S18 [Mus musculus]
 emb|CAI11439.1| ribosomal protein S18 [Canis lupus familiaris]
 gb|AAH93500.1| Ribosomal protein S18 [Mus musculus]
 gb|AAI00605.1| Ribosomal protein S18 [Mus musculus]
 dbj|BAE41010.1| unnamed protein product [Mus musculus]
 dbj|BAE30520.1| unnamed protein product [Mus musculus]
 dbj|BAE27106.1| unnamed protein product [Mus musculus]
 gb|AAI02294.1| Ribosomal protein S18 [Bos taurus]
 gb|AAI01787.1| Ribosomal protein S18 [Homo sapiens]
 gb|AAI01789.1| Ribosomal protein S18 [Homo sapiens]
 gb|AAI06064.1| Ribosomal protein S18 [Homo sapiens]
 gb|AAI26073.1| Ribosomal protein S18 [Rattus norvegicus]
 gb|EAX03695.1| ribosomal protein S18, isoform CRA_b [Homo sapiens]
 gb|ABQ51201.1| ribosomal protein S18 [Capra hircus]
 gb|EDL10232.1| mCG23000, isoform CRA_b [Mus musculus]
 gb|EDL96842.1| rCG60872, isoform CRA_a [Rattus norvegicus]
 gb|ACH43676.1| putative ribosomal protein S18 [Taeniopygia guttata]
 tpg|DAA16670.1| TPA: 40S ribosomal protein S18 [Bos taurus]
 dbj|BAJ20866.1| ribosomal protein S18 [synthetic construct]
 gb|EHH20995.1| hypothetical protein EGK_03965 [Macaca mulatta]
 gb|ELW69544.1| 40S ribosomal protein S18 [Tupaia chinensis]
 gb|ERE92023.1| 40S ribosomal protein S18-like protein [Cricetulus griseus]
 gb|AIC49648.1| RPS18, partial [synthetic construct]
 gb|KFO23117.1| 40S ribosomal protein S18 [Fukomys damarensis]
Length=152

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ACY71272.1| ribosomal protein S18 [Chrysomela tremula]
Length=152

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILRIL TN+DGK+K+MFA+T+IKG+GRR+ANI  KKAD+D++KRAGE +
Sbjct  1    MSLVIPEKFQHILRILGTNIDGKRKVMFALTAIKGVGRRYANIVLKKADVDLDKRAGECS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ANPRQ+K+PDWFLNRQKD  DG YSQ+ S++LD KLR+DLER+KKIR H
Sbjct  61   DEEVEKIITIMANPRQYKIPDWFLNRQKDIIDGKYSQLTSSSLDSKLREDLERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_011505351.1| PREDICTED: 40S ribosomal protein S18 [Ceratosolen solmsi marchali]
Length=152

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++NTN+DG +K+MFAMT+IKG+GRR+ANI  KKADID++KRAGE +
Sbjct  1    MSLVIPEKFQHILRVVNTNIDGNRKVMFAMTAIKGVGRRYANIVLKKADIDLDKRAGECS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ANPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLER+KKIR H
Sbjct  61   EEEVEKIVTIMANPRQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_006032333.1| PREDICTED: 40S ribosomal protein S18 [Alligator sinensis]
 ref|XP_006271746.1| PREDICTED: 40S ribosomal protein S18 [Alligator mississippiensis]
Length=152

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_003271942.1| PREDICTED: 40S ribosomal protein S18 isoform 1 [Nomascus leucogenys]
Length=175

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  24   MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  83

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  84   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  143

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  144  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  175



>gb|KGB32353.1| 40S ribosomal protein S18 [Schistosoma haematobium]
Length=174

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = -2

Query  645  IQFSGERERGEKAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICC  466
            +Q   +  R E+A    L+  E FQHILR++NTN+DG+ KIM+A+TSIKG+GRR+AN+ C
Sbjct  11   VQPHAQSLRDEEA---DLMLPEKFQHILRVMNTNIDGQLKIMYAITSIKGVGRRYANVVC  67

