BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF004A03

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803816.1|  PREDICTED: protease Do-like 10, mitochondrial      359   4e-117   Nicotiana sylvestris
ref|XP_009611385.1|  PREDICTED: protease Do-like 10, mitochondrial      358   2e-116   Nicotiana tomentosiformis
gb|EYU39504.1|  hypothetical protein MIMGU_mgv1a003194mg                356   1e-115   Erythranthe guttata [common monkey flower]
ref|XP_011077091.1|  PREDICTED: protease Do-like 10, mitochondrial      352   2e-114   Sesamum indicum [beniseed]
ref|XP_006353238.1|  PREDICTED: protease Do-like 10, mitochondria...    352   5e-114   Solanum tuberosum [potatoes]
emb|CDP04134.1|  unnamed protein product                                350   2e-113   Coffea canephora [robusta coffee]
ref|XP_002265825.2|  PREDICTED: protease Do-like 10, mitochondrial      348   7e-113   Vitis vinifera
ref|XP_010277816.1|  PREDICTED: protease Do-like 10, mitochondrial      346   3e-112   Nelumbo nucifera [Indian lotus]
ref|XP_004250091.1|  PREDICTED: protease Do-like 10, mitochondrial      345   3e-111   Solanum lycopersicum
ref|XP_008776774.1|  PREDICTED: protease Do-like 10, mitochondria...    343   4e-111   Phoenix dactylifera
ref|XP_010927886.1|  PREDICTED: protease Do-like 10, mitochondrial      338   3e-109   Elaeis guineensis
gb|EPS59937.1|  hypothetical protein M569_14869                         325   4e-109   Genlisea aurea
ref|XP_010528621.1|  PREDICTED: protease Do-like 10, mitochondrial      338   5e-109   Tarenaya hassleriana [spider flower]
gb|ACF84354.1|  unknown                                                 333   7e-109   Zea mays [maize]
ref|XP_008224670.1|  PREDICTED: protease Do-like 10, mitochondrial      338   7e-109   Prunus mume [ume]
ref|XP_006468667.1|  PREDICTED: protease Do-like 10, mitochondria...    338   1e-108   Citrus sinensis [apfelsine]
ref|XP_004155122.1|  PREDICTED: protease Do-like 10, mitochondria...    337   2e-108   
gb|KJB49014.1|  hypothetical protein B456_008G097600                    330   2e-108   Gossypium raimondii
ref|XP_004152886.1|  PREDICTED: protease Do-like 10, mitochondria...    337   4e-108   Cucumis sativus [cucumbers]
ref|XP_002441105.1|  hypothetical protein SORBIDRAFT_09g020480          336   4e-108   Sorghum bicolor [broomcorn]
ref|XP_007211387.1|  hypothetical protein PRUPE_ppa003181mg             335   1e-107   Prunus persica
ref|XP_011011698.1|  PREDICTED: protease Do-like 10, mitochondrial      335   1e-107   Populus euphratica
ref|XP_006448510.1|  hypothetical protein CICLE_v10014700mg             335   1e-107   Citrus clementina [clementine]
ref|XP_009420477.1|  PREDICTED: protease Do-like 10, mitochondrial      334   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004293434.2|  PREDICTED: protease Do-like 10, mitochondrial      334   2e-107   Fragaria vesca subsp. vesca
ref|XP_008647597.1|  PREDICTED: hypothetical protein isoform X1         334   2e-107   Zea mays [maize]
ref|XP_008377055.1|  PREDICTED: protease Do-like 10, mitochondrial      333   3e-107   
ref|XP_007028414.1|  DegP protease 10 isoform 1                         334   3e-107   
ref|XP_002463281.1|  hypothetical protein SORBIDRAFT_02g041140          333   6e-107   Sorghum bicolor [broomcorn]
ref|XP_004962074.1|  PREDICTED: protease Do-like 10, mitochondria...    332   1e-106   Setaria italica
gb|KDP32493.1|  hypothetical protein JCGZ_13418                         331   2e-106   Jatropha curcas
gb|KJB49013.1|  hypothetical protein B456_008G097600                    330   2e-106   Gossypium raimondii
ref|XP_010110145.1|  Protease Do-like 10                                330   3e-106   Morus notabilis
gb|KJB49010.1|  hypothetical protein B456_008G097600                    330   4e-106   Gossypium raimondii
ref|XP_002514764.1|  serine endopeptidase degp2, putative               329   4e-106   
gb|EMS52153.1|  Protease Do-like 10, mitochondrial                      330   5e-106   Triticum urartu
ref|XP_006655329.1|  PREDICTED: protease Do-like 10, mitochondria...    326   1e-105   
ref|XP_002311275.1|  hypothetical protein POPTR_0008s07940g             329   3e-105   
ref|XP_010027457.1|  PREDICTED: protease Do-like 10, mitochondrial      328   3e-105   Eucalyptus grandis [rose gum]
gb|EEE63742.1|  hypothetical protein OsJ_18561                          326   2e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98063.1|  hypothetical protein OsI_19981                          327   2e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_003568444.1|  PREDICTED: protease Do-like 10, mitochondrial      326   4e-104   Brachypodium distachyon [annual false brome]
ref|NP_001055560.1|  Os05g0417100                                       325   1e-103   
gb|KHG11681.1|  hypothetical protein F383_13103                         323   1e-103   Gossypium arboreum [tree cotton]
ref|XP_006858733.1|  hypothetical protein AMTR_s00066p00121670          324   1e-103   
ref|XP_002868484.1|  DEGP10                                             323   4e-103   
gb|KEH24729.1|  DegP protease                                           317   1e-102   Medicago truncatula
ref|XP_007150859.1|  hypothetical protein PHAVU_004G000300g             319   6e-102   Phaseolus vulgaris [French bean]
gb|KHN40897.1|  Protease Do-like 10, mitochondrial                      315   8e-102   Glycine soja [wild soybean]
ref|NP_568543.1|  protease Do-like 10                                   320   9e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KEH24728.1|  DegP protease                                           318   2e-101   Medicago truncatula
ref|XP_003534464.1|  PREDICTED: protease Do-like 10, mitochondria...    315   7e-101   Glycine max [soybeans]
ref|XP_010435521.1|  PREDICTED: protease Do-like 10, mitochondrial      317   9e-101   Camelina sativa [gold-of-pleasure]
ref|XP_004489189.1|  PREDICTED: protease Do-like 10, mitochondria...    316   1e-100   Cicer arietinum [garbanzo]
ref|XP_010673840.1|  PREDICTED: protease Do-like 10, mitochondrial      317   2e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010440805.1|  PREDICTED: protease Do-like 10, mitochondria...    316   2e-100   
ref|XP_010450457.1|  PREDICTED: protease Do-like 10, mitochondrial      316   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010440803.1|  PREDICTED: protease Do-like 10, mitochondria...    316   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006283411.1|  hypothetical protein CARUB_v10004459mg             315   4e-100   Capsella rubella
ref|XP_006405960.1|  hypothetical protein EUTSA_v10027701mg             313   2e-99    Eutrema salsugineum [saltwater cress]
ref|XP_009139697.1|  PREDICTED: protease Do-like 10, mitochondrial      309   8e-98    Brassica rapa
emb|CDY53528.1|  BnaCnng25320D                                          309   9e-98    Brassica napus [oilseed rape]
emb|CDX74606.1|  BnaA04g07830D                                          308   3e-97    
ref|XP_006858734.1|  hypothetical protein AMTR_s00066p00122890          298   4e-94    Amborella trichopoda
ref|XP_002963416.1|  hypothetical protein SELMODRAFT_62730              281   5e-88    
ref|XP_002971553.1|  hypothetical protein SELMODRAFT_62447              279   2e-87    
ref|XP_010027524.1|  PREDICTED: protease Do-like 10, mitochondrial      265   3e-81    Eucalyptus grandis [rose gum]
ref|NP_001142088.1|  hypothetical protein                               263   2e-80    Zea mays [maize]
ref|XP_008441958.1|  PREDICTED: protease Do-like 10, mitochondrial      247   8e-74    
ref|XP_007028415.1|  DegP protease 10 isoform 2                         244   3e-73    
gb|KJB49011.1|  hypothetical protein B456_008G097600                    242   5e-73    Gossypium raimondii
ref|XP_002951860.1|  trypsin family                                     239   8e-71    Volvox carteri f. nagariensis
gb|KCW54069.1|  hypothetical protein EUGRSUZ_I00050                     236   2e-70    Eucalyptus grandis [rose gum]
ref|XP_010027526.1|  PREDICTED: protease Do-like 10, mitochondria...    236   3e-70    Eucalyptus grandis [rose gum]
ref|XP_010027525.1|  PREDICTED: protease Do-like 10, mitochondria...    232   2e-68    Eucalyptus grandis [rose gum]
gb|KIZ03685.1|  hypothetical protein MNEG_4270                          224   2e-67    Monoraphidium neglectum
ref|XP_002888435.1|  predicted protein                                  226   3e-66    
ref|XP_010027559.1|  PREDICTED: protease Do-like 10, mitochondrial      222   6e-65    Eucalyptus grandis [rose gum]
ref|XP_010030295.1|  PREDICTED: uncharacterized protein LOC104420090    226   1e-64    
ref|XP_002499997.1|  predicted protein                                  216   4e-63    Micromonas commoda
ref|XP_002886956.1|  hypothetical protein ARALYDRAFT_315601             216   1e-62    Arabidopsis lyrata subsp. lyrata
gb|KCW54108.1|  hypothetical protein EUGRSUZ_I00089                     205   3e-62    Eucalyptus grandis [rose gum]
ref|XP_007028416.1|  DegP protease 10 isoform 3                         214   5e-62    
ref|XP_002886957.1|  hypothetical protein ARALYDRAFT_894151             213   1e-61    Arabidopsis lyrata subsp. lyrata
ref|XP_004344572.1|  DegPtype protease                                  213   3e-61    Acanthamoeba castellanii str. Neff
ref|NP_564856.1|  putativeDegP protease 3                               213   3e-61    Arabidopsis thaliana [mouse-ear cress]
gb|KFK41004.1|  hypothetical protein AALP_AA2G073000                    209   1e-60    Arabis alpina [alpine rockcress]
ref|XP_008776775.1|  PREDICTED: protease Do-like 10, mitochondria...    208   6e-60    
gb|KDO77071.1|  hypothetical protein CISIN_1g007765mg                   207   1e-59    Citrus sinensis [apfelsine]
ref|XP_010513422.1|  PREDICTED: putative protease Do-like 3, mito...    205   2e-58    Camelina sativa [gold-of-pleasure]
ref|XP_009140719.1|  PREDICTED: putative protease Do-like 3, mito...    206   7e-58    Brassica rapa
ref|XP_010511113.1|  PREDICTED: putative protease Do-like 3, mito...    203   2e-57    Camelina sativa [gold-of-pleasure]
ref|XP_006391530.1|  hypothetical protein EUTSA_v10019569mg             196   3e-57    
sp|Q9SHZ0.1|DEGP4_ARATH  RecName: Full=Protease Do-like 4, mitoch...    200   1e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888434.1|  predicted protein                                  199   3e-56    
ref|XP_006391532.1|  hypothetical protein EUTSA_v10019834mg             197   5e-55    
ref|XP_006301507.1|  hypothetical protein CARUB_v10021933mg             196   1e-54    Capsella rubella
ref|XP_003055699.1|  predicted protein                                  191   1e-53    Micromonas pusilla CCMP1545
ref|XP_010418975.1|  PREDICTED: putative protease Do-like 3, mito...    191   8e-53    Camelina sativa [gold-of-pleasure]
emb|CDY35320.1|  BnaA04g15270D                                          187   1e-51    Brassica napus [oilseed rape]
ref|XP_002866059.1|  predicted protein                                  186   4e-51    
ref|XP_006391531.1|  hypothetical protein EUTSA_v10019570mg             182   3e-50    
gb|KCW54067.1|  hypothetical protein EUGRSUZ_I00047                     181   8e-50    Eucalyptus grandis [rose gum]
gb|KCW54110.1|  hypothetical protein EUGRSUZ_I000922                    171   2e-49    Eucalyptus grandis [rose gum]
emb|CDY07457.1|  BnaA07g25360D                                          180   3e-49    Brassica napus [oilseed rape]
ref|XP_009105158.1|  PREDICTED: putative protease Do-like 3, mito...    179   3e-49    Brassica rapa
emb|CDY39277.1|  BnaC06g27140D                                          176   3e-48    Brassica napus [oilseed rape]
gb|KDO66274.1|  hypothetical protein CISIN_1g036586mg                   176   3e-47    Citrus sinensis [apfelsine]
emb|CDP16995.1|  unnamed protein product                                176   3e-47    Coffea canephora [robusta coffee]
ref|XP_002866058.1|  hypothetical protein ARALYDRAFT_357728             175   3e-47    
ref|XP_006446449.1|  hypothetical protein CICLE_v10014711mg             176   3e-47    Citrus clementina [clementine]
ref|XP_006470390.1|  PREDICTED: protease Do-like 9-like                 175   8e-47    Citrus sinensis [apfelsine]
ref|XP_011071819.1|  PREDICTED: protease Do-like 9 isoform X2           172   2e-46    Sesamum indicum [beniseed]
gb|EYU42545.1|  hypothetical protein MIMGU_mgv1a0052332mg               169   4e-46    Erythranthe guttata [common monkey flower]
ref|XP_011044336.1|  PREDICTED: protease Do-like 9                      171   2e-45    Populus euphratica
ref|XP_003608950.1|  hypothetical protein MTR_4g106730                  171   2e-45    Medicago truncatula
ref|XP_011015595.1|  PREDICTED: protease Do-like 9                      169   5e-45    Populus euphratica
ref|XP_006376843.1|  hypothetical protein POPTR_0012s07930g             169   6e-45    
gb|KJB40784.1|  hypothetical protein B456_007G077100                    169   8e-45    Gossypium raimondii
gb|KDP31134.1|  hypothetical protein JCGZ_11510                         169   1e-44    Jatropha curcas
ref|XP_011071818.1|  PREDICTED: protease Do-like 9 isoform X1           171   1e-44    
ref|XP_010928580.1|  PREDICTED: protease Do-like 9                      168   2e-44    Elaeis guineensis
ref|XP_009379979.1|  PREDICTED: protease Do-like 9                      168   2e-44    Musa acuminata subsp. malaccensis [pisang utan]
sp|Q9LK70.1|DGP12_ARATH  RecName: Full=Putative protease Do-like ...    167   3e-44    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566552.1|  DEGP protease 12                                      166   3e-44    
ref|XP_002321577.2|  hypothetical protein POPTR_0015s08440g             166   5e-44    Populus trichocarpa [western balsam poplar]
ref|XP_011087156.1|  PREDICTED: protease Do-like 9                      166   6e-44    Sesamum indicum [beniseed]
ref|NP_568583.1|  DegP protease 13                                      164   8e-44    
ref|XP_006339987.1|  PREDICTED: protease Do-like 9-like                 166   9e-44    Solanum tuberosum [potatoes]
ref|XP_009794183.1|  PREDICTED: protease Do-like 9                      166   1e-43    Nicotiana sylvestris
sp|Q9FM41.1|DGP13_ARATH  RecName: Full=Putative protease Do-like 13     164   2e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456846.1|  PREDICTED: putative protease Do-like 11, mit...    165   3e-43    
ref|XP_010446115.1|  PREDICTED: putative protease Do-like 3, mito...    164   3e-43    Camelina sativa [gold-of-pleasure]
ref|XP_009609751.1|  PREDICTED: protease Do-like 9                      164   3e-43    Nicotiana tomentosiformis
ref|XP_010254385.1|  PREDICTED: protease Do-like 9                      164   4e-43    Nelumbo nucifera [Indian lotus]
sp|Q9LK71.2|DGP11_ARATH  RecName: Full=Putative protease Do-like ...    163   9e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678720.1|  PREDICTED: protease Do-like 9                      163   1e-42    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010424503.1|  PREDICTED: putative protease Do-like 11, mit...    163   1e-42    
ref|XP_007514393.1|  predicted protein                                  162   2e-42    Bathycoccus prasinos
ref|XP_011402326.1|  Protease Do-like 9                                 162   2e-42    Auxenochlorella protothecoides
dbj|GAM25013.1|  hypothetical protein SAMD00019534_081880               161   3e-42    Acytostelium subglobosum LB1
ref|XP_002968921.1|  hypothetical protein SELMODRAFT_90340              160   6e-42    
ref|XP_004252189.1|  PREDICTED: protease Do-like 9                      160   1e-41    Solanum lycopersicum
ref|XP_006289059.1|  hypothetical protein CARUB_v10002456mg             156   1e-41    
ref|XP_006655949.1|  PREDICTED: protease Do-like 9-like                 159   1e-41    Oryza brachyantha
ref|NP_001057235.1|  Os06g0234100                                       160   1e-41    
ref|NP_566551.1|  DegP protease 11                                      160   1e-41    
ref|XP_002989968.1|  hypothetical protein SELMODRAFT_130891             159   2e-41    
gb|KHN48612.1|  Protease Do-like 9                                      157   2e-41    Glycine soja [wild soybean]
ref|XP_010111735.1|  Protease Do-like 9                                 159   2e-41    Morus notabilis
gb|KCW49312.1|  hypothetical protein EUGRSUZ_K02868                     158   2e-41    Eucalyptus grandis [rose gum]
ref|XP_006282154.1|  hypothetical protein CARUB_v10028411mg             159   2e-41    
ref|XP_010436835.1|  PREDICTED: LOW QUALITY PROTEIN: putative pro...    159   2e-41    
dbj|BAB01153.1|  unnamed protein product                                158   5e-41    Arabidopsis thaliana [mouse-ear cress]
gb|KIZ00510.1|  hypothetical protein MNEG_7454                          159   5e-41    Monoraphidium neglectum
ref|XP_010037587.1|  PREDICTED: protease Do-like 9                      158   6e-41    Eucalyptus grandis [rose gum]
gb|KHN18478.1|  Protease Do-like 9                                      157   8e-41    Glycine soja [wild soybean]
ref|XP_008239730.1|  PREDICTED: protease Do-like 9                      157   1e-40    Prunus mume [ume]
gb|KHF97497.1|  Protease Do-like 9                                      151   1e-40    Gossypium arboreum [tree cotton]
gb|EMS45662.1|  Protease Do-like 9                                      156   2e-40    Triticum urartu
ref|XP_004152460.1|  PREDICTED: protease Do-like 9-like                 157   2e-40    Cucumis sativus [cucumbers]
ref|XP_008438126.1|  PREDICTED: protease Do-like 9                      157   2e-40    Cucumis melo [Oriental melon]
ref|XP_003525265.1|  PREDICTED: protease Do-like 9-like                 156   3e-40    Glycine max [soybeans]
dbj|BAJ90442.1|  predicted protein                                      156   3e-40    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003550747.1|  PREDICTED: protease Do-like 9-like                 156   4e-40    Glycine max [soybeans]
gb|EFA82977.1|  hypothetical protein PPL_03755                          155   4e-40    Heterostelium album PN500
ref|XP_008659079.1|  PREDICTED: protease Do-like 9                      150   5e-40    Zea mays [maize]
ref|XP_004508846.1|  PREDICTED: protease Do-like 9-like                 155   6e-40    Cicer arietinum [garbanzo]
ref|XP_010678716.1|  PREDICTED: protease Do-like 9 isoform X1           154   7e-40    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001753311.1|  predicted protein                                  157   8e-40    
ref|XP_005704064.1|  serine-type endopeptidase isoform 1                155   1e-39    Galdieria sulphuraria
ref|XP_005704063.1|  serine-type endopeptidase isoform 2                155   1e-39    Galdieria sulphuraria
ref|XP_010029214.1|  PREDICTED: protease Do-like 9                      155   1e-39    Eucalyptus grandis [rose gum]
gb|EYU29924.1|  hypothetical protein MIMGU_mgv1a005009mg                154   1e-39    Erythranthe guttata [common monkey flower]
ref|XP_007036141.1|  Protease Do-like 9 isoform 1                       154   1e-39    Theobroma cacao [chocolate]
ref|XP_007155398.1|  hypothetical protein PHAVU_003G198000g             154   1e-39    Phaseolus vulgaris [French bean]
ref|XP_010424502.1|  PREDICTED: putative protease Do-like 12, mit...    153   2e-39    
ref|XP_001633828.1|  predicted protein                                  153   3e-39    Nematostella vectensis
ref|XP_010272002.1|  PREDICTED: protease Do-like 9                      153   3e-39    Nelumbo nucifera [Indian lotus]
emb|CDY46469.1|  BnaA08g06390D                                          153   3e-39    Brassica napus [oilseed rape]
ref|XP_009107927.1|  PREDICTED: putative protease Do-like 12, mit...    152   4e-39    Brassica rapa
ref|XP_003564034.1|  PREDICTED: protease Do-like 9                      153   4e-39    Brachypodium distachyon [annual false brome]
ref|XP_004965071.1|  PREDICTED: protease Do-like 9-like                 153   4e-39    Setaria italica
gb|KFG58629.1|  trypsin domain-containing protein                       147   4e-39    Toxoplasma gondii RUB
ref|NP_568577.1|  DegP protease 9                                       153   5e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913540.1|  PREDICTED: protease Do-like 9 isoform X2           150   6e-39    
ref|XP_002885148.1|  hypothetical protein ARALYDRAFT_479117             152   6e-39    
ref|XP_002981859.1|  hypothetical protein SELMODRAFT_154815             151   7e-39    
gb|EEE57793.1|  hypothetical protein OsJ_08344                          151   7e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002982828.1|  hypothetical protein SELMODRAFT_116969             151   8e-39    
gb|KDP45394.1|  hypothetical protein JCGZ_09643                         152   9e-39    Jatropha curcas
ref|XP_010678718.1|  PREDICTED: protease Do-like 9 isoform X2           151   9e-39    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001774430.1|  predicted protein                                  151   1e-38    
ref|XP_006836679.1|  hypothetical protein AMTR_s00088p00077590          152   1e-38    Amborella trichopoda
ref|XP_010227815.1|  PREDICTED: protease Do-like 9                      151   1e-38    Brachypodium distachyon [annual false brome]
ref|XP_007217173.1|  hypothetical protein PRUPE_ppa003383mg             151   2e-38    Prunus persica
ref|XP_002502087.1|  predicted protein                                  150   2e-38    Micromonas commoda
ref|XP_006281902.1|  hypothetical protein CARUB_v10028106mg             150   2e-38    
ref|XP_010254399.1|  PREDICTED: protease Do-like 9 isoform X1           151   2e-38    Nelumbo nucifera [Indian lotus]
ref|XP_006283387.1|  hypothetical protein CARUB_v10004432mg             151   2e-38    Capsella rubella
ref|XP_010450719.1|  PREDICTED: protease Do-like 9                      150   3e-38    Camelina sativa [gold-of-pleasure]
dbj|BAD15737.1|  putative DegP2 protease                                150   3e-38    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008647464.1|  PREDICTED: uncharacterized protein LOC100217...    150   4e-38    
emb|CDX99642.1|  BnaC04g33990D                                          150   4e-38    
gb|EAY87490.1|  hypothetical protein OsI_08898                          150   4e-38    Oryza sativa Indica Group [Indian rice]
gb|AFW76813.1|  hypothetical protein ZEAMMB73_778886                    150   4e-38    
ref|XP_010913539.1|  PREDICTED: protease Do-like 9 isoform X1           150   4e-38    Elaeis guineensis
ref|XP_002511438.1|  serine endopeptidase degp2, putative               150   4e-38    Ricinus communis
ref|XP_006476740.1|  PREDICTED: protease Do-like 9-like isoform X2      149   5e-38    Citrus sinensis [apfelsine]
ref|XP_008230646.1|  PREDICTED: protease Do-like 9                      150   5e-38    Prunus mume [ume]
ref|XP_009348028.1|  PREDICTED: protease Do-like 9                      150   5e-38    
ref|XP_006649039.1|  PREDICTED: protease Do-like 9-like                 149   5e-38    
gb|EMS48865.1|  Protease Do-like 9                                      148   6e-38    Triticum urartu
ref|XP_008793849.1|  PREDICTED: protease Do-like 9                      150   6e-38    Phoenix dactylifera
ref|XP_004252664.1|  PREDICTED: protease Do-like 9                      149   7e-38    Solanum lycopersicum
ref|XP_004953885.1|  PREDICTED: protease Do-like 9-like                 149   1e-37    Setaria italica
ref|XP_009349862.1|  PREDICTED: protease Do-like 9                      149   1e-37    Pyrus x bretschneideri [bai li]
ref|XP_008341479.1|  PREDICTED: protease Do-like 9                      149   1e-37    Malus domestica [apple tree]
ref|XP_003288812.1|  hypothetical protein DICPUDRAFT_153086             149   2e-37    Dictyostelium purpureum
ref|XP_010528270.1|  PREDICTED: protease Do-like 9                      148   2e-37    Tarenaya hassleriana [spider flower]
ref|XP_005831529.1|  hypothetical protein GUITHDRAFT_72154              146   2e-37    Guillardia theta CCMP2712
ref|XP_011028602.1|  PREDICTED: protease Do-like 9                      148   2e-37    Populus euphratica
ref|XP_009139975.1|  PREDICTED: protease Do-like 9                      148   2e-37    Brassica rapa
ref|XP_011399889.1|  Protease Do-like 9                                 147   2e-37    Auxenochlorella protothecoides
ref|XP_002452567.1|  hypothetical protein SORBIDRAFT_04g028270          148   2e-37    Sorghum bicolor [broomcorn]
emb|CDY44585.1|  BnaA04g10050D                                          148   2e-37    Brassica napus [oilseed rape]
gb|KFK33145.1|  hypothetical protein AALP_AA6G336800                    148   2e-37    Arabis alpina [alpine rockcress]
emb|CDY53116.1|  BnaCnng24440D                                          148   3e-37    Brassica napus [oilseed rape]