Query  465  KKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDM  286
            KKADID+NKRAGELT  E++ L+TV++NPRQ+K+PDWFLNRQKD  DG +SQ++S AL+ 
Sbjct  68   KKADIDLNKRAGELTEDEVEKLVTVMSNPRQYKIPDWFLNRQKDVDDGKHSQLMSGALET  127

Query  285  KLRDDLERLKKIRNHRGLRHYWGLRVRGQH  196
            KLR+DLERLK+IR+HRG+RHYWGLRVRGQH
Sbjct  128  KLREDLERLKRIRSHRGIRHYWGLRVRGQH  157



>gb|ACI70010.1| 40S ribosomal protein S18 [Salmo salar]
Length=152

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   DDEVEGVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>emb|CAH04336.1| S18e ribosomal protein [Cicindela campestris]
Length=152

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILRIL TN+DGK+K+MFAMT+IKG+GRR+ANI  KKAD+D++KRAGE +
Sbjct  1    MSLVIPEKFQHILRILGTNIDGKRKVMFAMTAIKGVGRRYANIVLKKADVDLDKRAGECS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLER+KKIR H
Sbjct  61   EEEVEKIITIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|EYU40914.1| hypothetical protein MIMGU_mgv1a015580mg [Erythranthe guttata]
Length=126

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  522  MFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNR  343
            MFAMTSIKGIGRRFANI CKKAD+DMNKRAGEL+ AEID+LM +VANPRQFK+PDWFLNR
Sbjct  1    MFAMTSIKGIGRRFANIVCKKADVDMNKRAGELSNAEIDSLMVIVANPRQFKIPDWFLNR  60

Query  342  QKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktv  163
            +KDYKDG +SQV SNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV
Sbjct  61   KKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV  120

Query  162  gVSKKR  145
            GVSKKR
Sbjct  121  GVSKKR  126



>ref|XP_001826904.1| 40S ribosomal protein S18 [Aspergillus oryzae RIB40]
 ref|XP_002385145.1| 40S ribosomal protein S18 [Aspergillus flavus NRRL3357]
 dbj|BAE65771.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED45016.1| ribosomal protein S13p/S18e [Aspergillus flavus NRRL3357]
 gb|EIT73770.1| ribosomal protein [Aspergillus oryzae 3.042]
 gb|KDE78568.1| ribosomal protein [Aspergillus oryzae 100-8]
Length=155

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = -2

Query  600  MSLVANE--DFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            MSLV+ E  +FQ+ILR+LNTNVDGKQKIM+A+T IKG+GRR++N+ CKKAD+D+NKRAGE
Sbjct  1    MSLVSGEKTNFQYILRLLNTNVDGKQKIMYALTQIKGVGRRYSNLVCKKADVDLNKRAGE  60

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            LT  E++ ++T++ NP Q+K+P WFLNRQ+D  DG  SQVVSN LD K+R+DLERLKKIR
Sbjct  61   LTTEELERVVTILQNPTQYKIPTWFLNRQRDITDGKDSQVVSNNLDSKMREDLERLKKIR  120

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            +HRGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  SHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  154



>ref|NP_001290753.1| ribosomal protein S18 [Esox lucius]
 ref|XP_010782878.1| PREDICTED: 40S ribosomal protein S18 [Notothenia coriiceps]
 gb|ABQ59673.1| ribosomal protein S18 [Salmo salar]
 gb|ACH70615.1| ribosomal protein S18 [Salmo salar]
 gb|ACI66957.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACI67484.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACI69333.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACI69981.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACN09828.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACN09920.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACN12175.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACN12267.1| 40S ribosomal protein S18 [Salmo salar]
 gb|ACO07429.1| 40S ribosomal protein S18 [Oncorhynchus mykiss]
 gb|ACO07710.1| 40S ribosomal protein S18 [Oncorhynchus mykiss]
 gb|ACO08788.1| 40S ribosomal protein S18 [Oncorhynchus mykiss]
 gb|ACO13930.1| 40S ribosomal protein S18 [Esox lucius]
 gb|ACX35593.1| ribosomal protein S18 [Salmo salar]
 gb|ACX35606.1| ribosomal protein S18 [Salmo salar]
 gb|ADN37677.1| ribosomal protein S18 [Oncorhynchus mykiss]
Length=152

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   DDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>emb|CCQ18669.1| ribosomal protein S18 [Sycon ciliatum]
Length=152

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            M+L+  E FQ++LR+LNTN+DG+QK+MFA+TSIKG+GRR++NI  KKADID+NKRAGEL+
Sbjct  1    MALLLPEKFQYVLRVLNTNIDGRQKVMFALTSIKGVGRRYSNIVLKKADIDLNKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++ ++ NPRQ+K+PDWFLNRQKD KDG +SQ++SN L+ KLR+DLERLKKIR H
Sbjct  61   EDEVERIVAILQNPRQYKIPDWFLNRQKDIKDGKFSQIISNQLEHKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRHYWG+RVRGQH
Sbjct  121  RGLRHYWGVRVRGQH  135



>gb|ACO11045.1| 40S ribosomal protein S18 [Caligus rogercresseyi]
Length=152

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV +  FQHILR++NTN+DG + IMFAMT+IKGIGRR+AN+  KKADID++KRAGEL+
Sbjct  1    MSLVISPTFQHILRVMNTNIDGMRNIMFAMTAIKGIGRRYANLVLKKADIDLHKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD K+G  SQV+SNALD KLR+DLERLKKIR H
Sbjct  61   EDEVEKIITIMQNPRQYKIPDWFLNRQKDIKEGKTSQVMSNALDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWG+RVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_007353912.1| ribosomal protein S13 [Auricularia delicata TFB-10046 SS5]
 gb|EJD37951.1| ribosomal protein S13 [Auricularia delicata TFB-10046 SS5]
Length=156

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLVA---NEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLVA   N  FQHILR+LNTNVDGK+K+M+A+T IKG+GRR+ANI CKKAD+D+NKRAG
Sbjct  1    MSLVAPDPNVQFQHILRLLNTNVDGKRKVMYALTEIKGVGRRYANIVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            +L + E++ ++T++ NP QFK+P WFLNRQKD  DG  SQ+VSNA+D KLRDDLERLKKI
Sbjct  61   DLNSDELERIVTIIQNPTQFKIPTWFLNRQKDIVDGKNSQLVSNAVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>ref|XP_007397054.1| hypothetical protein PHACADRAFT_258160 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM54356.1| hypothetical protein PHACADRAFT_258160 [Phanerochaete carnosa 
HHB-10118-sp]
Length=156

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+K+M+A+T IKG+GRR+ANI CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKVMYALTEIKGVGRRYANIVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL + E++ L+T++ NP QFKVP WFLNRQ+D  DG  SQ++SN +D KLRDDLERLKKI
Sbjct  61   ELNSDELERLVTIIQNPLQFKVPTWFLNRQRDIVDGKTSQILSNGVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>dbj|BAE35083.1| unnamed protein product [Mus musculus]
 dbj|BAE35401.1| unnamed protein product [Mus musculus]
Length=152

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+I+G+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIRGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_006900748.1| PREDICTED: 40S ribosomal protein S18-like [Elephantulus edwardii]
Length=177

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            +SLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  26   VSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  85

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E+++++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  86   EEEVEHVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  145

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  146  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  177



>emb|CDQ70124.1| unnamed protein product [Oncorhynchus mykiss]
Length=158

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  615  EKAIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKR  436
            E  ++ SLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KR
Sbjct  2    EVQLLSSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKR  61