emb|CDX91770.1|  BnaC08g06890D                                          143   3e-37    
ref|XP_002868670.1|  hypothetical protein ARALYDRAFT_493972             147   3e-37    
ref|XP_006476739.1|  PREDICTED: protease Do-like 9-like isoform X1      147   3e-37    Citrus sinensis [apfelsine]
gb|EMT18472.1|  Protease Do-like protein 9                              147   3e-37    
ref|XP_010233342.1|  PREDICTED: protease Do-like 2, chloroplastic       147   3e-37    
ref|XP_007140930.1|  hypothetical protein PHAVU_008G153200g             147   4e-37    Phaseolus vulgaris [French bean]
ref|XP_004298924.1|  PREDICTED: protease Do-like 9                      147   4e-37    Fragaria vesca subsp. vesca
ref|XP_006405537.1|  hypothetical protein EUTSA_v10027697mg             147   6e-37    Eutrema salsugineum [saltwater cress]
ref|XP_004357429.1|  hypothetical protein DFA_02707                     147   6e-37    Cavenderia fasciculata
ref|XP_002885149.1|  DEGP12                                             146   6e-37    
ref|XP_009609244.1|  PREDICTED: protease Do-like 9                      147   6e-37    Nicotiana tomentosiformis
ref|XP_008780936.1|  PREDICTED: protease Do-like 9                      147   7e-37    Phoenix dactylifera
ref|XP_010678715.1|  PREDICTED: protease Do-like 9                      146   7e-37    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004306333.2|  PREDICTED: protease Do-like 9                      146   7e-37    Fragaria vesca subsp. vesca
ref|XP_006363999.1|  PREDICTED: protease Do-like 9-like                 147   7e-37    Solanum tuberosum [potatoes]
emb|CDY15934.1|  BnaA04g11770D                                          146   9e-37    Brassica napus [oilseed rape]
emb|CBI15070.3|  unnamed protein product                                145   9e-37    Vitis vinifera
ref|XP_004960292.1|  PREDICTED: protease Do-like 2, chloroplastic...    146   1e-36    Setaria italica
dbj|BAK07966.1|  predicted protein                                      146   1e-36    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009140230.1|  PREDICTED: protease Do-like 9                      146   1e-36    Brassica rapa
ref|XP_007031392.1|  Protease Do-like 9 isoform 1                       145   1e-36    
ref|XP_002517376.1|  serine endopeptidase degp2, putative               145   2e-36    Ricinus communis
ref|XP_002370490.1|  trypsin, putative                                  147   2e-36    
gb|KFH09397.1|  trypsin domain-containing protein                       147   2e-36    Toxoplasma gondii VAND
gb|EPT25374.1|  trypsin domain-containing protein                       147   2e-36    Toxoplasma gondii ME49
ref|XP_008341480.1|  PREDICTED: protease Do-like 9                      145   2e-36    
emb|CAN74170.1|  hypothetical protein VITISV_013882                     145   2e-36    Vitis vinifera
ref|XP_002280249.1|  PREDICTED: protease Do-like 9                      145   2e-36    Vitis vinifera
gb|ESS28089.1|  trypsin domain-containing protein                       146   2e-36    Toxoplasma gondii VEG
ref|XP_009348035.1|  PREDICTED: protease Do-like 9                      144   3e-36    Pyrus x bretschneideri [bai li]
ref|XP_008643959.1|  PREDICTED: uncharacterized protein LOC100381...    145   3e-36    
gb|KJB40785.1|  hypothetical protein B456_007G077100                    145   3e-36    Gossypium raimondii
gb|KJB40786.1|  hypothetical protein B456_007G077100                    145   3e-36    Gossypium raimondii
emb|CBI34956.3|  unnamed protein product                                144   3e-36    Vitis vinifera
ref|XP_008887060.1|  trypsin domain-containing protein                  146   3e-36    
gb|AFW57620.1|  hypothetical protein ZEAMMB73_444319                    144   4e-36    
ref|XP_002439270.1|  hypothetical protein SORBIDRAFT_09g003540          144   4e-36    Sorghum bicolor [broomcorn]
gb|KJB08193.1|  hypothetical protein B456_001G070400                    144   5e-36    Gossypium raimondii
ref|XP_010272003.1|  PREDICTED: protease Do-like 9                      144   6e-36    Nelumbo nucifera [Indian lotus]
ref|XP_640805.1|  hypothetical protein DDB_G0281081                     144   9e-36    Dictyostelium discoideum AX4
gb|EPR63244.1|  trypsin domain-containing protein                       145   1e-35    Toxoplasma gondii GT1
ref|NP_001146551.1|  hypothetical protein                               143   1e-35    Zea mays [maize]
ref|XP_010111534.1|  Protease Do-like 9                                 142   2e-35    Morus notabilis
emb|CDP02143.1|  unnamed protein product                                137   2e-35    Coffea canephora [robusta coffee]
ref|XP_002275131.1|  PREDICTED: protease Do-like 9                      142   2e-35    Vitis vinifera
emb|CAN62736.1|  hypothetical protein VITISV_027750                     142   2e-35    Vitis vinifera
gb|EMS54752.1|  Protease Do-like 2, chloroplastic                       142   3e-35    Triticum urartu
ref|XP_002946355.1|  trypsin family                                     142   3e-35    Volvox carteri f. nagariensis
ref|XP_006855396.1|  hypothetical protein AMTR_s00057p00143260          141   4e-35    
ref|XP_009349861.1|  PREDICTED: protease Do-like 9                      141   5e-35    Pyrus x bretschneideri [bai li]
ref|XP_005649879.1|  trypsin-like serine protease                       141   5e-35    Coccomyxa subellipsoidea C-169
ref|XP_003886416.1|  hypothetical protein NCLIV_068150                  142   6e-35    
ref|XP_010236127.1|  PREDICTED: protease Do-like 9 isoform X2           140   7e-35    
gb|EMT00922.1|  Protease Do-like 2, chloroplastic                       141   7e-35    
ref|XP_005850048.1|  hypothetical protein CHLNCDRAFT_34342              141   8e-35    
ref|XP_010554015.1|  PREDICTED: protease Do-like 9                      141   9e-35    
ref|XP_010236126.1|  PREDICTED: protease Do-like 9 isoform X1           140   9e-35    
ref|XP_006654043.1|  PREDICTED: protease Do-like 2, chloroplastic...    140   1e-34    
dbj|BAJ90870.1|  predicted protein                                      140   1e-34    
ref|XP_003516811.1|  PREDICTED: protease Do-like 9-like                 140   1e-34    
gb|AAT93972.1|  putative DegP2 protease                                 140   1e-34    
ref|XP_007144564.1|  hypothetical protein PHAVU_007G1665001g            138   1e-34    
emb|CDJ68975.1|  trypsin, putative                                      139   3e-34    
ref|XP_007144565.1|  hypothetical protein PHAVU_007G1665001g            137   3e-34    
ref|XP_005644766.1|  trypsin-like serine protease                       138   3e-34    
emb|CDJ40717.1|  trypsin, putative                                      139   4e-34    
gb|AET50594.1|  hypothetical protein                                    139   4e-34    
ref|WP_029716855.1|  hypothetical protein                               135   6e-34    
ref|XP_007216372.1|  hypothetical protein PRUPE_ppa021785mg             137   9e-34    
ref|XP_010437094.1|  PREDICTED: putative protease Do-like 11, mit...    137   2e-33    
ref|XP_007031393.1|  Protease Do-like 9 isoform 2                       137   2e-33    
ref|WP_035698046.1|  hypothetical protein                               135   2e-33    
ref|XP_008230647.1|  PREDICTED: protease Do-like 9                      136   3e-33    
gb|EYU46653.1|  hypothetical protein MIMGU_mgv1a0034321mg               132   3e-33    
ref|XP_004148888.1|  PREDICTED: protease Do-like 2, chloroplastic...    136   4e-33    
ref|XP_006439771.1|  hypothetical protein CICLE_v10019344mg             136   4e-33    
gb|AFW73360.1|  hypothetical protein ZEAMMB73_819902                    135   6e-33    
ref|XP_008386612.1|  PREDICTED: protease Do-like 2, chloroplastic       135   6e-33    
ref|XP_001701981.1|  DegP-type protease                                 135   8e-33    
ref|XP_010041338.1|  PREDICTED: protease Do-like 2, chloroplastic       135   9e-33    
ref|XP_007200306.1|  hypothetical protein PRUPE_ppa002853mg             135   9e-33    
ref|XP_008451432.1|  PREDICTED: protease Do-like 2, chloroplastic       135   1e-32    
ref|XP_003520225.1|  PREDICTED: protease Do-like 2, chloroplastic...    135   1e-32    
ref|XP_010545055.1|  PREDICTED: protease Do-like 2, chloroplastic       135   1e-32    
ref|XP_003057446.1|  predicted protein                                  134   1e-32    
ref|XP_002974405.1|  hypothetical protein SELMODRAFT_100929             134   2e-32    
gb|KEH43264.1|  DegP protease                                           134   3e-32    
ref|XP_006588605.1|  PREDICTED: protease Do-like 2, chloroplastic...    133   3e-32    
ref|XP_002948745.1|  hypothetical protein VOLCADRAFT_58517              132   4e-32    
ref|XP_011458665.1|  PREDICTED: protease Do-like 2, chloroplastic...    133   5e-32    
ref|XP_004290719.1|  PREDICTED: protease Do-like 2, chloroplastic...    133   5e-32    
ref|XP_010070002.1|  PREDICTED: protease Do-like 2, chloroplastic       133   6e-32    
gb|ETO06735.1|  hypothetical protein RFI_30658                          132   6e-32    
ref|XP_003536894.1|  PREDICTED: protease Do-like 2, chloroplastic...    133   7e-32    
ref|XP_002958880.1|  serine protease                                    132   8e-32    
ref|XP_004306334.1|  PREDICTED: protease Do-like 9                      132   9e-32    
ref|WP_038960950.1|  hypothetical protein                               132   9e-32    
gb|EMT08042.1|  Protease Do-like protein 9                              132   1e-31    
ref|XP_010323029.1|  PREDICTED: protease Do-like 2, chloroplastic       132   1e-31    
gb|ETO17994.1|  hypothetical protein RFI_19299                          127   1e-31    
ref|XP_006389663.1|  hypothetical protein POPTR_0020s00220g             132   2e-31    
ref|XP_006444216.1|  hypothetical protein CICLE_v10019366mg             132   2e-31    
ref|XP_006479864.1|  PREDICTED: protease Do-like 2, chloroplastic...    132   2e-31    
ref|XP_002875030.1|  predicted protein                                  130   2e-31    
gb|KDP28079.1|  hypothetical protein JCGZ_13850                         132   2e-31    
ref|XP_002511437.1|  serine endopeptidase degp2, putative               130   2e-31    
ref|XP_007050776.1|  DEGP protease 2 isoform 1                          131   3e-31    
ref|XP_006352801.1|  PREDICTED: protease Do-like 2, chloroplastic...    131   3e-31    
ref|XP_004495997.1|  PREDICTED: protease Do-like 2, chloroplastic...    131   3e-31    
ref|XP_001417982.1|  predicted protein                                  130   4e-31    
ref|XP_009587779.1|  PREDICTED: protease Do-like 2, chloroplastic...    130   4e-31    
ref|XP_011079745.1|  PREDICTED: protease Do-like 2, chloroplastic       131   4e-31    
ref|XP_009587778.1|  PREDICTED: protease Do-like 2, chloroplastic...    130   5e-31    
ref|XP_009384166.1|  PREDICTED: protease Do-like 2, chloroplastic       130   5e-31    
ref|XP_009587776.1|  PREDICTED: protease Do-like 2, chloroplastic...    130   6e-31    
gb|KCW54068.1|  hypothetical protein EUGRSUZ_I00049                     122   6e-31    
ref|XP_011082504.1|  PREDICTED: protease Do-like 2, chloroplastic       130   8e-31    
ref|XP_002985706.1|  hypothetical protein SELMODRAFT_122577             129   1e-30    
ref|XP_002154609.2|  PREDICTED: protease Do-like 10, mitochondria...    129   1e-30    
ref|XP_006295823.1|  hypothetical protein CARUB_v10024950mg             129   1e-30    
ref|XP_010507830.1|  PREDICTED: protease Do-like 2, chloroplastic       129   1e-30    
ref|XP_005537155.1|  DegP protease                                      129   1e-30    
ref|XP_007028418.1|  DegP protease 10 isoform 5                         128   1e-30    
ref|XP_010506841.1|  PREDICTED: protease Do-like 2, chloroplastic       129   2e-30    
ref|XP_004829939.1|  serine protease, putative                          128   2e-30    
ref|XP_009768576.1|  PREDICTED: protease Do-like 2, chloroplastic...    129   2e-30    
ref|XP_006289341.1|  hypothetical protein CARUB_v10002825mg             128   2e-30    
ref|XP_009768577.1|  PREDICTED: protease Do-like 2, chloroplastic...    129   2e-30    
ref|XP_002863059.1|  hypothetical protein ARALYDRAFT_497185             129   2e-30    
pdb|4FLN|A  Chain A, Crystal Structure Of Plant Protease Deg2           128   2e-30    
ref|XP_002882138.1|  hypothetical protein ARALYDRAFT_483986             129   2e-30    
ref|XP_009768575.1|  PREDICTED: protease Do-like 2, chloroplastic...    129   3e-30    
ref|XP_002270247.1|  PREDICTED: protease Do-like 2, chloroplastic       128   3e-30    
ref|XP_009344539.1|  PREDICTED: protease Do-like 9 isoform X1           127   3e-30    
ref|XP_009344540.1|  PREDICTED: protease Do-like 9 isoform X2           127   4e-30    
ref|NP_001118544.1|  DegP2 protease                                     128   4e-30    
ref|NP_566115.1|  DegP2 protease                                        128   4e-30    
ref|XP_011033618.1|  PREDICTED: protease Do-like 2, chloroplastic       128   4e-30    
ref|XP_008800525.1|  PREDICTED: protease Do-like 2, chloroplastic       128   4e-30    
ref|XP_009631857.1|  PREDICTED: protease Do-like 2, chloroplastic...    128   4e-30    
ref|XP_009631856.1|  PREDICTED: protease Do-like 2, chloroplastic...    128   5e-30    
ref|XP_007050777.1|  DEGP protease 2 isoform 2                          128   5e-30    
ref|XP_005650005.1|  trypsin-like serine protease                       127   5e-30    
ref|XP_008368916.1|  PREDICTED: protease Do-like 2, chloroplastic       127   6e-30    
ref|XP_010941774.1|  PREDICTED: protease Do-like 2, chloroplastic       127   6e-30    
ref|XP_010518514.1|  PREDICTED: protease Do-like 2, chloroplastic...    127   7e-30    
ref|XP_010518515.1|  PREDICTED: protease Do-like 2, chloroplastic...    127   7e-30    
ref|NP_564857.2|  DegP protease 4                                       125   8e-30    
gb|ABE65743.1|  DegP protease                                           125   8e-30    
gb|KFK37548.1|  hypothetical protein AALP_AA4G271000                    127   8e-30    
ref|XP_006397989.1|  hypothetical protein EUTSA_v10001363mg             127   8e-30    
ref|NP_001168096.1|  uncharacterized protein LOC100381831               122   8e-30    
gb|KFK37547.1|  hypothetical protein AALP_AA4G271000                    127   9e-30    
ref|XP_010247118.1|  PREDICTED: protease Do-like 2, chloroplastic       127   1e-29    
gb|KDD74963.1|  hypothetical protein H632_c960p1                        125   1e-29    
ref|XP_006439770.1|  hypothetical protein CICLE_v10019344mg             125   1e-29    
ref|XP_002520690.1|  serine endopeptidase degp2, putative               127   1e-29    
ref|XP_006439772.1|  hypothetical protein CICLE_v10019344mg             124   1e-29    
ref|XP_009773293.1|  PREDICTED: protease Do-like 2, chloroplastic       126   2e-29    
gb|KJB49012.1|  hypothetical protein B456_008G097600                    125   2e-29    
gb|KFG27726.1|  trypsin domain protein                                  121   2e-29    
ref|XP_009118165.1|  PREDICTED: protease Do-like 2, chloroplastic       126   2e-29    
ref|XP_008348037.1|  PREDICTED: protease Do-like 9                      125   2e-29    
ref|XP_010684759.1|  PREDICTED: protease Do-like 2, chloroplastic...    125   2e-29    
ref|XP_006845229.1|  hypothetical protein AMTR_s00005p00256670          117   3e-29    
ref|XP_006366368.1|  PREDICTED: protease Do-like 2, chloroplastic...    125   3e-29    
ref|XP_010254417.1|  PREDICTED: protease Do-like 9 isoform X2           124   5e-29    
ref|XP_010684757.1|  PREDICTED: protease Do-like 2, chloroplastic...    125   6e-29    
gb|KJB47046.1|  hypothetical protein B456_008G008100                    125   6e-29    
emb|CDP03552.1|  unnamed protein product                                123   7e-29    
ref|XP_006439769.1|  hypothetical protein CICLE_v10019344mg             124   9e-29    
gb|KFG45747.1|  trypsin domain-containing protein                       119   9e-29    
ref|XP_004247469.1|  PREDICTED: protease Do-like 2, chloroplastic       124   9e-29    
ref|XP_005827715.1|  hypothetical protein GUITHDRAFT_164606             124   1e-28    
ref|XP_005774372.1|  hypothetical protein EMIHUDRAFT_74740              123   1e-28    
emb|CDY66495.1|  BnaCnng51110D                                          115   2e-28    
emb|CCF73353.1|  unnamed protein product                                122   3e-28    
emb|CBI32271.3|  unnamed protein product                                122   5e-28    
gb|KFH12639.1|  trypsin domain-containing protein                       120   8e-28    
gb|EPS65237.1|  hypothetical protein M569_09541                         120   8e-28    
emb|CDR95924.1|  DegP protease, putative                                121   1e-27    
emb|CEF97941.1|  Serine endopeptidase DegP2                             120   1e-27    
ref|XP_011011013.1|  PREDICTED: LOW QUALITY PROTEIN: protease Do-...    120   2e-27    
emb|CBJ48373.1|  conserved unknown protein                              120   3e-27    
ref|XP_006378624.1|  hypothetical protein POPTR_0010s18430g             117   3e-27    
emb|CDY55521.1|  BnaA04g29470D                                          120   3e-27    
emb|CDY27464.1|  BnaC04g51050D                                          119   5e-27    
ref|XP_003079294.1|  putative DegP2 protease (ISS)                      119   8e-27    
ref|XP_001610362.1|  DegP protease                                      116   3e-26    
ref|XP_008235077.1|  PREDICTED: protease Do-like 2, chloroplastic       116   5e-26    
ref|XP_009689126.1|  serine protease                                    116   6e-26    
emb|CBX27101.1|  Protease Do-like 10, mitochondrial                     114   1e-25    
ref|XP_765845.1|  serine protease                                       114   1e-25    
gb|KIY95877.1|  hypothetical protein MNEG_12084                         114   3e-25    
gb|AAB60913.1|  F5I14.17 gene product                                   112   4e-25    
gb|AAB60923.1|  F5I14.16                                                112   4e-25    
ref|XP_006391529.1|  hypothetical protein EUTSA_v10019498mg             110   5e-25    
gb|KDO69730.1|  hypothetical protein CISIN_1g007213mg                   112   1e-24    
gb|ETO21210.1|  hypothetical protein RFI_15994                          108   6e-24    
ref|XP_954412.1|  serine protease (zymogen-like)                        108   2e-23    
ref|WP_027353863.1|  hypothetical protein                               107   3e-23    
gb|KHN03752.1|  Protease Do-like 2, chloroplastic                       108   4e-23    
gb|KHN46596.1|  Protease Do-like 2, chloroplastic                       107   7e-23    
ref|XP_005779861.1|  hypothetical protein EMIHUDRAFT_430070             106   1e-22    
gb|ABW31588.1|  trypsin-like serine protease, putative                  105   1e-22    
ref|XP_006391634.1|  hypothetical protein EUTSA_v10023879mg             105   1e-22    
ref|XP_011400998.1|  Protease Do-like 9                                 107   2e-22    
ref|WP_041661167.1|  hypothetical protein                               105   2e-22    
gb|ABW33227.1|  protease, putative                                      105   2e-22    
gb|ABK21948.1|  unknown                                                 101   2e-22    
gb|EJK64737.1|  hypothetical protein THAOC_14498                        105   6e-22    
gb|AIA26574.1|  serine protease                                         104   6e-22    
gb|EWM29653.1|  protease do-like 9                                      103   8e-22    
gb|ABR25659.1|  protease do-2 like                                      100   1e-21    
ref|WP_012831747.1|  peptidase S1 and S6 chymotrypsin/Hap               102   1e-21    
gb|EWM29652.1|  protease do-like 9                                      103   2e-21    
ref|WP_024123741.1|  MULTISPECIES: hypothetical protein               99.4    2e-21    
ref|WP_013942997.1|  protease Do-like 10                                102   2e-21    
ref|XP_005767710.1|  hypothetical protein EMIHUDRAFT_103267             103   2e-21    
ref|XP_007031394.1|  Protease Do-like 9 isoform 3                       102   3e-21    
ref|XP_002286231.1|  trypsin-like serine protease                       102   4e-21    
ref|XP_005714405.1|  unnamed protein product                            100   1e-20    
gb|KCW56073.1|  hypothetical protein EUGRSUZ_I01831                   99.8    3e-20    
emb|CDJ62816.1|  trypsin, putative                                      100   5e-20    
ref|XP_008647465.1|  PREDICTED: uncharacterized protein LOC100217...  98.6    7e-20    
dbj|BAK01822.1|  predicted protein                                    98.2    8e-20    
ref|XP_005717038.1|  unnamed protein product                          95.5    9e-20    
ref|XP_001748733.1|  hypothetical protein                             99.0    9e-20    
ref|XP_002321037.1|  putative DegP2 protease family protein           98.2    1e-19    
emb|CDJ40146.1|  hypothetical protein ETH_00012215                    98.2    2e-19    
ref|XP_007209088.1|  hypothetical protein PRUPE_ppa003679mg           96.3    4e-19    
ref|XP_003881237.1|  peptidase S1, chymotrypsin:PDZ/DHR/GLGF doma...  96.3    9e-19    
gb|KDO69729.1|  hypothetical protein CISIN_1g007213mg                 94.7    2e-18    
gb|KFK31613.1|  hypothetical protein AALP_AA6G135800                  92.0    2e-18    
ref|WP_025566621.1|  hypothetical protein                             93.2    4e-18    
emb|CCK81051.1|  serine protease, related to trypsin                  92.8    5e-18    
ref|WP_041280057.1|  hypothetical protein                             92.4    6e-18    
dbj|GAK48960.1|  protease, putative                                   92.4    8e-18    
ref|XP_002368468.1|  trypsin, putative                                92.8    2e-17    
gb|KFG31101.1|  serine protease                                       92.8    2e-17    
gb|ESS33926.1|  serine protease                                       92.8    2e-17    
ref|XP_007050778.1|  DEGP protease 2 isoform 3                        91.7    2e-17    
gb|EPR59808.1|  serine protease                                       92.4    2e-17    
ref|XP_005764176.1|  hypothetical protein EMIHUDRAFT_247734           91.7    2e-17    
gb|KFG42321.1|  serine protease                                       92.4    2e-17    
ref|WP_020036438.1|  hypothetical protein                             89.4    2e-17    
ref|XP_002862794.1|  hypothetical protein ARALYDRAFT_920262           90.9    2e-17    
ref|NP_001136976.1|  uncharacterized protein LOC100217136             86.3    2e-17    
gb|EPS74298.1|  hypothetical protein M569_00454                       90.1    2e-17    
ref|XP_008889209.1|  serine protease                                  91.7    3e-17    
emb|CDJ60046.1|  DegPtype protease, related                           91.3    4e-17    
gb|EJK72666.1|  hypothetical protein THAOC_05779                      87.8    6e-17    
ref|XP_004989115.1|  hypothetical protein PTSG_09760                  90.5    6e-17    
ref|WP_038142065.1|  peptidase S1 and S6 chymotrypsin/Hap             89.7    6e-17    
ref|WP_012861033.1|  serine protease                                  88.2    2e-16    
ref|WP_020035256.1|  MULTISPECIES: hypothetical protein               88.2    2e-16    
emb|CDY72455.1|  BnaA10g28640D                                        83.6    3e-16    
emb|CAX68967.1|  periplasmic serine endoprotease of the DegP/Htr ...  87.4    3e-16    
ref|XP_010112729.1|  hypothetical protein L484_020456                 86.7    4e-16    
gb|EJK64993.1|  hypothetical protein THAOC_14214                      88.2    4e-16    
gb|KHG08084.1|  Protease Do-like 9                                    81.3    4e-16    
gb|ACI15904.1|  serine protease                                       87.4    7e-16    
ref|XP_006439768.1|  hypothetical protein CICLE_v10019344mg           85.5    7e-16    
gb|EIJ35545.1|  peptidase S1 and S6 chymotrypsin/Hap                  86.7    1e-15    
ref|WP_040840851.1|  peptidase S1 and S6 chymotrypsin/Hap             85.9    1e-15    
ref|WP_033407513.1|  peptidase S1 and S6 chymotrypsin/Hap             85.9    1e-15    
gb|KJB47047.1|  hypothetical protein B456_008G008100                  86.3    1e-15    
ref|WP_040504359.1|  hypothetical protein                             84.7    3e-15    
ref|XP_006439767.1|  hypothetical protein CICLE_v10019344mg           84.7    3e-15    
emb|CDX93500.1|  BnaA06g05480D                                        82.0    4e-15    
ref|WP_021745262.1|  trypsin                                          84.0    5e-15    
gb|ETO12956.1|  trypsin                                               82.0    5e-15    