Query  435  AGELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLK  256
            AGELT  E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLK
Sbjct  62   AGELTDDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLK  121

Query  255  KIRNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            KIR HRGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  122  KIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  158



>ref|XP_005707661.1| 40S ribosomal protein S18 [Galdieria sulphuraria]
 gb|EME31141.1| 40S ribosomal protein S18 [Galdieria sulphuraria]
Length=154

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  594  LVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAA  415
            L+ + +FQHILRILNTN+DGK+K+M+A+TSIKG+GRRF+N+  KKA++D++KRAG+LTA 
Sbjct  4    LLQSSEFQHILRILNTNIDGKRKVMYALTSIKGVGRRFSNLVLKKAEVDVSKRAGDLTAE  63

Query  414  EIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRG  235
            EID ++T++ NPRQFK+PDWFLNRQKD +DG Y+Q++SN LD KLR+DL+RL+KIR HRG
Sbjct  64   EIDRIVTIIQNPRQFKIPDWFLNRQKDVRDGKYTQLISNNLDFKLREDLDRLRKIRAHRG  123

Query  234  LRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            LRH WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  124  LRHMWGLRVRGQHTKTTGRRGRTVGVSKKK  153



>ref|XP_002131089.1| PREDICTED: 40S ribosomal protein S18 [Ciona intestinalis]
Length=152

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILRILNTN+DG++ I FA+T+IKGIGRRF+ + CKKAD+D+ KRAGEL+
Sbjct  1    MSLVIPEKFQHILRILNTNIDGRRHIAFALTAIKGIGRRFSTLVCKKADVDLTKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              EID ++T++ NPRQ+K+PDWFLNRQKD +DG + Q++SN LD KLR+D+ERLKKIR H
Sbjct  61   DDEIDRIVTIMQNPRQYKIPDWFLNRQKDVRDGKFGQILSNQLDNKLREDIERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|KIM45047.1| hypothetical protein M413DRAFT_441693 [Hebeloma cylindrosporum 
h7]
Length=156

 Score =   215 bits (548),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+KIMFA+T IKG+GRR++N+ CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKIMFALTEIKGVGRRYSNLVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            +L + E++ L+T++ NP QFK+P WFLNRQKD  DG  SQ++SN +D KLRDDLERLKKI
Sbjct  61   DLNSDELERLVTIIQNPTQFKIPTWFLNRQKDIIDGKNSQILSNGVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>ref|XP_005558824.1| PREDICTED: 40S ribosomal protein S18-like [Macaca fascicularis]
Length=152

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KAD+D+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADVDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD +LR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDKQLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_002109240.1| ribosomal protein S18 [Trichoplax adhaerens]
 gb|EDV27406.1| ribosomal protein S18 [Trichoplax adhaerens]
Length=153

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV  E FQHILR++ TN+DG+ KIMFA+T+IKG GRRFANI CKKA +D++KRAGELT 
Sbjct  3    SLVLPEKFQHILRVMGTNIDGRVKIMFALTAIKGCGRRFANIVCKKAGVDIDKRAGELTE  62

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             EID ++T++ NPRQ+K+PDWFLNRQKD KDG +SQV+SN L+ KLR+DLERLKK+R HR
Sbjct  63   DEIDKVITIMQNPRQYKIPDWFLNRQKDIKDGKFSQVLSNNLETKLREDLERLKKVRAHR  122

Query  237  GLRHYWGLRVRGQH  196
            G+RHYWGLRVRGQH
Sbjct  123  GIRHYWGLRVRGQH  136



>ref|XP_004375591.1| PREDICTED: 40S ribosomal protein S18-like [Trichechus manatus 
latirostris]
Length=152

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG+ KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRWKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|NP_001084747.1| ribosomal protein S18 [Xenopus laevis]
 gb|AAH68873.1| MGC82306 protein [Xenopus laevis]
Length=152