>ref|XP_009803816.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana sylvestris]
Length=593

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA LKVLRNGE  +F I L PL+PLVPVHQFDK
Sbjct  381  ANDGTVPFRNRERITFDHLVSMKKPNETAELKVLRNGEVHDFKIMLHPLQPLVPVHQFDK  440

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGLVFIPLTQP+LHEYGEDWYN SPRRLCERALR+LP KPGEQ +ILSQVL+D
Sbjct  441  LPSYFIFAGLVFIPLTQPFLHEYGEDWYNASPRRLCERALRELPKKPGEQFIILSQVLMD  500

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEV NLKHLR+LVED +++ +RFDLDDERVIVLNY+ A++A
Sbjct  501  DINAGYERLAELQVKKVNGVEVLNLKHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIA  560

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRILKRHRIP+AMS+DL +DE A  L+ ACS+
Sbjct  561  TSRILKRHRIPHAMSTDLTDDENAAELQSACSS  593



>ref|XP_009611385.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana tomentosiformis]
Length=593

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA LKVLRNG+  +F I L PL+PLVPVHQFDK
Sbjct  381  ANDGTVPFRNRERITFDHLVSMKKPNETAELKVLRNGKVHDFKITLHPLQPLVPVHQFDK  440

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGLVFIPLTQP+LHEYGEDWYN SPRRLCERALR+LP KPGEQ +ILSQVL+D
Sbjct  441  LPSYFIFAGLVFIPLTQPFLHEYGEDWYNASPRRLCERALRELPKKPGEQFIILSQVLMD  500

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEV NLKHLR+LVED +++ +RFDLDDERVIVLNY+ A++A
Sbjct  501  DINAGYERLAELQVKKVNGVEVLNLKHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIA  560

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRILKRHRIP+AMSSDL +DE A  L+ ACS+
Sbjct  561  TSRILKRHRIPHAMSSDLTDDENAVELQSACSS  593



>gb|EYU39504.1| hypothetical protein MIMGU_mgv1a003194mg [Erythranthe guttata]
Length=601

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPN+TA +KVLR+GE+ EF++ L PL PLVPVHQFDK
Sbjct  389  ANDGSVAFRNRERITFDHLVSMKKPNDTAQVKVLRSGEEHEFTVTLRPLHPLVPVHQFDK  448

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+ IFAGLVF+PLTQPYLHEYGEDWYN SPRRLCERALR+LP KPG+Q VILSQVL+D
Sbjct  449  LPSYLIFAGLVFVPLTQPYLHEYGEDWYNASPRRLCERALRELPQKPGQQFVILSQVLMD  508

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTGYERLA+LQV KVNGVEV+NLKHLR+LVED   E +RFDLDDERVIVLNYD AK A
Sbjct  509  DINTGYERLADLQVKKVNGVEVDNLKHLRQLVEDGGNENVRFDLDDERVIVLNYDSAKTA  568

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACS  93
            TSRILKRHRIP AMS DLI ++    +E+ACS
Sbjct  569  TSRILKRHRIPSAMSDDLIEEQDVSVIEVACS  600



>ref|XP_011077091.1| PREDICTED: protease Do-like 10, mitochondrial [Sesamum indicum]
Length=596

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMK+PN+TA +KVLR+G++ EF+I L PL+PLVPVHQFDK
Sbjct  384  ANDGSVPFRNRERITFDHLVSMKRPNDTARVKVLRDGKEHEFTITLRPLQPLVPVHQFDK  443

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP K G+QLVILSQVL+D
Sbjct  444  LPSYFIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPQKTGQQLVILSQVLMD  503

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTGYERL++LQV KVNG+EV+NLKHLR+LVE++S++ +RFDLDD+RVIVLNY+ AK+A
Sbjct  504  DINTGYERLSDLQVKKVNGIEVDNLKHLRQLVENSSRDNVRFDLDDDRVIVLNYNSAKMA  563

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACS  93
            T+RILKRHRIP AMSSDL+++E    +ELAC+
Sbjct  564  TTRILKRHRIPSAMSSDLVDEEGGSNIELACA  595



>ref|XP_006353238.1| PREDICTED: protease Do-like 10, mitochondrial-like [Solanum tuberosum]
Length=597

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A+DG V FR RERI+FDHLVSMKKPNETA LKVLRNGE  +F I L PL+PLVPVHQFDK
Sbjct  385  ASDGTVPFRNRERISFDHLVSMKKPNETAELKVLRNGEVHDFKITLHPLQPLVPVHQFDK  444

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGLVFIPLTQP+LHEYGE+WYNTSPRRLCERALR+LP KPGEQ +ILSQVL+D
Sbjct  445  LPSYFIFAGLVFIPLTQPFLHEYGEEWYNTSPRRLCERALRELPKKPGEQFIILSQVLMD  504

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEV NLKHLR+LVED +++ +RFDLDDERVIVLNY+ A++A
Sbjct  505  DINAGYERLAELQVKKVNGVEVLNLKHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIA  564

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRILKRHRIP+AMS DL +++ A  L+ ACS 
Sbjct  565  TSRILKRHRIPHAMSIDLTDEQNAAELQSACST  597



>emb|CDP04134.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 189/214 (88%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETAVLKVLRNGE+ EF+I L PL+PLVPVHQFDK
Sbjct  378  ANDGTVPFRNRERITFDHLVSMKKPNETAVLKVLRNGEEHEFNITLQPLQPLVPVHQFDK  437

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGL+F+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP K GE+LVILSQVL+D
Sbjct  438  LPSYFIFAGLLFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPRKAGEELVILSQVLMD  497

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTGYERLAELQV KV+ VEVENLKHL +LVE   KE IRFDLDDERVIVLNY +AKVA
Sbjct  498  DINTGYERLAELQVKKVDNVEVENLKHLCQLVEGCEKEAIRFDLDDERVIVLNYSMAKVA  557