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKI+ H
Sbjct  61   EDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIKAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|NP_001016358.1| ribosomal protein S18 [Xenopus (Silurana) tropicalis]
 gb|AAI55979.1| ribosomal protein S18 [Xenopus (Silurana) tropicalis]
 gb|AAI59393.1| ribosomal protein S18 [Xenopus (Silurana) tropicalis]
Length=152

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKI+ H
Sbjct  61   EDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIKAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|EDL11403.1| mCG9349 [Mus musculus]
Length=143

 Score =   214 bits (546),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   QDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRH+WGLRVRGQH
Sbjct  121  RGLRHFWGLRVRGQH  135



>ref|XP_007380884.1| ribosomal protein S13 [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN11357.1| ribosomal protein S13 [Punctularia strigosozonata HHB-11173 SS5]
Length=156

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+KIM+A+T IKG+GRR+ANI CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKIMYALTEIKGVGRRYANIVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL + E++ ++T++ NP QFK+P WFLNRQKD  DG  SQ++SN +D KLRDDLERLKKI
Sbjct  61   ELNSDELERVVTIIQNPTQFKIPTWFLNRQKDIVDGKNSQILSNGVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>emb|CDS03642.1| Putative 40S ribosomal protein S18 [Absidia idahoensis var. thermophila]
 emb|CDS06403.1| Putative 40S ribosomal protein S18 [Absidia idahoensis var. thermophila]
Length=154

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -2

Query  600  MSLVANE--DFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            MSLV  E   FQHILR+LNTNVDGK KI  A+TS+KG+GRRFANI CKKAD+D+NKRAGE
Sbjct  1    MSLVVPERNQFQHILRLLNTNVDGKNKITIALTSVKGVGRRFANIACKKADVDLNKRAGE  60

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            L+  E++ ++T++ NP Q+K+P+WFLNRQKD  DG YSQ +SN LD KLR+DLERLKKIR
Sbjct  61   LSNEELERIVTILQNPAQYKIPNWFLNRQKDVVDGKYSQAISNGLDTKLREDLERLKKIR  120

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
             HRGLRHYWG+RVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  AHRGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK  154



>gb|KDR22651.1| 40S ribosomal protein S18 [Zootermopsis nevadensis]
Length=152

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  + FQHILR++ TN+DGK+K+MFAMT+IKG+GRR+ANI  KKADID++KRAGE T
Sbjct  1    MSLVIPDKFQHILRVMGTNIDGKRKVMFAMTAIKGVGRRYANIVLKKADIDLDKRAGECT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T+++NPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLERLKKIR H
Sbjct  61   DEEVEKIVTIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSYLDSKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RG+RHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_004410082.1| PREDICTED: 40S ribosomal protein S18-like [Odobenus rosmarus 
divergens]
Length=152

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGEL+
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|ACG27203.1| 40S ribosomal protein S18 [Zea mays]
 gb|AFW67379.1| 40S ribosomal protein S18 [Zea mays]
Length=126

 Score =   214 bits (544),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  522  MFAMTSIKGIGRRFANICCKKADIDMNKRAGELTAAEIDNLMTVVANPRQFKVPDWFLNR  343
            MFAMTSIKG+GRRF+NI CKKADIDMNKRAGELT  E++ LMTVVANPRQFKVPDWFLNR
Sbjct  1    MFAMTSIKGVGRRFSNIVCKKADIDMNKRAGELTPDELERLMTVVANPRQFKVPDWFLNR  60

Query  342  QKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHtkttgrrgktv  163
            +KDYKDG +SQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV
Sbjct  61   KKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV  120

Query  162  gVSKKR  145
            GVSKKR
Sbjct  121  GVSKKR  126



>ref|XP_005554553.1| PREDICTED: 40S ribosomal protein S18-like [Macaca fascicularis]
Length=170