Query  188  TSRILKRHRIPYAMSSDLINDE-CAPALELACSN  90
            TSRIL+RHRIP AMS DL+N+E     +  ACS+
Sbjct  558  TSRILQRHRIPNAMSGDLLNNERKVSNISSACSS  591



>ref|XP_002265825.2| PREDICTED: protease Do-like 10, mitochondrial [Vitis vinifera]
 emb|CBI33040.3| unnamed protein product [Vitis vinifera]
Length=564

 Score =   348 bits (892),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA +KVLR+GE+ EFS+ L  L+PLVPV QFDK
Sbjct  352  ANDGTVPFRNRERITFDHLVSMKKPNETAQVKVLRDGEEYEFSVTLQTLQPLVPVQQFDK  411

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGLVF+PLTQPYLHEYGEDWYNT PRRLCERALR+LPT+PGEQ+VILSQVL+D
Sbjct  412  LPSYFIFAGLVFVPLTQPYLHEYGEDWYNTCPRRLCERALRELPTRPGEQIVILSQVLMD  471

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLA+LQV KVNGVE++NLKH  +LVE+ S E +RFDLDDERVIVLNY LAK+A
Sbjct  472  DINAGYERLADLQVKKVNGVEIKNLKHFSQLVENCSMESLRFDLDDERVIVLNYQLAKIA  531

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELAC  96
            TSRILKRHRIP AMS DLI  + +   ELAC
Sbjct  532  TSRILKRHRIPSAMSRDLIQKQDSSEAELAC  562



>ref|XP_010277816.1| PREDICTED: protease Do-like 10, mitochondrial [Nelumbo nucifera]
Length=573

 Score =   346 bits (888),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA + VLRNG + EF+I L PL+PLVPVHQFDK
Sbjct  360  ANDGTVPFRNRERITFDHLVSMKKPNETAKVTVLRNGVEYEFNITLLPLQPLVPVHQFDK  419

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  420  LPSYFIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMD  479

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            D+NTGYERLAE+QV KVNGVEVENLKHL +LVED S+E +RFDLDD+RVIVLNY  AKVA
Sbjct  480  DVNTGYERLAEMQVKKVNGVEVENLKHLCRLVEDCSEESLRFDLDDDRVIVLNYQSAKVA  539

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRILKRHRIP AMS+DLI ++
Sbjct  540  TSRILKRHRIPSAMSNDLIEEQ  561



>ref|XP_004250091.1| PREDICTED: protease Do-like 10, mitochondrial [Solanum lycopersicum]
Length=595

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A+DG V FR RERI+FDHLVSMKKPNETA L+VLR+GE  +F I L PL+PLVPVHQFDK
Sbjct  385  ASDGTVPFRNRERISFDHLVSMKKPNETAELEVLRDGEVHDFKITLHPLQPLVPVHQFDK  444

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+FIFAGLVFIPLTQP+LHEYGE+WYNTSPRRLCERALR+LP KPGEQ VILSQVL+D
Sbjct  445  LPSYFIFAGLVFIPLTQPFLHEYGEEWYNTSPRRLCERALRELPKKPGEQFVILSQVLMD  504

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEV NLKHLR+LVED +++ +RFDLDDERVIVLNY+ A++A
Sbjct  505  DINAGYERLAELQVKKVNGVEVLNLKHLRQLVEDGNQKNVRFDLDDERVIVLNYESARIA  564

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELAC  96
            TSRILKRHRIP+AMS DL +++ A  L  AC
Sbjct  565  TSRILKRHRIPHAMSIDLTDEQNAAELLSAC  595



>ref|XP_008776774.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Phoenix 
dactylifera]
Length=568

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 187/214 (87%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA ++VLR+G + EF I L PL+PLVPVHQFD 
Sbjct  355  ANDGTVPFRNRERITFDHLVSMKKPNETAHVRVLRDGTEHEFCISLLPLQPLVPVHQFDT  414

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  415  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQVLMD  474

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERL+ELQV K NGVEVENLKHL +LVE  S+E +RFDLDDERVIVLNY  A++A
Sbjct  475  DINAGYERLSELQVKKANGVEVENLKHLCELVEGCSEESLRFDLDDERVIVLNYQNARLA  534

Query  188  TSRILKRHRIPYAMSSDLINDEC-APALELACSN  90
            TSRILKRHRIP AMSSDLIND+     +++ACS+
Sbjct  535  TSRILKRHRIPSAMSSDLINDQTNVSEIKVACSS  568



>ref|XP_010927886.1| PREDICTED: protease Do-like 10, mitochondrial [Elaeis guineensis]
Length=568

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA ++VLR+G + EF I L PL+PLVPVHQFDK
Sbjct  355  ANDGTVPFRNRERITFDHLVSMKKPNETAHVRVLRDGIENEFCISLQPLQPLVPVHQFDK  414

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LP ++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  415  LPGYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQVLMD  474

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERL+ELQV KVNGVEVENLKHL +LVE  S+E +RFDLDDERVIVLNY  A++A
Sbjct  475  DINAGYERLSELQVKKVNGVEVENLKHLCELVEGCSEESLRFDLDDERVIVLNYQNARLA  534

Query  188  TSRILKRHRIPYAMSSDLINDEC-APALELACSN  90
            TSRIL RHRIP AMSSDLI+D+     +++ACS+
Sbjct  535  TSRILNRHRIPSAMSSDLIDDQTNVSEIKVACSS  568



>gb|EPS59937.1| hypothetical protein M569_14869, partial [Genlisea aurea]
Length=196

 Score =   325 bits (834),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 180/195 (92%), Gaps = 1/195 (1%)
 Frame = -1

Query  713  VHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLPSFF  534
            V FR RERITFDHLVSMKKP+E A++K+LR+GE+ EF+I L PL+PLVPVHQFDKLPS+F
Sbjct  2    VPFRNRERITFDHLVSMKKPDEVALVKILRDGEELEFTITLRPLQPLVPVHQFDKLPSYF  61

Query  533  IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTG  354
            IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP K G+QL+ILSQVL+DDINTG
Sbjct  62   IFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPRKGGQQLIILSQVLMDDINTG  121

Query  353  YERLAELQVNKVNGVEVENLKHLRKLVEDN-SKERIRFDLDDERVIVLNYDLAKVATSRI  177
            YERLA+LQV KVNG+EV+NL HLR+LVED+ S+E IRFD+DDERV+VLNY LAKVATSR+
Sbjct  122  YERLADLQVKKVNGIEVDNLVHLRRLVEDSHSREVIRFDMDDERVMVLNYSLAKVATSRV  181

Query  176  LKRHRIPYAMSSDLI  132
            LKRHRIP A+S DLI
Sbjct  182  LKRHRIPSAVSWDLI  196



>ref|XP_010528621.1| PREDICTED: protease Do-like 10, mitochondrial [Tarenaya hassleriana]
Length=594

 Score =   338 bits (868),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLR+G + EF I L PL+PLVPVHQFD 
Sbjct  382  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLRDGTEHEFIISLKPLQPLVPVHQFDT  441

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYN+SPRRLCERALR LP K GEQLVILSQVL+D
Sbjct  442  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNSSPRRLCERALRDLPKKAGEQLVILSQVLMD  501

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTGYERLAELQV KVNGVEV+NL+HL +L+E  S E +R DLDDERVIVLNY  AK+A
Sbjct  502  DINTGYERLAELQVKKVNGVEVDNLRHLCQLIEKCSDENLRLDLDDERVIVLNYPFAKIA  561

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACS  93
            TSRILKRHRIP +MSSDL++++      +AC+
Sbjct  562  TSRILKRHRIPSSMSSDLLSEQNTATESVACA  593



>gb|ACF84354.1| unknown [Zea mays]
Length=446

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 183/214 (86%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAVLKVLR+G++ E  + L PL+PLVPVHQFDK
Sbjct  233  ANDGTVPFRNRERITFDHLVSMKKPEETAVLKVLRDGKEQELGVTLRPLQPLVPVHQFDK  292

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  293  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNASPRRLCERALRELPKKTGEQLVILSQVLMD  352

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  A++A
Sbjct  353  DINVGYERLAELQVKKVNGVEVENLKHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLA  412

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSR+LKRHRIP A+SSDL+ D+     +E +C++
Sbjct  413  TSRVLKRHRIPSAISSDLVEDQVTDGEVETSCTS  446



>ref|XP_008224670.1| PREDICTED: protease Do-like 10, mitochondrial [Prunus mume]
Length=595

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETAV++VLR+GE+ EF+I L PL+PLVPVHQFDK
Sbjct  380  ANDGTVPFRNRERITFDHLVSMKKPNETAVVRVLRDGEEYEFNITLRPLQPLVPVHQFDK  439

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCE ALR+ P + GEQL+ILSQVL+D
Sbjct  440  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCESALREPPKRAGEQLIILSQVLMD  499

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+EVENLKHL +LVE+ SKE +RFDLDD+RVIVLN+ LAKVA
Sbjct  500  DINAGYERLAELQVKKVNGIEVENLKHLCQLVENCSKESVRFDLDDDRVIVLNHSLAKVA  559

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TS+ILK HRIP AMS+DLI+ +
Sbjct  560  TSKILKCHRIPSAMSNDLIDKQ  581



>ref|XP_006468667.1| PREDICTED: protease Do-like 10, mitochondrial-like [Citrus sinensis]
 gb|KDO77070.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=590

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE ++++VLR+G++ EFSI L  L+PLVPVHQFDK
Sbjct  373  ANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDK  432

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  433  LPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMD  492

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYER A+LQV KVNGVE+ENLKHL +LVE+ S E +RFDLDD+RV+VLNYD+AK+A
Sbjct  493  DINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIA  552

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELA  99
            TS+ILKRHRIP AMS DL N E    +ELA
Sbjct  553  TSKILKRHRIPSAMSGDL-NGEQISEIELA  581



>ref|XP_004155122.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus]
Length=601

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 185/213 (87%), Gaps = 1/213 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE +V+KVLRNGE  E SI L PL+PLVPVHQFDK
Sbjct  390  ANDGTVSFRNRERITFDHLVSMKKPNEKSVVKVLRNGEVCELSITLRPLQPLVPVHQFDK  449

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALR+LP KPGEQ VILSQVL+D
Sbjct  450  LPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKPGEQFVILSQVLMD  509

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEV+NLKHL +LV D S++ +RFDLDD+RVIVLN+++AK+A
Sbjct  510  DINAGYERLAELQVKKVNGVEVDNLKHLCQLV-DKSEDSVRFDLDDDRVIVLNFEMAKIA  568

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRIL RHRIP A+S DL+ D      +LA S+
Sbjct  569  TSRILNRHRIPSALSHDLMEDLSFHNSQLASSS  601



>gb|KJB49014.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=382

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLRNG++  F+I L PL+PLVPVHQFDK
Sbjct  172  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLRNGQEHAFTITLQPLQPLVPVHQFDK  231

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  232  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQVLMD  291

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+E++NLKHL +LVE+ S+E +R DLDD+RV+ LNY+ A++A
Sbjct  292  DINAGYERLAELQVKKVNGIEIKNLKHLCQLVENCSRESLRIDLDDDRVVALNYESARIA  351

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRIL+RHRIP  MS DL++++
Sbjct  352  TSRILERHRIPSRMSIDLLSEQ  373



>ref|XP_004152886.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus]
 gb|KGN61234.1| hypothetical protein Csa_2G072480 [Cucumis sativus]
Length=601

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 185/213 (87%), Gaps = 1/213 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE +V+KVLRNGE  E  I L PL+PLVPVHQFDK
Sbjct  390  ANDGTVSFRNRERITFDHLVSMKKPNEKSVVKVLRNGEVCELRITLRPLQPLVPVHQFDK  449

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALR+LP KPGEQ VILSQVL+D
Sbjct  450  LPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKPGEQFVILSQVLMD  509

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEV+NLKHL +LV D S++ +RFDLDD+RVIVLN+++AK+A
Sbjct  510  DINAGYERLAELQVKKVNGVEVDNLKHLCQLV-DKSEDSVRFDLDDDRVIVLNFEMAKIA  568

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRILKRHRIP A+S DL+ D      +LA S+
Sbjct  569  TSRILKRHRIPSALSHDLMEDLSFHNSQLASSS  601



>ref|XP_002441105.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
 gb|EES19535.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
Length=587

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 183/214 (86%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAVLKVLR+G++ E  + L PL+PLVPVHQFDK
Sbjct  374  ANDGTVPFRNRERITFDHLVSMKKPEETAVLKVLRDGKEQELKVTLRPLQPLVPVHQFDK  433

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  434  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNASPRRLCERALRELPKKAGEQLVILSQVLMD  493

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  A++A
Sbjct  494  DINVGYERLAELQVKKVNGVEVENLKHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLA  553

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSR+LKRHRIP A+SSDL+ DE     +E +C++
Sbjct  554  TSRVLKRHRIPSAISSDLVQDEATNGEVETSCTS  587



>ref|XP_007211387.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
 gb|EMJ12586.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
Length=595

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETAV++VLR+GE+ E +I L PL+PLVPVHQFDK
Sbjct  380  ANDGTVPFRNRERITFDHLVSMKKPNETAVVRVLRDGEEYEINITLQPLQPLVPVHQFDK  439

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCE ALR+ P + GEQLVILSQVL+D
Sbjct  440  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCESALREPPKRAGEQLVILSQVLMD  499

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+EVENLKH+ +LVE+ SKE +RFDLDD+RVIVLN+ LAKVA
Sbjct  500  DINAGYERLAELQVKKVNGIEVENLKHICQLVENCSKESVRFDLDDDRVIVLNHSLAKVA  559

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TS+ILK HRIP AMS+DLI+ +
Sbjct  560  TSKILKCHRIPSAMSNDLIDKQ  581



>ref|XP_011011698.1| PREDICTED: protease Do-like 10, mitochondrial [Populus euphratica]
Length=580

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA +++LR GE+ EFSI L PL+PLVPVHQFDK
Sbjct  368  ANDGTVPFRNRERITFDHLVSMKKPNETASVRLLRGGEEHEFSITLRPLQPLVPVHQFDK  427

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGE+WYNTSPRRLCERAL++LP K  +QL+ILSQVL+D
Sbjct  428  LPSYYIFAGLVFVPLTQPYLHEYGEEWYNTSPRRLCERALKELPKKADQQLIILSQVLMD  487

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVE++N+KHL +LV D S E +RFDLDD+RVI LNY  AKVA
Sbjct  488  DINAGYERLAELQVKKVNGVEIDNMKHLCQLVGDCSSESLRFDLDDDRVIALNYQSAKVA  547

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRILKRHRIP AMSSDL  ++  P  E A S+
Sbjct  548  TSRILKRHRIPSAMSSDLSAEQNIPESESASSS  580



>ref|XP_006448510.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
 gb|ESR61750.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
Length=590

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 184/210 (88%), Gaps = 1/210 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE ++++VLR+G++ EFSI L PL+ LVPVHQFDK
Sbjct  373  ANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRPLQSLVPVHQFDK  432

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF PLTQPYLHEYGEDWYNTSPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  433  LPSYYIFAGLVFTPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMD  492

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYER A+LQV KVNGVE+ENLKHL +LVE+ S E +RFDLDD+RV+VLNYD+AK+A
Sbjct  493  DINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSTENLRFDLDDDRVVVLNYDVAKIA  552

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELA  99
            TS+ILKRHRIP A+S DL N E    +ELA
Sbjct  553  TSKILKRHRIPSALSGDL-NGEQISEIELA  581



>ref|XP_009420477.1| PREDICTED: protease Do-like 10, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=564

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETA+L +LR+G + EFSI L PL+PLVPVHQFDK
Sbjct  351  ANDGSVPFRNRERITFDHLVSMKKPGETAILSLLRDGIEQEFSISLRPLQPLVPVHQFDK  410

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  411  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQVLMD  470

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERL+E QV KVN VEVENLKHL  L+E  ++E IR DLDDERVIVLNY  A++A
Sbjct  471  DINAGYERLSEFQVKKVNDVEVENLKHLCGLIEGCTEESIRLDLDDERVIVLNYKNARLA  530

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSRILKRHRIP AMS+DLI+++     +E+ACS+
Sbjct  531  TSRILKRHRIPSAMSNDLIDEQATNGEVEVACSS  564



>ref|XP_004293434.2| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
 ref|XP_011460090.1| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG VHFR RERITFDHLVSMKKPNETAV++VLR+G++ EFSI L PL+PLVPVHQFDK
Sbjct  370  ANDGTVHFRNRERITFDHLVSMKKPNETAVVRVLRDGKEYEFSITLQPLQPLVPVHQFDK  429

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            +PS++IFAGLVF+PLTQPYLHEYGEDWYNTSPR+LCE ALR+ P + GEQ VILSQVL+D
Sbjct  430  VPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRKLCEIALRESPKRAGEQFVILSQVLMD  489

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG EVENLKHL +LVE  S+E +RFDLDD+RV+VLNY+LAKVA
Sbjct  490  DINAGYERLAELQVKKVNGKEVENLKHLCQLVESCSEESVRFDLDDDRVVVLNYNLAKVA  549

Query  188  TSRILKRHRIPYAMSSDLI  132
            TS+ILK HRIP AMS+DL+
Sbjct  550  TSKILKCHRIPSAMSNDLV  568



>ref|XP_008647597.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW78023.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=585

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 183/214 (86%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAVLKVLR+G++ E  + L PL+PLVPVHQFDK
Sbjct  372  ANDGTVPFRNRERITFDHLVSMKKPEETAVLKVLRDGKEQELGVTLRPLQPLVPVHQFDK  431

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  432  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNASPRRLCERALRELPKKTGEQLVILSQVLMD  491

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  A++A
Sbjct  492  DINVGYERLAELQVKKVNGVEVENLKHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLA  551

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSR+LKRHRIP A+SSDL+ D+     +E +C++
Sbjct  552  TSRVLKRHRIPSAISSDLVEDQVTDGEVETSCTS  585



>ref|XP_008377055.1| PREDICTED: protease Do-like 10, mitochondrial [Malus domestica]
Length=572

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG VHFR RERITFDHLVSMKKPNETA+++VLR+GE+ EFSI L PL+PLVPVHQFDK
Sbjct  372  ANDGTVHFRNRERITFDHLVSMKKPNETAIVRVLRDGEEYEFSIALQPLQPLVPVHQFDK  431

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYN+SPRRLCE ALR+ P +PG+QLVILSQVL+D
Sbjct  432  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNSSPRRLCESALREPPKRPGQQLVILSQVLMD  491

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEV+NLKHL  LVE+ S+E +RFDLDD+RVIVLN  LAKVA
Sbjct  492  DINAGYERLAELQVKKVNGVEVDNLKHLCLLVENCSEESVRFDLDDDRVIVLNRRLAKVA  551

Query  188  TSRILKRHRIPYAMSSDL  135
            TS+ILK HRIP  MS DL
Sbjct  552  TSKILKCHRIPSVMSDDL  569



>ref|XP_007028414.1| DegP protease 10 isoform 1 [Theobroma cacao]
 gb|EOY08916.1| DegP protease 10 isoform 1 [Theobroma cacao]
Length=602

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETAV+KVLRNGE+  F+I L PL+PLVPVHQFDK
Sbjct  394  ANDGTVPFRNRERITFDHLVSMKKPNETAVVKVLRNGEEHAFTITLRPLQPLVPVHQFDK  453

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  454  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKQAGEQLVILSQVLMD  513

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+E++NLKHL +LVE+ S E +RFDLDD+RV+ LN++ A++A
Sbjct  514  DINAGYERLAELQVKKVNGIEIQNLKHLCQLVENCSTESLRFDLDDDRVVALNFESARIA  573

Query  188  TSRILKRHRIPYAMSSDL  135
            TSRIL+RHRIP  MSSDL
Sbjct  574  TSRILERHRIPSRMSSDL  591



>ref|XP_002463281.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
 gb|EER99802.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
Length=586

 Score =   333 bits (854),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 182/214 (85%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAVLKVLR+G++ E  + L PL+PLVPVHQFDK
Sbjct  373  ANDGTVPFRNRERITFDHLVSMKKPEETAVLKVLRDGKEQELRVTLRPLQPLVPVHQFDK  432

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIP TQPYLHE+GEDWYN SPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  433  LPSYYIFAGFVFIPFTQPYLHEFGEDWYNASPRRLCERALRELPKKAGEQLVILSQVLMD  492

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  AK+A
Sbjct  493  DINVGYERLAELQVKKVNGVEVENLKHLCSLVEGCTEENLRFDLDDERVIVLKYQNAKLA  552

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSR+LKRHRIP A+SSDL+ DE     +E +C++
Sbjct  553  TSRVLKRHRIPSAISSDLVEDEPTNGEVETSCTS  586



>ref|XP_004962074.1| PREDICTED: protease Do-like 10, mitochondrial-like [Setaria italica]
Length=586

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 183/214 (86%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAVLK LR+G++ E S+ L PL+PLVPVHQFDK
Sbjct  373  ANDGTVPFRNRERITFDHLVSMKKPGETAVLKALRDGKEQELSVILRPLQPLVPVHQFDK  432

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K GEQLV+LSQVL+D
Sbjct  433  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNASPRRLCERALRELPKKAGEQLVVLSQVLMD  492

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVI+L Y  A++A
Sbjct  493  DINVGYERLAELQVKKVNGVEVENLKHLCSLVESCTEENLRFDLDDERVIILKYQNARLA  552

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSR+LKRHRIP AMSSDL+ ++     +E +C++
Sbjct  553  TSRVLKRHRIPSAMSSDLVEEQATNGEVEASCTS  586



>gb|KDP32493.1| hypothetical protein JCGZ_13418 [Jatropha curcas]
Length=565

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA+L++ R G++ EFSI + PL+PLVPVHQFDK
Sbjct  356  ANDGTVPFRNRERITFDHLVSMKKPNETALLRIFREGKEHEFSITVRPLQPLVPVHQFDK  415

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PL+QPYLHEYGEDWYNTSPRRLCERALR LP K GEQLVILSQVL+D
Sbjct  416  LPSYYIFAGLVFVPLSQPYLHEYGEDWYNTSPRRLCERALRDLPKKAGEQLVILSQVLMD  475

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV +VNGVE+ENLKHL  +VE  + E +RFDLDD+RVIVLNY  A+VA
Sbjct  476  DINAGYERLAELQVKEVNGVEIENLKHLCHIVERCTAESLRFDLDDDRVIVLNYSSARVA  535

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELA  99
            TSRILKRHRIP  MS DL++++     E+A
Sbjct  536  TSRILKRHRIPSPMSRDLVDEQSELESEMA  565



>gb|KJB49013.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=542

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLRNG++  F+I L PL+PLVPVHQFDK
Sbjct  332  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLRNGQEHAFTITLQPLQPLVPVHQFDK  391

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  392  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQVLMD  451

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+E++NLKHL +LVE+ S+E +R DLDD+RV+ LNY+ A++A
Sbjct  452  DINAGYERLAELQVKKVNGIEIKNLKHLCQLVENCSRESLRIDLDDDRVVALNYESARIA  511

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRIL+RHRIP  MS DL++++
Sbjct  512  TSRILERHRIPSRMSIDLLSEQ  533



>ref|XP_010110145.1| Protease Do-like 10 [Morus notabilis]
 gb|EXC25314.1| Protease Do-like 10 [Morus notabilis]
Length=542

 Score =   330 bits (846),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAV++VLR+GE+ EF I L PL+PLVP HQFD+
Sbjct  340  ANDGTVCFRNRERITFDHLVSMKKPKETAVVRVLRDGEEHEFFITLRPLQPLVPAHQFDR  399

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNT+PR LC+RALR+LP KPGEQLVILSQVL+D
Sbjct  400  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTAPRSLCQRALRELPKKPGEQLVILSQVLMD  459

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            D+N GYERLAELQV KVNG+E+ENLKHL +LVE+N+++ +RFDLDDERVI LNY+ AK+A
Sbjct  460  DVNAGYERLAELQVKKVNGLEIENLKHLCQLVENNTEDNVRFDLDDERVIALNYNSAKIA  519

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TS+ILK HRIP AMS DL +++
Sbjct  520  TSKILKWHRIPSAMSKDLADEK  541



>gb|KJB49010.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=551

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLRNG++  F+I L PL+PLVPVHQFDK
Sbjct  341  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLRNGQEHAFTITLQPLQPLVPVHQFDK  400

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  401  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQVLMD  460

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+E++NLKHL +LVE+ S+E +R DLDD+RV+ LNY+ A++A
Sbjct  461  DINAGYERLAELQVKKVNGIEIKNLKHLCQLVENCSRESLRIDLDDDRVVALNYESARIA  520

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRIL+RHRIP  MS DL++++
Sbjct  521  TSRILERHRIPSRMSIDLLSEQ  542



>ref|XP_002514764.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF47318.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=527

 Score =   329 bits (844),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++++LR+GE+ E++I + PL+PLVPVHQFDK
Sbjct  327  ANDGTVPFRNRERITFDHLVSMKKPNETALVRILRDGEEQEYNIIIRPLQPLVPVHQFDK  386

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYN+SPRRLCE ALR+LP K GEQLVILSQVL+D
Sbjct  387  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNSSPRRLCEHALRELPKKAGEQLVILSQVLMD  446

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGV +ENLKHL +LVE  S ER+RFDLDD+RVIVLNY+LAK+A
Sbjct  447  DINAGYERLAELQVKKVNGVVIENLKHLCQLVEGCSAERLRFDLDDDRVIVLNYNLAKLA  506

Query  188  TSRILKRHRIPYAMSSDLIND  126
            TS+ILK HRIP A S DLI++
Sbjct  507  TSKILKHHRIPSAKSCDLIDE  527



>gb|EMS52153.1| Protease Do-like 10, mitochondrial [Triticum urartu]
Length=585

 Score =   330 bits (847),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 185/214 (86%), Gaps = 1/214 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAV+KVLR+G++ E ++ L PL+PLVPVHQFDK
Sbjct  372  ANDGTVPFRNRERITFDHLVSMKKPEETAVIKVLRDGKEHELNVTLRPLQPLVPVHQFDK  431

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K G+QLVILSQVL+D
Sbjct  432  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNASPRRLCERALRELPKKAGQQLVILSQVLMD  491

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  +VE+ ++E +R DLDDERVIVL +  A++A
Sbjct  492  DINVGYERLAELQVKKVNGVEVENLKHLCSIVENCTEENLRIDLDDERVIVLKFQNARLA  551

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSRILKRHRIP AMSSDL++++ +    E +C+N
Sbjct  552  TSRILKRHRIPSAMSSDLVDEQASKGETEASCTN  585



>ref|XP_006655329.1| PREDICTED: protease Do-like 10, mitochondrial-like [Oryza brachyantha]
Length=475

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 183/219 (84%), Gaps = 6/219 (3%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP E AVLKVLR+G + E ++ + PL+PLVPVHQFD+
Sbjct  257  ANDGTVPFRNRERITFDHLVSMKKPGEKAVLKVLRDGNEHELNVTVRPLQPLVPVHQFDQ  316

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  317  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSPRRLCERALRELPKKAGEQLVILSQVLMD  376

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+EVENLKHL  LVE  ++E +RFDLDDERVIVL Y  AK+A
Sbjct  377  DINVGYERLAELQVKKVNGIEVENLKHLCSLVEGCTEENLRFDLDDERVIVLKYKNAKLA  436

Query  188  TSRILKRHRIPYAMSSDLINDECAPA------LELACSN  90
            TSRILKRHRIP A+SSDL++++          +E +C++
Sbjct  437  TSRILKRHRIPSAISSDLVDEQATDGEATNGEIEASCTS  475



>ref|XP_002311275.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
 gb|EEE88642.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
Length=587

 Score =   329 bits (843),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 183/220 (83%), Gaps = 7/220 (3%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA +++LR GE+ EFSI L PL+PLVPVHQFDK
Sbjct  368  ANDGTVPFRNRERITFDHLVSMKKPNETASVRLLRGGEEHEFSITLRPLQPLVPVHQFDK  427

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQ----  381
            LPS++IFAGLVF+PLTQPYLHEYGE+WYNTSPRRLCERAL++LP K  +QL+ILSQ    
Sbjct  428  LPSYYIFAGLVFVPLTQPYLHEYGEEWYNTSPRRLCERALKELPKKADQQLIILSQACLR  487

Query  380  ---VLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLN  210
               VL+DDIN GYERLAELQV KVNGVE++NLKHL +L+ D S E +RFDLDD+RVI LN
Sbjct  488  FFFVLMDDINAGYERLAELQVKKVNGVEIDNLKHLCQLIRDCSSESLRFDLDDDRVIALN  547

Query  209  YDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            Y  AKVATSRILKRHRIP AMSSDL  ++  P  E A S+
Sbjct  548  YQSAKVATSRILKRHRIPSAMSSDLSAEQNIPESESASSS  587



>ref|XP_010027457.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54013.1| hypothetical protein EUGRSUZ_I00006 [Eucalyptus grandis]
Length=567

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 179/211 (85%), Gaps = 1/211 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG + FR RERITFDHL SMKKPNETA+++VLR+GE  EFSI L PL+ LVPVHQFDK
Sbjct  356  ANDGTIPFRNRERITFDHLASMKKPNETALIRVLRDGEVKEFSIALRPLQQLVPVHQFDK  415

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGL+F+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP   GE+LVILSQVL+D
Sbjct  416  LPSYYIFAGLIFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKNAGEELVILSQVLMD  475

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG+E+ENL+HL +LVE  + E +RFDLDDERVIV NY  AK+A
Sbjct  476  DINAGYERLAELQVRKVNGIEIENLRHLYRLVEHCTSESVRFDLDDERVIVFNYHTAKIA  535

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELAC  96
            TS ILKRHRIP   S+DLI DE     +LAC
Sbjct  536  TSTILKRHRIPSVASTDLI-DEQNSQEDLAC  565



>gb|EEE63742.1| hypothetical protein OsJ_18561 [Oryza sativa Japonica Group]
Length=563

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP E AVLKVLR+G++ E ++ + PL+PLVPVHQFDK
Sbjct  343  ANDGTVPFRNRERITFDHLVSMKKPGEMAVLKVLRDGKEHELNVTVRPLQPLVPVHQFDK  402

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K  EQLVILSQVL+D
Sbjct  403  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSPRRLCERALRELPKKAAEQLVILSQVLMD  462

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  AK+A
Sbjct  463  DINVGYERLAELQVKKVNGVEVENLKHLCSLVESCTEENLRFDLDDERVIVLKYQNAKLA  522

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRILKRHRIP A+S+DL++++
Sbjct  523  TSRILKRHRIPSAISADLVDEQ  544



>gb|EAY98063.1| hypothetical protein OsI_19981 [Oryza sativa Indica Group]
Length=614

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP E AVLKVLR+G++ E ++ + PL+PLVPVHQFDK
Sbjct  394  ANDGTVPFRNRERITFDHLVSMKKPGEMAVLKVLRDGKEHELNVTVRPLQPLVPVHQFDK  453

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  454  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSPRRLCERALRELPKKAGEQLVILSQVLMD  513

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV +VNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  AK+A
Sbjct  514  DINVGYERLAELQVKRVNGVEVENLKHLCSLVESCTEENLRFDLDDERVIVLKYQNAKLA  573

Query  188  TSRILKRHRIPYAMSSDLINDEC  120
            TSRILKRHRIP A+S+DL++++ 
Sbjct  574  TSRILKRHRIPSAISADLVDEQA  596



>ref|XP_003568444.1| PREDICTED: protease Do-like 10, mitochondrial [Brachypodium distachyon]
Length=585

 Score =   326 bits (835),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP E AVLKVLR+G++ E ++ L PL+PLVPVHQFDK
Sbjct  372  ANDGTVPFRNRERITFDHLVSMKKPEEIAVLKVLRDGKEHELTVTLRPLQPLVPVHQFDK  431

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+G+DWYNTSPRRLCERALR+LP K G+QLVILSQVL+D
Sbjct  432  LPSYYIFAGFVFIPLTQPYLHEFGDDWYNTSPRRLCERALRELPKKAGQQLVILSQVLMD  491

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVE+ENLKHL  LVE  + E +RFDLDDERVIVL +  A++A
Sbjct  492  DINVGYERLAELQVKKVNGVEIENLKHLCGLVEGCTDENLRFDLDDERVIVLKFQNARLA  551

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRILKRHRIP AMS+DL++++
Sbjct  552  TSRILKRHRIPSAMSNDLVDEQ  573



>ref|NP_001055560.1| Os05g0417100 [Oryza sativa Japonica Group]
 gb|AAT77386.1| putative serine protease [Oryza sativa Japonica Group]
 gb|AAU10782.1| putative serine protease [Oryza sativa Japonica Group]
 dbj|BAF17474.1| Os05g0417100 [Oryza sativa Japonica Group]
 dbj|BAG93339.1| unnamed protein product [Oryza sativa Japonica Group]
Length=614

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP E AVLKVLR+G++ E ++ + PL+PLVPVHQFDK
Sbjct  394  ANDGTVPFRNRERITFDHLVSMKKPGEMAVLKVLRDGKEHELNVTVRPLQPLVPVHQFDK  453

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VFIPLTQPYLHE+GEDWYN SPRRLCERALR+LP K  EQLVILSQVL+D
Sbjct  454  LPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSPRRLCERALRELPKKAAEQLVILSQVLMD  513

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  AK+A
Sbjct  514  DINVGYERLAELQVKKVNGVEVENLKHLCSLVESCTEENLRFDLDDERVIVLKYQNAKLA  573

Query  188  TSRILKRHRIPYAMSSDLINDEC  120
            TSRILKRHRIP A+S+DL++++ 
Sbjct  574  TSRILKRHRIPSAISADLVDEQA  596



>gb|KHG11681.1| hypothetical protein F383_13103 [Gossypium arboreum]
Length=551

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLRNG +  F+I L PL+PLVPVHQFDK
Sbjct  341  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLRNGGEHAFTITLQPLQPLVPVHQFDK  400

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCE ALR+LP + GEQLVILSQVL+D
Sbjct  401  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCELALRELPKRAGEQLVILSQVLMD  460

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV  VNG+E++NLKHL +LVE+ S+E +R DLDD+RV+ LNY+ A++A
Sbjct  461  DINAGYERLAELQVKNVNGIEIKNLKHLCQLVENCSRESLRIDLDDDRVVALNYESARIA  520

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRIL+RHRIP  MS DL++++
Sbjct  521  TSRILERHRIPSRMSIDLLSEQ  542



>ref|XP_006858733.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
 gb|ERN20200.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
Length=573

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKK NETA ++VLR+G++ E S+ + PLK LVPVH+++K
Sbjct  361  ANDGTVPFRNRERITFDHLVSMKKANETANIRVLRDGQELELSVVVHPLKALVPVHEYEK  420

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  421  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPEKVGEQLVILSQVLMD  480

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            +IN GYERLAELQV KVNGVE++NLKHL +LVED  +E +RFDLDDERV+VLNY+ AK+A
Sbjct  481  EINVGYERLAELQVKKVNGVEIDNLKHLCELVEDCKEESLRFDLDDERVVVLNYNKAKLA  540

Query  188  TSRILKRHRIPYAMSSDLIND  126
            TSRILKRHRIP AMS+DL++ 
Sbjct  541  TSRILKRHRIPSAMSTDLLDS  561



>ref|XP_002868484.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44743.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 186/214 (87%), Gaps = 3/214 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP+ETA++KVLR G++ EFSI L PL+PLVPVHQFD+
Sbjct  372  ANDGTVPFRNRERITFDHLVSMKKPDETALVKVLREGKEHEFSITLRPLQPLVPVHQFDQ  431

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNTSPR LC+RAL+ LP K G+QLVI+SQVL+D
Sbjct  432  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRTLCQRALKDLPKKAGQQLVIVSQVLMD  491

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDE-RVIVLNYDLAKV  192
            DINTGYERLAELQVNKVNGVEV+NL+HL +L+E+ + E++R DLDDE RVIVLNY  AK+
Sbjct  492  DINTGYERLAELQVNKVNGVEVDNLRHLCQLIENCNTEKLRIDLDDESRVIVLNYQSAKI  551

Query  191  ATSRILKRHRIPYAMSSDLINDECAPALELA-CS  93
            ATS ILKRHRI  A+SSDL+ ++  P  ELA CS
Sbjct  552  ATSLILKRHRIASAISSDLLVEQ-NPETELASCS  584



>gb|KEH24729.1| DegP protease [Medicago truncatula]
Length=443

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 182/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKK NE AV++V+R+G++ E SI L P++PLVPVHQFDK
Sbjct  233  ANDGTVPFRNRERITFDHLVSMKKLNEKAVVRVMRDGQELELSITLQPIQPLVPVHQFDK  292

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYN SPRRLCERALR+LP K  +QLVILSQVL+D
Sbjct  293  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNASPRRLCERALRELPKKENQQLVILSQVLMD  352

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLA+LQV KVNG E++NL+HL +LVE+ +K+ + FDLDD RVIVLNY+ AK+A
Sbjct  353  DINAGYERLADLQVLKVNGTEIDNLEHLCQLVENCTKDSLHFDLDDNRVIVLNYETAKIA  412

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRIL RHRIP +MS+DLI+ +    L+L  SN
Sbjct  413  TSRILTRHRIPSSMSADLIDAQ--NNLQLTSSN  443



>ref|XP_007150859.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
 gb|ESW22853.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
Length=549

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE A+++VLR+G++ E SI L P++PLVPVHQFDK
Sbjct  348  ANDGTVPFRNRERITFDHLVSMKKPNEKAIVRVLRDGQEHELSIILRPIQPLVPVHQFDK  407

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+ LTQPYLHEYGEDWYNTSPRRLCERALR+LP K  +QLVILSQVL+D
Sbjct  408  LPSYYIFAGLVFVTLTQPYLHEYGEDWYNTSPRRLCERALRELPKKANQQLVILSQVLMD  467

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNG E++NL+HLR+LV++ + E +R DLDD+RVIVLNY++AK+A
Sbjct  468  DINAGYERLAELQVLKVNGTEIDNLEHLRQLVQNCNAEFLRIDLDDDRVIVLNYEMAKIA  527

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TS ILKRHRIP ++S DL++ E
Sbjct  528  TSSILKRHRIPSSVSIDLLDTE  549