 Score =   215 bits (548),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -2

Query  609  AIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            A  MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAG
Sbjct  16   AAAMSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAG  75

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            ELT  E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKI
Sbjct  76   ELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKI  135

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRH+WGLRVRGQH KTTGR G+TVGVSKK+
Sbjct  136  RAHRGLRHFWGLRVRGQHAKTTGRCGRTVGVSKKK  170



>ref|XP_003400826.1| PREDICTED: 40S ribosomal protein S18-like [Bombus terrestris]
 ref|XP_003493042.1| PREDICTED: 40S ribosomal protein S18-like [Bombus impatiens]
 ref|XP_003697517.1| PREDICTED: 40S ribosomal protein S18-like [Apis florea]
 ref|XP_003702861.1| PREDICTED: 40S ribosomal protein S18-like [Megachile rotundata]
 ref|XP_006611546.1| PREDICTED: 40S ribosomal protein S18-like [Apis dorsata]
Length=152

 Score =   215 bits (547),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR++ TN+DG +K+MFAMT+IKG+GRR+ANI  KKADID++KRAGE +
Sbjct  1    MSLVIPEKFQHILRVMGTNIDGNRKVMFAMTAIKGVGRRYANIVLKKADIDLDKRAGECS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ANPRQ+K+PDWFLNRQKD  DG YSQ+ S+ LD KLR+DLER+KKIR H
Sbjct  61   EEEVEKIVTIMANPRQYKIPDWFLNRQKDIVDGKYSQLTSSYLDSKLREDLERMKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>gb|EMD37436.1| hypothetical protein CERSUDRAFT_114091 [Ceriporiopsis subvermispora 
B]
Length=156

 Score =   215 bits (547),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 137/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+KIM+A+T IKG+GRR++NI CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKIMYALTEIKGVGRRYSNIVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL + E++ L+T++ NP QFK+P WFLNRQ+D  DG  SQ++SNA+D K+RDDLERLKKI
Sbjct  61   ELNSDELERLVTIIQNPTQFKIPTWFLNRQRDIVDGKNSQILSNAVDSKIRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRH+WGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>gb|KIY74232.1| ribosomal protein S13 [Cylindrobasidium torrendii FP15055 ss-10]
Length=155

 Score =   214 bits (546),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+KIM+A+T IKG+GRR++N+ CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKIMYALTEIKGVGRRYSNLVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            EL + E++ L+T++ NP QFK+P WFLNRQKD  DG + QV+SN +D KLRDDLERLKKI
Sbjct  61   ELNSDELERLVTIIQNPLQFKIPSWFLNRQKDIVDGKHGQVLSNGVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKK+
Sbjct  121  RAHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKK  155



>ref|XP_004639218.1| PREDICTED: 40S ribosomal protein S18-like [Octodon degus]
Length=152

 Score =   214 bits (546),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   EDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGL+VRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLQVRGQHTKTTGRRGRTVGVSKKK  152



>gb|AFK10867.1| ribosomal protein S18 [Callorhinchus milii]
Length=152

 Score =   214 bits (546),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGEL+
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELS  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   DDEVERIITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



>ref|XP_006998989.1| PREDICTED: 40S ribosomal protein S18-like [Peromyscus maniculatus 
bairdii]
Length=176

 Score =   215 bits (548),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  609  AIIMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            A  +SLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAG
Sbjct  22   AAAISLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAG  81

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            ELT  E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQ+++N LD KLR+DLERLKKI
Sbjct  82   ELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQILANGLDNKLREDLERLKKI  141

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRH+WGLRVRGQHTKTTGR+G+TVGVSKK+
Sbjct  142  RAHRGLRHFWGLRVRGQHTKTTGRQGRTVGVSKKK  176



>gb|ACO07574.1| 40S ribosomal protein S18 [Oncorhynchus mykiss]
Length=152

 Score =   214 bits (546),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGELT
Sbjct  1    MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR H
Sbjct  61   DDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAH  120