>gb|KHN40897.1| Protease Do-like 10, mitochondrial [Glycine soja]
Length=434

 Score =   315 bits (807),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKK NE A++++LR+G++ E SI L P++PLVPVHQFDK
Sbjct  233  ANDGTVPFRNRERITFDHLVSMKKTNEKALVRILRDGQEQELSIILQPIQPLVPVHQFDK  292

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALR+LP K  +QLVILSQVL+D
Sbjct  293  LPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKANQQLVILSQVLMD  352

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVN  E++NL+HLR+LVE  + E +R DL+D+RVIVLNY  AK+A
Sbjct  353  DINAGYERLAELQVLKVNETEIDNLEHLRQLVESCNTEFLRLDLEDDRVIVLNYGTAKIA  412

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRILKRHRIP +MS DL++ E
Sbjct  413  TSRILKRHRIPSSMSVDLLDTE  434



>ref|NP_568543.1| protease Do-like 10 [Arabidopsis thaliana]
 sp|Q9FIV6.1|DGP10_ARATH RecName: Full=Protease Do-like 10, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11638.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL47441.1| AT5g36950/MLF18_70 [Arabidopsis thaliana]
 gb|AAT85770.1| At5g36950 [Arabidopsis thaliana]
 gb|AED94131.1| protease Do-like 10 [Arabidopsis thaliana]
Length=586

 Score =   320 bits (819),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP+ETA++KVLR G++ EFSI L PL+PLVPVHQFD+
Sbjct  372  ANDGTVPFRNRERITFDHLVSMKKPDETALVKVLREGKEHEFSITLRPLQPLVPVHQFDQ  431

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNTSPR LC RAL+ LP K G+QLVI+SQVL+D
Sbjct  432  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRTLCHRALKDLPKKAGQQLVIVSQVLMD  491

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDE-RVIVLNYDLAKV  192
            DINTGYERLAELQVNKVNGVEV NL+HL +L+E+ + E++R DLDDE RVIVLNY  AK+
Sbjct  492  DINTGYERLAELQVNKVNGVEVNNLRHLCQLIENCNTEKLRIDLDDESRVIVLNYQSAKI  551

Query  191  ATSRILKRHRIPYAMSSDLINDECAPALELACS  93
            ATS ILKRHRI  A+SSDL+ ++       +CS
Sbjct  552  ATSLILKRHRIASAISSDLLIEQNLETELASCS  584



>gb|KEH24728.1| DegP protease [Medicago truncatula]
Length=550

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 182/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKK NE AV++V+R+G++ E SI L P++PLVPVHQFDK
Sbjct  340  ANDGTVPFRNRERITFDHLVSMKKLNEKAVVRVMRDGQELELSITLQPIQPLVPVHQFDK  399

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYN SPRRLCERALR+LP K  +QLVILSQVL+D
Sbjct  400  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNASPRRLCERALRELPKKENQQLVILSQVLMD  459

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLA+LQV KVNG E++NL+HL +LVE+ +K+ + FDLDD RVIVLNY+ AK+A
Sbjct  460  DINAGYERLADLQVLKVNGTEIDNLEHLCQLVENCTKDSLHFDLDDNRVIVLNYETAKIA  519

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACSN  90
            TSRIL RHRIP +MS+DLI+ +    L+L  SN
Sbjct  520  TSRILTRHRIPSSMSADLIDAQ--NNLQLTSSN  550



>ref|XP_003534464.1| PREDICTED: protease Do-like 10, mitochondrial-like [Glycine max]
Length=528

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKK NE A++++LR+G++ E SI L P++PLVPVHQFDK
Sbjct  327  ANDGTVPFRNRERITFDHLVSMKKTNEKALVRILRDGQEQELSIILQPIQPLVPVHQFDK  386

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALR+LP K  +QLVILSQVL+D
Sbjct  387  LPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKANQQLVILSQVLMD  446

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVN  E++NL+HLR+LVE  + E +R DL+D+RVIVLNY  AK+A
Sbjct  447  DINAGYERLAELQVLKVNETEIDNLEHLRQLVESCNTEFLRLDLEDDRVIVLNYGTAKIA  506

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TSRILKRHRIP +MS DL++ E
Sbjct  507  TSRILKRHRIPSSMSVDLLDTE  528



>ref|XP_010435521.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   317 bits (813),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 180/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE+A++KVLR G++ EFSI L PL+PLVPVHQFD+
Sbjct  383  ANDGTVPFRNRERITFDHLVSMKKPNESALVKVLREGKEQEFSITLKPLQPLVPVHQFDQ  442

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNTSPR LC RAL+ LP K G+QLVI+SQVL+D
Sbjct  443  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRSLCVRALKDLPKKAGQQLVIVSQVLMD  502

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKV  192
            DINTGYERL ELQV KVNGVEV+NL+HL +L+E+ + E +R DL DDERVI LNY  AK+
Sbjct  503  DINTGYERLTELQVKKVNGVEVDNLRHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKI  562

Query  191  ATSRILKRHRIPYAMSSDLINDECAPALELACS  93
            ATS ILKRHRI  AMSSDL+ ++  P  ELA S
Sbjct  563  ATSLILKRHRIASAMSSDLLIEQ-NPVTELASS  594



>ref|XP_004489189.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cicer arietinum]
Length=550

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKK +E AV++VLR G++ E SI L P++PLVPVHQFDK
Sbjct  337  ANDGTVSFRNRERITFDHLVSMKKLDEKAVVRVLRGGQEIELSITLRPIQPLVPVHQFDK  396

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYN SPRRLCERALR+LP K  +QLVILSQVL+D
Sbjct  397  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNASPRRLCERALRELPKKENQQLVILSQVLMD  456

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLA+ QV KVNG E++NL+HL +LVE+ S E + FDLDD+RVIVLNY+ AK+A
Sbjct  457  DINAGYERLADFQVLKVNGTEIDNLEHLCQLVENCSTESLHFDLDDDRVIVLNYETAKIA  516

Query  188  TSRILKRHRIPYAMSSDL  135
            TSRILKRHRIP +MS+DL
Sbjct  517  TSRILKRHRIPSSMSTDL  534



>ref|XP_010673840.1| PREDICTED: protease Do-like 10, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERI FDHLVSMKK NE A LKVLR+G++ +FSI + PL+PLVPVHQFDK
Sbjct  379  ANDGTVPFRNRERIPFDHLVSMKKVNEKAELKVLRDGKEYDFSINVQPLQPLVPVHQFDK  438

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVFIPL+QPYLHEYGE+WYNTSPRRLCERALR++P K G+QLVILSQVL+D
Sbjct  439  LPSYYIFAGLVFIPLSQPYLHEYGEEWYNTSPRRLCERALREVPKKAGQQLVILSQVLMD  498

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERL+ELQV KVNGVE++NLKHL +LVED  ++ +R DLDD+RVIVL+Y  AK+A
Sbjct  499  DINAGYERLSELQVRKVNGVEIDNLKHLCQLVEDCKEKNLRIDLDDDRVIVLDYHKAKLA  558

Query  188  TSRILKRHRIPYAMSSDLINDECAPAL  108
            TSRIL RHRIP + SSDL++ E  P +
Sbjct  559  TSRILTRHRIPSSTSSDLVDSEEEPTV  585



>ref|XP_010440805.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Camelina 
sativa]
Length=567

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLR G++ EFSI L PL+PLVPVHQFD+
Sbjct  352  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLREGKEQEFSITLKPLQPLVPVHQFDQ  411

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNTSPR LC RAL+ LP K G+QLVI+SQVL+D
Sbjct  412  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRSLCVRALKDLPKKAGQQLVIVSQVLMD  471

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKV  192
            DINTGYERL ELQV KVNGVEV+NL+HL +L+E+ + E +R DL DDERVI LNY  AK+
Sbjct  472  DINTGYERLTELQVKKVNGVEVDNLRHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKI  531

Query  191  ATSRILKRHRIPYAMSSD-LINDECAPALELACS  93
            ATS ILKRHRI  AMSSD LI       L  +CS
Sbjct  532  ATSLILKRHRIASAMSSDLLIEQNLVTELASSCS  565



>ref|XP_010450457.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLR G++ EFSI L PL+PLVPVHQFD+
Sbjct  383  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLREGKEQEFSITLKPLQPLVPVHQFDQ  442

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNTSPR LC RAL+ LP K G+QLVI+SQVL+D
Sbjct  443  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRSLCMRALKDLPKKAGQQLVIVSQVLMD  502

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKV  192
            DINTGYERL ELQV KVNGVEV+NL+HL +L+E+ + E +R DL DDERVI LNY  AK+
Sbjct  503  DINTGYERLTELQVKKVNGVEVDNLRHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKI  562

Query  191  ATSRILKRHRIPYAMSSD-LINDECAPALELACS  93
            ATS ILKRHRI  AMSSD LI       L  +CS
Sbjct  563  ATSLILKRHRIASAMSSDLLIEQNLVTELASSCS  596



>ref|XP_010440803.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Camelina 
sativa]
Length=590

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLR G++ EFSI L PL+PLVPVHQFD+
Sbjct  375  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLREGKEQEFSITLKPLQPLVPVHQFDQ  434

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNTSPR LC RAL+ LP K G+QLVI+SQVL+D
Sbjct  435  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRSLCVRALKDLPKKAGQQLVIVSQVLMD  494

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKV  192
            DINTGYERL ELQV KVNGVEV+NL+HL +L+E+ + E +R DL DDERVI LNY  AK+
Sbjct  495  DINTGYERLTELQVKKVNGVEVDNLRHLCQLIENCNTENLRVDLEDDERVIFLNYQSAKI  554

Query  191  ATSRILKRHRIPYAMSSD-LINDECAPALELACS  93
            ATS ILKRHRI  AMSSD LI       L  +CS
Sbjct  555  ATSLILKRHRIASAMSSDLLIEQNLVTELASSCS  588



>ref|XP_006283411.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
 gb|EOA16309.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
Length=577

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 183/214 (86%), Gaps = 3/214 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFD+LVSMKKP+ETA++KVLR G++ EFSI L PL+PLVPVHQFD+
Sbjct  363  ANDGTVPFRNRERITFDYLVSMKKPDETALVKVLREGKEHEFSITLKPLQPLVPVHQFDQ  422

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNTSPR LC RAL+ LP K G+QLVI+SQVL+D
Sbjct  423  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRSLCMRALKDLPKKAGQQLVIVSQVLMD  482

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDL-DDERVIVLNYDLAKV  192
            DINTGYERLAELQV KVNGVEV+NL+HL +L+E+ + E +R DL DDERVI+LNY  AK+
Sbjct  483  DINTGYERLAELQVKKVNGVEVDNLRHLCQLIENCNTEELRLDLDDDERVIILNYQSAKI  542

Query  191  ATSRILKRHRIPYAMSSDLINDECAPALELA-CS  93
            ATS ILKRHRI  A+SSDL+ ++  P  ELA CS
Sbjct  543  ATSLILKRHRIASAISSDLLIEQ-NPVTELASCS  575



>ref|XP_006405960.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
 gb|ESQ47413.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
Length=578

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 181/214 (85%), Gaps = 2/214 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            AN+G VHFR +ERI FDHLVSMKKP+ETA++KVLR G++ EF I L PL+PLVPVHQFD+
Sbjct  364  ANEGTVHFRKKERINFDHLVSMKKPDETALVKVLREGKEHEFRITLKPLQPLVPVHQFDQ  423

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+ LTQPYLHEYGEDWYN SPRRLCERALR LP KPG++LVI+SQVL+D
Sbjct  424  LPSYYIFAGFVFVRLTQPYLHEYGEDWYNISPRRLCERALRDLPKKPGQELVIISQVLMD  483

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTGYERLAELQV KVNGVEV+NL+HL +L+E+ + E +R DLD+ RV+ L+Y  A+VA
Sbjct  484  DINTGYERLAELQVEKVNGVEVDNLRHLCQLIENCNTENLRIDLDEGRVLALHYHSARVA  543

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELA-CSN  90
            TS ILKRHRI  AMSSDL+ ++  P  ELA CS 
Sbjct  544  TSLILKRHRIASAMSSDLLMEQ-NPVTELASCST  576



>ref|XP_009139697.1| PREDICTED: protease Do-like 10, mitochondrial [Brassica rapa]
Length=573

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             NDG V  R +ERITFDH+VSMKKPNETA++KVLR G++ EF I L PL+PLVPVHQFD+
Sbjct  356  GNDGTVPLRKKERITFDHMVSMKKPNETALVKVLREGKEHEFCITLRPLQPLVPVHQFDQ  415

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNT PRRLCERALR LP K  +QLVI+SQVL+D
Sbjct  416  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTCPRRLCERALRDLPEKSNQQLVIISQVLMD  475

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTG+ERLAELQV KVNGVEV+NL+HL +L+E+   E ++ DLDD RV+ L Y  A++A
Sbjct  476  DINTGFERLAELQVKKVNGVEVDNLRHLCQLIENCDTENLKLDLDDGRVLALKYQDARLA  535

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACS  93
            TS ILKRHRI  AMSSDL+ ++   A ELA S
Sbjct  536  TSLILKRHRIASAMSSDLLIEQNNLATELAAS  567



>emb|CDY53528.1| BnaCnng25320D [Brassica napus]
Length=581

 Score =   309 bits (792),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             NDG V  R +ERITFDH+VSMKKPNETA++KVLR G++ EF I L PL+PLVPVHQFD+
Sbjct  364  GNDGTVPLRKKERITFDHMVSMKKPNETALVKVLREGKEHEFCITLRPLQPLVPVHQFDQ  423

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPYLHEYGEDWYNT PRRLCERALR LP K  +QLVI+SQVL+D
Sbjct  424  LPSYYIFAGFVFVPLTQPYLHEYGEDWYNTCPRRLCERALRDLPEKSNQQLVIISQVLMD  483

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTG+ERLAELQV KVNGVEV+NL+HL +L+E+   E ++ DLDD RV+ L Y  A++A
Sbjct  484  DINTGFERLAELQVKKVNGVEVDNLRHLCQLIENCDAENLKLDLDDGRVLALKYQDARLA  543

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACS  93
            TS ILKRHRI  AMSSDL+ ++   A ELA S
Sbjct  544  TSLILKRHRIASAMSSDLLIEQNNLATELAAS  575



>emb|CDX74606.1| BnaA04g07830D [Brassica napus]
Length=573

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             NDG V  R +ERITFDH+VSMKKPNETA++KVLR G++ EF I L PL+PLVPVHQFD+
Sbjct  356  GNDGTVPLRKKERITFDHMVSMKKPNETALVKVLREGKEHEFCITLRPLQPLVPVHQFDQ  415

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IF+G VF+PLTQPYLHEYGEDWYNT PRRLCERALR LP K  +QLVI+SQVL+D
Sbjct  416  LPSYYIFSGFVFVPLTQPYLHEYGEDWYNTCPRRLCERALRDLPEKSNQQLVIISQVLMD  475

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTG+ERLAELQV KVNGVEV+NL+HL +L+E+   E ++ DLDD RV+ L Y  A++A
Sbjct  476  DINTGFERLAELQVKKVNGVEVDNLRHLCQLIENCDTENLKLDLDDGRVLALKYQDARLA  535

Query  188  TSRILKRHRIPYAMSSDLINDECAPALELACS  93
            TS ILKRHRI  AMSSDL+ ++   A ELA S
Sbjct  536  TSLILKRHRIASAMSSDLLIEQNNLATELAAS  567



>ref|XP_006858734.1| hypothetical protein AMTR_s00066p00122890 [Amborella trichopoda]
 gb|ERN20201.1| hypothetical protein AMTR_s00066p00122890 [Amborella trichopoda]
Length=524

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITF+HLVSMKK NET+ ++VLR+G++ E S+ + PL  LVPVHQ+DK
Sbjct  312  ANDGTVPFRNRERITFEHLVSMKKANETSKIRVLRDGQELELSVVVHPLNALVPVHQYDK  371

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHE+GEDWYNTSPR LC+ + R++P K GEQLVILSQVL+D
Sbjct  372  LPSYYIFAGLVFVPLTQPYLHEFGEDWYNTSPRHLCDLSFRRMPKKVGEQLVILSQVLMD  431

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            +IN GYERL +LQV KVNGVE+ NLKHL +LVED  +E +R DLD ERV+ LNY+ AK+A
Sbjct  432  EINVGYERLEDLQVKKVNGVEINNLKHLCQLVEDCKEESLRLDLDKERVVALNYNKAKLA  491

Query  188  TSRILKRHRIPYAMSSDLINDE  123
            TS ILKRHRIP A S+DL++ E
Sbjct  492  TSHILKRHRIPSATSTDLLDSE  513



>ref|XP_002963416.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
 gb|EFJ35287.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
Length=472

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERI+F HLV+MK+  E+A L+VLR+G++  F++KL P+KPLVP HQF++
Sbjct  275  ANDGSVTFRNRERISFVHLVTMKREGESAALRVLRDGKEINFNVKLAPVKPLVPNHQFER  334

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLT PYLHEYG+DWYN SPRRLC+R   K+P KPGEQ VI+SQVL+D
Sbjct  335  LPSYYIFAGLVFVPLTLPYLHEYGDDWYNASPRRLCDRTFSKMPKKPGEQFVIMSQVLID  394

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV +VNG ++ NL+HLR+LVE   +  IRFDLDD RVIVL Y+ AK A
Sbjct  395  DINAGYERLAELQVKQVNGEKIVNLQHLRRLVEGCKEPYIRFDLDDGRVIVLKYESAKEA  454

Query  188  TSRILKRHRIPYAMSSDL  135
            + RIL+ HRI  A+S+DL
Sbjct  455  SLRILQNHRISSAVSTDL  472



>ref|XP_002971553.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
 gb|EFJ27302.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
Length=463

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERI+F HLV+MK+  E+A L+VLR+G++  F++KL P+KPLVP HQF++
Sbjct  265  ANDGSVTFRNRERISFVHLVTMKREGESAALRVLRDGKEINFNVKLAPVKPLVPNHQFER  324

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLT PYLHEYG+DWYN SPRRLC+R   K+P KPGEQ VI+SQVL+D
Sbjct  325  LPSYYIFAGLVFVPLTLPYLHEYGDDWYNASPRRLCDRTFSKMPKKPGEQFVIMSQVLID  384

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV +VNG ++ NL+HLR+LVE   +  IRFDLDD RVIVL Y+ AK A
Sbjct  385  DINAGYERLAELQVKQVNGEKIVNLQHLRRLVEGCKEPYIRFDLDDGRVIVLKYESAKEA  444

Query  188  TSRILKRHRIPYAMSSDLI  132
            + RIL+ HRI   +S+DL+
Sbjct  445  SLRILQNHRISSPVSTDLL  463



>ref|XP_010027524.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54066.1| hypothetical protein EUGRSUZ_I00047 [Eucalyptus grandis]
Length=541

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG   FR RERI FDH VSMKKPN+   +KV R  ++ EFSI L PL+PLVPVHQFDK
Sbjct  332  ANDGTTPFRKRERIAFDHWVSMKKPNDPVPIKVFREKKECEFSITLRPLQPLVPVHQFDK  391

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IFAGL+FIPLTQPYL EY  D Y+  PRRLCERAL +LP   G+++VI+S+VL  
Sbjct  392  HPSYYIFAGLIFIPLTQPYLDEYA-DRYSMWPRRLCERALEELPRNAGQEIVIISKVLTA  450

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYE LAELQV KVNG E+ENL HL +LVED + E IRFDLD+E VIV NY +AK A
Sbjct  451  DINAGYEHLAELQVRKVNGTEIENLSHLYRLVEDCTDESIRFDLDNEGVIVFNYPMAKTA  510

Query  188  TSRILKRHRIPYAMSSDLI  132
            T+ IL RHRIP   S+DLI
Sbjct  511  TTTILMRHRIPSTASADLI  529



>ref|NP_001142088.1| hypothetical protein [Zea mays]
 gb|ACF87611.1| unknown [Zea mays]
 gb|AFW78022.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=556

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 155/214 (72%), Gaps = 30/214 (14%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKP ETAVLKVLR+G++ E  + L P            
Sbjct  372  ANDGTVPFRNRERITFDHLVSMKKPEETAVLKVLRDGKEQELGVTLRP------------  419

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
                             PYLHE+GEDWYN SPRRLCERALR+LP K GEQLVILSQVL+D
Sbjct  420  -----------------PYLHEFGEDWYNASPRRLCERALRELPKKTGEQLVILSQVLMD  462

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYERLAELQV KVNGVEVENLKHL  LVE  ++E +RFDLDDERVIVL Y  A++A
Sbjct  463  DINVGYERLAELQVKKVNGVEVENLKHLCSLVEGCTEENLRFDLDDERVIVLKYQNARLA  522

Query  188  TSRILKRHRIPYAMSSDLINDECAPA-LELACSN  90
            TSR+LKRHRIP A+SSDL+ D+     +E +C++
Sbjct  523  TSRVLKRHRIPSAISSDLVEDQVTDGEVETSCTS  556



>ref|XP_008441958.1| PREDICTED: protease Do-like 10, mitochondrial [Cucumis melo]
Length=586

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE +V+K+LRNGE  E SI L PL+PLVPVHQFDK
Sbjct  451  ANDGTVSFRNRERITFDHLVSMKKPNEKSVIKILRNGEVCELSITLRPLQPLVPVHQFDK  510

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALR+LP KPGEQ VILSQVL+D
Sbjct  511  LPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKPGEQFVILSQVLMD  570

Query  368  DINTGYERLAELQVNK  321
            DIN GYERLAELQV K
Sbjct  571  DINAGYERLAELQVKK  586



>ref|XP_007028415.1| DegP protease 10 isoform 2 [Theobroma cacao]
 gb|EOY08917.1| DegP protease 10 isoform 2 [Theobroma cacao]
Length=537

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETAV+KVLRNGE+  F+I L PL+PLVPVHQFDK
Sbjct  394  ANDGTVPFRNRERITFDHLVSMKKPNETAVVKVLRNGEEHAFTITLRPLQPLVPVHQFDK  453

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  454  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKQAGEQLVILSQVLMD  513

Query  368  DINTGYERLAELQ  330
            DIN GYERLAELQ
Sbjct  514  DINAGYERLAELQ  526



>gb|KJB49011.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=487

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA++KVLRNG++  F+I L PL+PLVPVHQFDK
Sbjct  341  ANDGTVPFRNRERITFDHLVSMKKPNETALVKVLRNGQEHAFTITLQPLQPLVPVHQFDK  400

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQVL+D
Sbjct  401  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQVLMD  460

Query  368  DINTGYERLAELQV  327
            DIN GYERLAELQV
Sbjct  461  DINAGYERLAELQV  474



>ref|XP_002951860.1| trypsin family [Volvox carteri f. nagariensis]
 gb|EFJ46965.1| trypsin family [Volvox carteri f. nagariensis]
Length=571

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG VH R RERI F +L+++K    TA +KVLR+GE   + + + P   LVPVH +D+
Sbjct  373  ANDGTVHLRQRERIYFSYLITLKPTGATAKIKVLRDGEVLSYDLTVTPNDLLVPVHCYDR  432

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS+F++AGLVF+PLTQPYLHEYGEDW NT+PRRL ++AL  +  KP +Q+VILSQVL+D
Sbjct  433  LPSYFMYAGLVFVPLTQPYLHEYGEDWMNTAPRRLYDKALHGMMQKPHQQIVILSQVLVD  492

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            D+NTGY++   LQV +VNG EV NL HL++LVE  ++  +RF+L+DER++V++  LA  A
Sbjct  493  DVNTGYQQFQSLQVLRVNGTEVLNLTHLKELVEGAAERFVRFELEDERIMVVDRSLALNA  552

Query  188  TSRILKRHRIPYAMSSDLI  132
             +RI++R+R+P ++S D++
Sbjct  553  NNRIMERYRVPSSVSVDIV  571



>gb|KCW54069.1| hypothetical protein EUGRSUZ_I00050 [Eucalyptus grandis]
Length=517

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RER+ FDHL SMKKPNE A++KVLR   + + +I L PL+PLVPVHQFDK
Sbjct  316  ANDGTVTFRHRERVNFDHLASMKKPNEVALIKVLRKEIECKVNITLRPLQPLVPVHQFDK  375

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS+FIF GL+F  LTQPYLHEY  D Y+  PRRL + AL +LP   G+++VI+S VL+D
Sbjct  376  HPSYFIFGGLIFTSLTQPYLHEYA-DRYSMLPRRLWQLALEELPRNAGQEIVIISMVLMD  434

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DI  GY  LA LQV KVN +E++NL+HL +LVE  +   IRFDLD+ERVIVL Y  AK A
Sbjct  435  DITEGYGNLAALQVRKVNEIEIQNLRHLYELVEHCTAPSIRFDLDEERVIVLKYSEAKTA  494

Query  188  TSRILKRHRIPYAMSSDLI  132
            TS I  R+ IP   S+DLI
Sbjct  495  TSTIRARYNIPSIASADLI  513



>ref|XP_010027526.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Eucalyptus 
grandis]
 gb|KCW54070.1| hypothetical protein EUGRSUZ_I00050 [Eucalyptus grandis]
Length=534

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RER+ FDHL SMKKPNE A++KVLR   + + +I L PL+PLVPVHQFDK
Sbjct  333  ANDGTVTFRHRERVNFDHLASMKKPNEVALIKVLRKEIECKVNITLRPLQPLVPVHQFDK  392

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS+FIF GL+F  LTQPYLHEY  D Y+  PRRL + AL +LP   G+++VI+S VL+D
Sbjct  393  HPSYFIFGGLIFTSLTQPYLHEYA-DRYSMLPRRLWQLALEELPRNAGQEIVIISMVLMD  451

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DI  GY  LA LQV KVN +E++NL+HL +LVE  +   IRFDLD+ERVIVL Y  AK A
Sbjct  452  DITEGYGNLAALQVRKVNEIEIQNLRHLYELVEHCTAPSIRFDLDEERVIVLKYSEAKTA  511

Query  188  TSRILKRHRIPYAMSSDLI  132
            TS I  R+ IP   S+DLI
Sbjct  512  TSTIRARYNIPSIASADLI  530



>ref|XP_010027525.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Eucalyptus 
grandis]
Length=554

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 142/199 (71%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RER+ FDHL SMKKPNE A++KVLR   + + +I L PL+PLVPV QFDK
Sbjct  333  ANDGTVTFRHRERVNFDHLASMKKPNEVALIKVLRKEIECKVNITLRPLQPLVPVRQFDK  392

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IF GLVF PLTQ YL EY  D Y   PRRLC+ A  +LP   G+++VI+S VL D
Sbjct  393  HPSYYIFGGLVFTPLTQSYLREYA-DRYRMWPRRLCQLAREELPRNAGQEIVIISMVLRD  451

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            D+N GYE LAELQV KVN +E++NL HL +LVE  +   IRFDLD ERVIV  Y  AK A
Sbjct  452  DVNAGYEHLAELQVRKVNEIEIQNLSHLYRLVEHCTALSIRFDLDKERVIVFKYSEAKTA  511

Query  188  TSRILKRHRIPYAMSSDLI  132
            TS IL  + IP   S+DLI
Sbjct  512  TSTILTHYNIPSIASADLI  530



>gb|KIZ03685.1| hypothetical protein MNEG_4270 [Monoraphidium neglectum]
Length=347

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG VHFR+RERI F  L++ K    TA L VLR+G+  EF + L PL+ LVP+ ++D+
Sbjct  38   ANDGTVHFRSRERIFFTALITQKPTGSTARLSVLRDGQLDEFDVPLQPLQTLVPICKYDE  97

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            +PSF ++AGLVF+PL+QPYLHE+GEDW   SPRRL E+AL  L  +P +Q+VILSQVL+D
Sbjct  98   VPSFLMYAGLVFVPLSQPYLHEFGEDWIANSPRRLVEKALNGLMQRPEQQIVILSQVLVD  157

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            D+NTG++    LQV +VNG EV NL+HLR L+       +R DL+D+R+IVL+   A  +
Sbjct  158  DVNTGFQGFQNLQVLRVNGEEVLNLRHLRALLAGCDAPYVRLDLEDDRIIVLDRAAADAS  217

Query  188  TSRILKRHRIPYAMSSDL  135
            T RI +R+R+P+  S+DL
Sbjct  218  TLRIQQRYRVPFLESADL  235



>ref|XP_002888435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64694.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=528

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 141/198 (71%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR +ERI F+H VSMKK NET +LKVLR G++ +F I L P+ PLVPVHQ+DK
Sbjct  332  GNDAKVAFRNKERINFNHFVSMKKLNETVLLKVLREGKEHDFHISLKPVPPLVPVHQYDK  391

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPY+              +C  A + +P K GEQLVI+SQVL D
Sbjct  392  LPSYYIFAGFVFVPLTQPYI----------DSTLICNCANKNMPEKAGEQLVIISQVLAD  441

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY    +L+V KVNGV+VENLKHL +LVE    E +R DL++E+V+VLNY+ AK A
Sbjct  442  DINAGYTDFNDLKVIKVNGVQVENLKHLSELVEKCCTEDLRLDLENEKVVVLNYENAKEA  501

Query  188  TSRILKRHRIPYAMSSDL  135
            TS ILK HRIP A S DL
Sbjct  502  TSLILKLHRIPSANSKDL  519



>ref|XP_010027559.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
Length=533

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERI FDHL SMKKPN   ++KVLR   +  F I L PL+PLVPVHQFDK
Sbjct  333  ANDGTVTFRHRERIDFDHLASMKKPNGKTLIKVLRKERECIFDITLRPLQPLVPVHQFDK  392

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQ-LVILSQVLL  372
             PS++IF GL+F  LTQPYLHEY  D Y+  PRRLC+ A R   +K  +Q +VI+S VL+
Sbjct  393  HPSYYIFGGLIFTSLTQPYLHEYA-DRYSVWPRRLCQLAQRT--SKNADQEIVIISMVLM  449

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            DDI  GY  LA LQV KVN ++++NL+HL + +E  +   IRFDLD+ERVIV  Y  AK+
Sbjct  450  DDITEGYGNLAALQVRKVNEIDIQNLRHLYEFLEHCTATSIRFDLDEERVIVFKYREAKI  509

Query  191  ATSRILKRHRIPYAMSSDLI  132
            ATS IL R+ IP   S+DLI
Sbjct  510  ATSTILTRYNIPSIASADLI  529



>ref|XP_010030295.1| PREDICTED: uncharacterized protein LOC104420090 [Eucalyptus grandis]
Length=844

 Score =   226 bits (577),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 113/193 (59%), Positives = 138/193 (72%), Gaps = 1/193 (1%)
 Frame = -1

Query  707  FRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLPSFFIF  528
            F  RERI FD L SMKKPNE A++KVLR   + +F+I L PL+PLVPV QFDK PS++IF
Sbjct  636  FWHRERIDFDQLASMKKPNEVALIKVLRKERECKFNITLRPLQPLVPVRQFDKRPSYYIF  695

Query  527  AGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYE  348
             GL+F PLTQPYL EY  DW +  PRRL + A  +LP   G+++VI+S VL DD+N GYE
Sbjct  696  GGLIFTPLTQPYLDEYA-DWDSMWPRRLWQLAPEELPRNAGQEIVIISMVLRDDVNAGYE  754

Query  347  RLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKR  168
             LAELQV KVN +E++NL+HL  LVE  +   IRFDLD ERVIV  Y  AK ATS IL  
Sbjct  755  HLAELQVRKVNEIEIQNLRHLYGLVEHCTAPSIRFDLDKERVIVFKYSEAKTATSTILTH  814

Query  167  HRIPYAMSSDLIN  129
            + IP   S+DLI+
Sbjct  815  YNIPSIASADLID  827



>ref|XP_002499997.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61255.1| predicted protein, partial [Micromonas sp. RCC299]
Length=476

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 145/203 (71%), Gaps = 4/203 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ER+ FD+L+S+K+P ET   K+ R  E    S  + P  PLVPVHQ+D+
Sbjct  274  ANDGTVSFRGWERVAFDYLISLKRPGETVEAKIRRKTEAFTASFAVKPRAPLVPVHQYDR  333

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++++AGLVF PLTQP+L E+G+DW+NT+PRRL +RAL   PT PG+++VILSQVL D
Sbjct  334  LPSYYVYAGLVFSPLTQPHLQEFGDDWFNTAPRRLVDRALNDHPTSPGQEVVILSQVLAD  393

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKER----IRFDLDDERVIVLNYDL  201
            ++N GY+ + +L+V  VNG EV++L+ L+  VE  +  +    +R D  ++RV+V++ + 
Sbjct  394  EVNAGYQGMHDLEVRAVNGREVKSLRELKAEVEKGTGAKGGKFLRLDFVNDRVLVISREE  453

Query  200  AKVATSRILKRHRIPYAMSSDLI  132
            A+ A  RI+ +HR+P  MS DL+
Sbjct  454  AERAHGRIMAKHRVPSRMSPDLV  476



>ref|XP_002886956.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63215.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 139/198 (70%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR +ERITF HLVSMKKP E A+LKVLR G++ EFSI L P+  LVP+HQFDK
Sbjct  346  GNDSTVPFRNKERITFKHLVSMKKPCERALLKVLREGKEYEFSISLKPVPRLVPMHQFDK  405

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IF GLVF+PLT+PY+ +     Y          AL K+P K GEQ+VI+SQ+L D
Sbjct  406  PPSYYIFGGLVFVPLTKPYIDDASISKY----------ALEKMPKKAGEQIVIISQILED  455

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTGY    +LQV KVNGV+V NLKHL  L+E+   E++  DL+ + +I L+Y  AK A
Sbjct  456  DINTGYNIFEDLQVKKVNGVQVHNLKHLYNLIEECCTEKLLMDLEQDNIIALDYKSAKKA  515

Query  188  TSRILKRHRIPYAMSSDL  135
            TS+ILK+  IP AMS DL
Sbjct  516  TSKILKKLEIPSAMSKDL  533



>gb|KCW54108.1| hypothetical protein EUGRSUZ_I00089 [Eucalyptus grandis]
Length=195

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 129/179 (72%), Gaps = 1/179 (1%)
 Frame = -1

Query  665  MKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH  486
            MKKPNE A++KVLR   + +F+I L PL+PLVPV QFDK PS++IF GL+F PLTQPYL 
Sbjct  1    MKKPNEVALIKVLRKERECKFNITLRPLQPLVPVRQFDKRPSYYIFGGLIFTPLTQPYLD  60

Query  485  EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVE  306
            EY  DW +  PRRL + A  +LP   G+++VI+S VL DD+N GYE LAELQV KVN +E
Sbjct  61   EYA-DWDSMWPRRLWQLAPEELPRNAGQEIVIISMVLRDDVNAGYEHLAELQVRKVNEIE  119

Query  305  VENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  129
            ++NL+HL  LVE  +   IRFDLD ERVIV  Y  AK ATS IL  + IP   S+DLI+
Sbjct  120  IQNLRHLYGLVEHCTAPSIRFDLDKERVIVFKYSEAKTATSTILTHYNIPSIASADLID  178



>ref|XP_007028416.1| DegP protease 10 isoform 3 [Theobroma cacao]
 gb|EOY08918.1| DegP protease 10 isoform 3 [Theobroma cacao]
Length=514

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETAV+KVLRNGE+  F+I L PL+PLVPVHQFDK
Sbjct  394  ANDGTVPFRNRERITFDHLVSMKKPNETAVVKVLRNGEEHAFTITLRPLQPLVPVHQFDK  453

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQ   D
Sbjct  454  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKQAGEQLVILSQSGFD  513

Query  368  D  366
             
Sbjct  514  G  514



>ref|XP_002886957.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63216.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (70%), Gaps = 9/197 (5%)
 Frame = -1

Query  725  NDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKL  546
            ND  V FR +ERI F HLVSMKKP E   LKVLR G+K EF+I + P++ L+PV+ FDKL
Sbjct  307  NDETVIFRKKERINFSHLVSMKKPGEKTSLKVLREGKKHEFNINITPVESLLPVYHFDKL  366

Query  545  PSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDD  366
            PS++IFAG VF+PLT+PYL              +C+ AL  +P KPGEQ+VI+SQVL  D
Sbjct  367  PSYYIFAGFVFLPLTKPYLD---------CSYSMCDCALTHMPKKPGEQIVIISQVLEAD  417

Query  365  INTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVAT  186
            ++ GY  L +LQV +VNGV+VENLKHL +L+E    E +R DL+    I LN + AK AT
Sbjct  418  VSVGYANLTDLQVKRVNGVQVENLKHLCQLIEGCCTEDLRLDLEGAFAITLNQNYAKKAT  477

Query  185  SRILKRHRIPYAMSSDL  135
            ++ILKR+ IP AMS DL
Sbjct  478  AKILKRYGIPSAMSKDL  494



>ref|XP_004344572.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
 gb|ELR20829.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
Length=561

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 145/222 (65%), Gaps = 22/222 (10%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERI FD++ SMK+  E   L++LRNGEK E S++L P++PLVP+H+FD+
Sbjct  332  ANDGTVAFRKRERIFFDYVTSMKQVGEYCRLEILRNGEKQEVSVQLSPVQPLVPIHRFDQ  391

Query  548  LPSFFIFAGLVFIPLTQPYLHE-------YGEDWYNTSPRRLCERALRKLPTKPGEQLVI  390
             PSFFI  GLVF PLTQPYL E       YGEDWYN+SPR+LC +AL +   +P +++VI
Sbjct  392  RPSFFIHGGLVFTPLTQPYLQEGSHFYFQYGEDWYNSSPRKLCMKALTEYMEEPDQEVVI  451

Query  389  LSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDE------  228
            LS VL+ +IN GY+++  LQ+ + N  +++NLK L KLV  N +  +RFD D+       
Sbjct  452  LSAVLVHEINYGYQQMTNLQLLRFNDQKIKNLKQLAKLVAANKQPYLRFDFDEHVRATCN  511

Query  227  ---------RVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  129
                     RVI+L  D AK A   IL RHRIP   S DL +
Sbjct  512  TPALRHVTGRVIILEADAAKQAEEAILTRHRIPSPHSPDLFD  553