Query  240  RGLRHYWGLRVRGQH  196
            RGLRH+WGLRVRGQH
Sbjct  121  RGLRHFWGLRVRGQH  135



>gb|AGC74031.1| ribosomal protein S18 [Spirometra erinaceieuropaei]
Length=153

 Score =   214 bits (546),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  603  IMSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGEL  424
            + +L+  E FQHILR++NTN+DG++K+ FA+T+IKG+GRR+A + CKKADID+ KRAGEL
Sbjct  1    MATLMLPEKFQHILRVMNTNIDGQRKVSFAITAIKGVGRRYAVVVCKKADIDIRKRAGEL  60

Query  423  TAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRN  244
            T  E++ L+TV++NPRQ+K+PDWFLNRQKD +DG +SQ++S ALD KLR+DLERLKKIR 
Sbjct  61   TEDEVEKLVTVMSNPRQYKIPDWFLNRQKDVEDGKHSQLMSQALDTKLREDLERLKKIRA  120

Query  243  HRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            HRGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  HRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  153



>emb|CBN75754.1| conserved unknown protein [Ectocarpus siliculosus]
Length=192

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV + +FQHILRILNTN+DG++K+ +++TSI+G+GRRFAN+ CKKA++D NKRAGE+T
Sbjct  41   MSLVISPEFQHILRILNTNIDGRRKVQYSLTSIRGVGRRFANLICKKAEVDPNKRAGEMT  100

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
            A EI+ L+ ++ NPRQFK+PDWFLNRQKD+K G  +Q+ S  +D KLRDDLERLKKIR+H
Sbjct  101  ADEIEKLVAIIQNPRQFKIPDWFLNRQKDWKTGKTTQISSQTIDQKLRDDLERLKKIRSH  160

Query  240  RGLRHYWGLRVRGQH  196
            RG+RHYWG+RVRGQH
Sbjct  161  RGIRHYWGVRVRGQH  175



>ref|XP_001258494.1| 40S ribosomal protein S18 [Neosartorya fischeri NRRL 181]
 gb|EAW16597.1| ribosomal protein S13p/S18e [Neosartorya fischeri NRRL 181]
Length=155

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = -2

Query  600  MSLVANE--DFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            MSLV+ E  +FQ+ILR+LNTNVDGKQKIM+A+T IKG+GRR++N+ CKKAD+D++KRAGE
Sbjct  1    MSLVSGEKTNFQYILRLLNTNVDGKQKIMYALTQIKGVGRRYSNLVCKKADVDLSKRAGE  60

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            LT  E++ ++T++ NP Q+K+P WFLNRQ+D  DG  SQV+SN LD KLR+DLERLKKIR
Sbjct  61   LTTEELERIVTILQNPTQYKIPSWFLNRQRDIVDGKDSQVLSNGLDSKLREDLERLKKIR  120

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            +HRGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  SHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  154



>gb|KDR75450.1| hypothetical protein GALMADRAFT_70039 [Galerina marginata CBS 
339.88]
Length=156

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+KIM+A+T IKG+GRR++N+ CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKIMYALTEIKGVGRRYSNLVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            +L + E++ L+T++ NP QFK+P WFLNRQKD  DG  SQ++SN +D KLRDDLERLKKI
Sbjct  61   DLNSDELERLVTIIQNPTQFKIPTWFLNRQKDIVDGKNSQILSNGVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>ref|XP_001392986.1| 40S ribosomal protein S18 [Aspergillus niger CBS 513.88]
 emb|CAK96654.1| unnamed protein product [Aspergillus niger]
Length=155

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 138/154 (90%), Gaps = 2/154 (1%)
 Frame = -2

Query  600  MSLVANE--DFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            MSLV+ E  +FQ+ILR+LNTNVDGKQKIM+A+T IKG+GRR++N+ CKKAD+D++KRAGE
Sbjct  1    MSLVSGEKTNFQYILRLLNTNVDGKQKIMYALTQIKGVGRRYSNLVCKKADVDLSKRAGE  60

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            LT  E++ ++T++ +P Q+K+P WFLNRQ+D  DG  SQVVSN+LD K+R+DLERLKKIR
Sbjct  61   LTTEELERIVTILQSPTQYKIPTWFLNRQRDITDGKDSQVVSNSLDSKIREDLERLKKIR  120

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            +HRGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  SHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  154



>ref|XP_011371747.1| PREDICTED: 40S ribosomal protein S18 isoform X1 [Pteropus vampyrus]
Length=170

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  597  SLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELTA  418
            SLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID+ KRAGELT 
Sbjct  20   SLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTE  79

Query  417  AEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNHR  238
             E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLKKIR HR
Sbjct  80   DEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHR  139

Query  237  GLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            GLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  140  GLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  170



>ref|XP_001268409.1| 40S ribosomal protein S18 [Aspergillus clavatus NRRL 1]
 gb|EAW06983.1| ribosomal protein S13p/S18e [Aspergillus clavatus NRRL 1]
Length=155

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = -2

Query  600  MSLVANE--DFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGE  427
            MSLV+ E  +FQ+ILR+LNTNVDGKQKIM+A+T IKG+GRR++N+ CKKAD+D++KRAGE
Sbjct  1    MSLVSGEKTNFQYILRLLNTNVDGKQKIMYALTQIKGVGRRYSNLVCKKADVDLSKRAGE  60

Query  426  LTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIR  247
            LT  E++ ++T++ NP Q+K+P WFLNRQ+D  DG  SQV+SN LD KLR+DLERLKKIR
Sbjct  61   LTTEELERIVTILQNPTQYKIPTWFLNRQRDIVDGKDSQVLSNGLDSKLREDLERLKKIR  120

Query  246  NHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            +HRGLRHYWGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  SHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK  154



>gb|KJA29077.1| hypothetical protein HYPSUDRAFT_33600 [Hypholoma sublateritium 
FD-334 SS-4]
Length=156

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -2

Query  600  MSLV---ANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAG  430
            MSLV   A++ FQHILR+LNTNVDGK+KIM+A+T IKG+GRR++N+ CKKAD+D+NKRAG
Sbjct  1    MSLVVPEAHQQFQHILRLLNTNVDGKRKIMYALTEIKGVGRRYSNLVCKKADVDLNKRAG  60

Query  429  ELTAAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKI  250
            +L + E++ L+T++ NP QFK+P WFLNRQKD  DG  SQ++SN +D KLRDDLERLKKI
Sbjct  61   DLNSDELERLVTIIQNPTQFKIPTWFLNRQKDIVDGKNSQILSNGVDSKLRDDLERLKKI  120

Query  249  RNHRGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            R HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
Sbjct  121  RAHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR  155



>gb|ACO08134.1| 40S ribosomal protein S18 [Oncorhynchus mykiss]
Length=152

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  600  MSLVANEDFQHILRILNTNVDGKQKIMFAMTSIKGIGRRFANICCKKADIDMNKRAGELT  421
            MSLV  E FQHILR+LNTN+DG++KI FA+T+IKG+GRR+A++  +KADID++KRAGELT
Sbjct  1    MSLVILEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELT  60

Query  420  AAEIDNLMTVVANPRQFKVPDWFLNRQKDYKDGNYSQVVSNALDMKLRDDLERLKKIRNH  241
              E++ ++T++ NPRQ+K+PDWFLNRQKD KDG YSQV++N LD KLR+DLERLK+IR H
Sbjct  61   DDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKRIRAH  120

Query  240  RGLRHYWGLRVRGQHtkttgrrgktvgVSKKR  145
            RGLRH+WGLRVRGQHTKTTGRRG+TVGVSKK+
Sbjct  121  RGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420