>ref|NP_564856.1| putativeDegP protease 3 [Arabidopsis thaliana]
 sp|Q9SHZ1.1|DEGP3_ARATH RecName: Full=Putative protease Do-like 3, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF23847.1|AC007234_19 F1E22.1 [Arabidopsis thaliana]
 gb|AEE34405.1| putativeDegP protease 3 [Arabidopsis thaliana]
Length=559

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 137/198 (69%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  VHFR +ERITF HLVSMKKP ETA+LKVLR G++ EF+  L  + PLVP  Q+DK
Sbjct  354  GNDSSVHFRKKERITFKHLVSMKKPCETALLKVLREGKEYEFNSSLKSVPPLVPKRQYDK  413

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
              S++IF GLVF+PLT+PY+              + E AL K+P K GEQ+VI+SQ+L D
Sbjct  414  SASYYIFGGLVFLPLTKPYIDS----------SCVSESALGKMPKKAGEQVVIISQILED  463

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DINTGY    + QV KVNGV+V NLKHL KLVE+   E +R DL+ ++VI L+Y  AK  
Sbjct  464  DINTGYSIFEDFQVKKVNGVQVHNLKHLYKLVEECCTETVRMDLEKDKVITLDYKSAKKV  523

Query  188  TSRILKRHRIPYAMSSDL  135
            TS+ILK  +IP A+S DL
Sbjct  524  TSKILKSLKIPSAVSEDL  541



>gb|KFK41004.1| hypothetical protein AALP_AA2G073000 [Arabis alpina]
Length=444

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 141/198 (71%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR +ERI ++HLVSMKKP ET +LKVLR G++ +F+I + P++PL+PV+ +DK
Sbjct  249  GNDETVKFRKKERINYNHLVSMKKPAETTLLKVLREGKQHKFNINIKPVEPLIPVYLYDK  308

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++I AG VF+PLT+PY+        + +P  +C+  L  +P K GEQ+V++SQVL D
Sbjct  309  LPSYYILAGFVFVPLTKPYM--------DCAP--ICDCVLENMPKKAGEQIVVISQVLED  358

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY    +LQV KVNGV+VENLKHL +L+E    E +R DL+ E VI+L +  AK A
Sbjct  359  DINVGYSSFEDLQVKKVNGVQVENLKHLFQLIEGCCTEDLRLDLEKENVIILKHKAAKKA  418

Query  188  TSRILKRHRIPYAMSSDL  135
            TS+ILK + IP A S DL
Sbjct  419  TSKILKCYGIPSARSKDL  436



>ref|XP_008776775.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Phoenix 
dactylifera]
Length=471

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNETA ++VLR+G + EF I L PL+PLVPVHQFD 
Sbjct  355  ANDGTVPFRNRERITFDHLVSMKKPNETAHVRVLRDGTEHEFCISLLPLQPLVPVHQFDT  414

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQV  378
            LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP + GEQLVILSQV
Sbjct  415  LPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPKRAGEQLVILSQV  471



>gb|KDO77071.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=490

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERITFDHLVSMKKPNE ++++VLR+G++ EFSI L  L+PLVPVHQFDK
Sbjct  373  ANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDK  432

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQV  378
            LPS++IFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALR+LP K GEQLVILSQV
Sbjct  433  LPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQV  489



>ref|XP_010513422.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=502

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 140/199 (70%), Gaps = 11/199 (6%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR +ERI ++HLVSMKKP ET  L VLR G+K EF+I + P++ L+PV+QFDK
Sbjct  312  GNDETVVFRKKERINYNHLVSMKKPGETTSLIVLREGKKHEFNINITPVESLIPVYQFDK  371

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++I+AG VF+PLT+PY+              + +  L  +P KPGEQ+V++SQVL  
Sbjct  372  LPSYYIYAGFVFLPLTKPYM----------DCSYMSDCLLNHMPKKPGEQIVVISQVLEA  421

Query  368  DINTGYER-LAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            DIN GY   L +L+V +VNGV+VENLKHLRKL+E+ S + +R DL+ +  I LN + AK 
Sbjct  422  DINVGYGADLTDLKVKRVNGVQVENLKHLRKLIEECSTKDLRLDLEGDFAITLNQNDAKN  481

Query  191  ATSRILKRHRIPYAMSSDL  135
             TS+ILKR+ IP AMS DL
Sbjct  482  VTSKILKRYGIPSAMSKDL  500



>ref|XP_009140719.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=634

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 142/198 (72%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F  ++ + F HLVSMKKP+ETA++KVLR G++ EF++ L P++PLVP+H FDK
Sbjct  427  GNDSKVPFLNQDTVDFKHLVSMKKPSETALIKVLREGKECEFNVGLKPVQPLVPLHNFDK  486

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            + S++I+ G +F+PL+QPY+   G D        +CE + +K+P K  EQ+VI+SQ+L D
Sbjct  487  IRSYYIYGGFLFVPLSQPYID--GSD--------MCECSSKKMPKKASEQIVIISQILED  536

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY    +LQV KVNG+EV+NLKHL +++E+ S   +R DL++E+V++LN  LA+ A
Sbjct  537  DINAGYASFEDLQVKKVNGIEVDNLKHLCQVIEECSTGFLRLDLENEKVLILNNKLARKA  596

Query  188  TSRILKRHRIPYAMSSDL  135
             S ILK  +IP AMS DL
Sbjct  597  NSTILKELKIPSAMSDDL  614



>ref|XP_010511113.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=562

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 139/198 (70%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V  R +ERI+F HLVSMKK ++TA+ KVLR G++ EF+I L P++PLVPV+ FDK
Sbjct  355  GNDSRVPLRKQERISFKHLVSMKKSSDTALFKVLREGKEHEFNISLKPVQPLVPVNHFDK  414

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IF GLVF+PLTQPY+              + E AL K+PTK  EQ+VI+SQ+L D
Sbjct  415  PPSYYIFGGLVFVPLTQPYIDS----------SYVSECALEKMPTKASEQIVIISQILED  464

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN+G +   +LQV KVNGV+V+NLKHL  L+E+ S E +RFDL+ ++   L+Y  AK A
Sbjct  465  DINSGLDIFEDLQVKKVNGVQVDNLKHLFHLIENCSTEYLRFDLEKDKFFGLHYKSAKKA  524

Query  188  TSRILKRHRIPYAMSSDL  135
            T +ILK  +I  AMS DL
Sbjct  525  TPKILKSLKILSAMSEDL  542



>ref|XP_006391530.1| hypothetical protein EUTSA_v10019569mg, partial [Eutrema salsugineum]
 gb|ESQ28816.1| hypothetical protein EUTSA_v10019569mg, partial [Eutrema salsugineum]
Length=316

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 135/198 (68%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  VHFR +E ITF HLVSMKKP ETA++KVLR G++ EF+I + P++PLVP   FDK
Sbjct  112  GNDSKVHFRKQETITFKHLVSMKKPCETALVKVLREGKEHEFNISVKPVQPLVPTQHFDK  171

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
              S+ I+ G+V + LT+PY+              + E  L K+P K  EQ+VI+SQ+L D
Sbjct  172  HRSYCIYGGVVLVALTKPYI----------DSSYISESFLGKMPKKAVEQIVIISQILED  221

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN  YE   +LQV KVNGVEV+NLKHL +L+E+     +R DL++E+V+VLN   A+ A
Sbjct  222  DINADYEGFEDLQVKKVNGVEVDNLKHLCQLIEECCTRFLRLDLENEKVLVLNNKSAEKA  281

Query  188  TSRILKRHRIPYAMSSDL  135
            TSRILK  +IP AMS DL
Sbjct  282  TSRILKDLKIPSAMSEDL  299



>sp|Q9SHZ0.1|DEGP4_ARATH RecName: Full=Protease Do-like 4, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF23846.1|AC007234_18 F1E22.2 [Arabidopsis thaliana]
Length=518

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 133/197 (68%), Gaps = 15/197 (8%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR +ERI F+H VSMKK +ET +L+VLR+G++ EF I + P+ PLVP HQ+DK
Sbjct  332  GNDAKVTFRNKERINFNHFVSMKKLDETVLLQVLRDGKEHEFHIMVKPVPPLVPGHQYDK  391

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IFAG VF+PLTQPY+              +C  A++ +P K GEQL     VL D
Sbjct  392  LPSYYIFAGFVFVPLTQPYI----------DSTLICNCAIKYMPEKAGEQL-----VLAD  436

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY     L+V KVNGV+VENLKHL +LVE    E +R DL++E+V+VLNY  AK A
Sbjct  437  DINAGYTDFKNLKVIKVNGVQVENLKHLTELVETCWTEDLRLDLENEKVVVLNYANAKEA  496

Query  188  TSRILKRHRIPYAMSSD  138
            TS IL+ HRIP A   D
Sbjct  497  TSLILELHRIPSANEYD  513



>ref|XP_002888434.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64693.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 134/188 (71%), Gaps = 10/188 (5%)
 Frame = -1

Query  698  RERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLPSFFIFAGL  519
            ++R++F HLVSMKKP +TA  KVLR G++ EF+I L P++PLVPV+Q+D  PS++I+ GL
Sbjct  358  QDRVSFKHLVSMKKPCDTASFKVLREGKEHEFNISLKPVQPLVPVNQYDMPPSYYIYGGL  417

Query  518  VFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLA  339
            VF+PLTQPY+              +CE  ++K+PTK GEQ+VI+SQ+L DDI +G     
Sbjct  418  VFVPLTQPYIDR----------SYICECCVKKMPTKAGEQIVIISQILEDDITSGLSIFE  467

Query  338  ELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRI  159
            +LQV K+NGVEV+NLKHL +L+E+ S E +RFDL+D     L +  AK AT +ILK  +I
Sbjct  468  DLQVKKLNGVEVDNLKHLCQLIEECSNEYLRFDLEDNNFFFLEHKSAKKATCKILKSLKI  527

Query  158  PYAMSSDL  135
            P AMS DL
Sbjct  528  PSAMSEDL  535



>ref|XP_006391532.1| hypothetical protein EUTSA_v10019834mg [Eutrema salsugineum]
 gb|ESQ28818.1| hypothetical protein EUTSA_v10019834mg [Eutrema salsugineum]
Length=595

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 135/198 (68%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  VHFR +E ITF HLVSMKKP ETA++KVLR G++ EF+I + P++PLVP   FDK
Sbjct  391  GNDSKVHFRKQETITFKHLVSMKKPCETALVKVLREGKEHEFNISVKPVQPLVPTQHFDK  450

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
              S+ I+ G+V + LT+PY+              + E  L K+P K  EQ+VI+SQ+L D
Sbjct  451  HRSYCIYGGVVLVALTKPYI----------DSSYISESFLGKMPKKAVEQIVIISQILED  500

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN  YE   +LQV KVNGVEV+NLKHL +L+E+     +R DL++E+V+VLN   A+ A
Sbjct  501  DINADYEGFEDLQVKKVNGVEVDNLKHLCQLIEECCTRFLRLDLENEKVLVLNNKSAEKA  560

Query  188  TSRILKRHRIPYAMSSDL  135
            TSRILK  +IP AMS DL
Sbjct  561  TSRILKDLKIPSAMSEDL  578



>ref|XP_006301507.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
 gb|EOA34405.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
Length=566

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 140/198 (71%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR +ER++F HLVSMKK  +TA+ KVLR G++ EF+I L P++PLVPV+ F+K
Sbjct  361  GNDSTVPFRKQERVSFKHLVSMKKSCDTALFKVLREGKEHEFNISLKPVQPLVPVNLFEK  420

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++I+ GLVF+PLTQPY+    ++ Y      + E AL K+P K  EQ+VI+SQ+L D
Sbjct  421  PPSYYIYGGLVFVPLTQPYI----DNSY------VSECALEKMPRKADEQIVIISQILED  470

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DI +G   + +LQV KVNGV+V+NLKHL  L+E+   E ++F+L+ +    LN+  AK A
Sbjct  471  DITSGLSMVEDLQVKKVNGVQVDNLKHLFHLIEECCTEYLKFELEKDMFFALNHKSAKKA  530

Query  188  TSRILKRHRIPYAMSSDL  135
            TS+ILK  +IP AMS DL
Sbjct  531  TSKILKNLKIPSAMSDDL  548



>ref|XP_003055699.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60951.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=492

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 132/198 (67%), Gaps = 6/198 (3%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ER+ FDHLVS+K+  E   +KVL         +   P  PLVPVHQ+D+
Sbjct  301  ANDGSVSFRGWERVAFDHLVSLKRAGENIRMKVL------TVDVVATPRAPLVPVHQYDR  354

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LP++F+FAGLVF PLTQP+LHE+G+DWY+ +PRRLC+RA+      P EQ+VILS VL D
Sbjct  355  LPTYFVFAGLVFCPLTQPHLHEWGDDWYDKAPRRLCDRAMHSHMKVPDEQVVILSHVLAD  414

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            +IN GY+   +L+V++V G +V+N++ L   ++ +  E +R D     V+V+N    + A
Sbjct  415  EINVGYQGKHDLEVSRVCGAKVKNMRELAAALDAHDGEFVRVDFVGGDVVVVNAKEGRAA  474

Query  188  TSRILKRHRIPYAMSSDL  135
              RIL +HR+P  MS DL
Sbjct  475  GERILAKHRVPARMSPDL  492



>ref|XP_010418975.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=572

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 136/198 (69%), Gaps = 10/198 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V  R +ERI+F HLVSMKK ++TA++KVLR G++ EF+I L P++PLVPV+ FDK
Sbjct  365  GNDSRVPLRKQERISFKHLVSMKKSSDTALIKVLREGKEYEFNISLKPVQPLVPVNHFDK  424

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IF GLVF+PL+Q Y+              + E AL K+PTK  EQ+VI+SQ+L D
Sbjct  425  PPSYYIFGGLVFVPLSQAYVDS----------SYVSECALEKMPTKADEQIVIISQILED  474

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DI +G     +LQV KVNGV+V+NLKHL  L+E+   E +RFDL+ ++   L+Y  AK A
Sbjct  475  DITSGLGIFEDLQVKKVNGVQVDNLKHLFNLIENCCTEYLRFDLEKDKFFGLHYKSAKEA  534

Query  188  TSRILKRHRIPYAMSSDL  135
            T +ILK  +I  A+S DL
Sbjct  535  TPKILKNLKILSAVSEDL  552



>emb|CDY35320.1| BnaA04g15270D [Brassica napus]
Length=540

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 133/198 (67%), Gaps = 23/198 (12%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F  ++ + F HLVSMKKP+ETA++KVLR G++ EF++ L P+KPLVP+H FDK
Sbjct  346  GNDSKVPFLNQDTVDFKHLVSMKKPSETALIKVLREGKECEFNVGLKPVKPLVPLHNFDK  405

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            + S++++ G +F+PL+QPY+   G D                      EQ+VI+SQ+L D
Sbjct  406  MRSYYVYGGFLFVPLSQPYID--GSDI---------------------EQIVIISQILED  442

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY    +LQV KVNG+EV+NLKHL +++E+ S   +R DL++E+V++LN  LA+ A
Sbjct  443  DINAGYASFEDLQVKKVNGIEVDNLKHLCQVIEECSTGFLRLDLENEKVLILNNKLARKA  502

Query  188  TSRILKRHRIPYAMSSDL  135
             S ILK  +IP AMS DL
Sbjct  503  NSTILKELKIPSAMSDDL  520



>ref|XP_002866059.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42318.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=517

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 132/198 (67%), Gaps = 12/198 (6%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  + FR +ERI F+HLV++KK  ET +LKVLR G++ EF+I +   +PLVP      
Sbjct  315  GNDETIPFRKKERINFEHLVTIKKSGETVLLKVLRKGKEHEFNIIVRHDQPLVPDRH---  371

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++I AG VF+PLT+PY+         +   ++CE +  +   K GEQ+VI+SQVLL+
Sbjct  372  LPSYYILAGFVFVPLTKPYI---------SKSCKICECSSNRKAKKAGEQIVIISQVLLN  422

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DI TGY    +LQV  VNGVEV NL+HL +L+E   +E +R DL++ RVI LNY  AK A
Sbjct  423  DITTGYRDFKDLQVKNVNGVEVLNLRHLSELIEKCCEEDLRLDLENGRVISLNYTSAKEA  482

Query  188  TSRILKRHRIPYAMSSDL  135
            TS IL+ H IP AMS DL
Sbjct  483  TSWILEHHGIPSAMSKDL  500



>ref|XP_006391531.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
 gb|ESQ28817.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
Length=489

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 124/198 (63%), Gaps = 16/198 (8%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR  ERI F HLVSMKKP ET  L+VLR G + +       L+PL+P++QFDK
Sbjct  299  GNDETVSFRKAERINFSHLVSMKKPGETISLEVLREGIQHK-------LEPLIPMYQFDK  351

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IF G VF+PLTQPY+          S RR      R +P K GEQ+VI+SQVL D
Sbjct  352  LPSYYIFGGFVFVPLTQPYID-------CCSARR--SSVFRNMPKKAGEQIVIISQVLED  402

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            +   GY      QV +VNGV VENLKHLR+L+E+   E +R DL+ +  I+ +    K  
Sbjct  403  ETTVGYTIFENSQVKQVNGVPVENLKHLRQLLEECCTEYLRLDLEKDNTIIASSKSTKKV  462

Query  188  TSRILKRHRIPYAMSSDL  135
            T +ILKR+ IP AMS DL
Sbjct  463  TGKILKRYGIPNAMSKDL  480



>gb|KCW54067.1| hypothetical protein EUGRSUZ_I00047 [Eucalyptus grandis]
Length=464

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG   FR RERI FDH VSMKKPN+   +KV R  ++ EFSI L PL+PLVPVHQFDK
Sbjct  332  ANDGTTPFRKRERIAFDHWVSMKKPNDPVPIKVFREKKECEFSITLRPLQPLVPVHQFDK  391

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IFAGL+FIPLTQPYL EY  D Y+  PRRLCERAL +LP   G+++VI+S+VL  
Sbjct  392  HPSYYIFAGLIFIPLTQPYLDEYA-DRYSMWPRRLCERALEELPRNAGQEIVIISKVLTA  450

Query  368  DINTGYERLAELQ  330
            DIN GYE LAELQ
Sbjct  451  DINAGYEHLAELQ  463



>gb|KCW54110.1| hypothetical protein EUGRSUZ_I000922, partial [Eucalyptus grandis]
Length=153

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 108/151 (72%), Gaps = 2/151 (1%)
 Frame = -1

Query  584  LKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPG  405
            L+PLVPVHQFDK PS++IF GL+F  LTQPYLHEY  D Y+  PRRLC+ A R       
Sbjct  1    LQPLVPVHQFDKHPSYYIFGGLIFTSLTQPYLHEYA-DRYSVWPRRLCQLAQRT-SKNAD  58

Query  404  EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  225
            +++VI+S VL+DDI  GY  LA LQV KVN ++++NL+HL + +E  +   IRFDLD+ER
Sbjct  59   QEIVIISMVLMDDITEGYGNLAALQVRKVNEIDIQNLRHLYEFLEHCTATSIRFDLDEER  118

Query  224  VIVLNYDLAKVATSRILKRHRIPYAMSSDLI  132
            VIV  Y  AK+ATS IL R+ IP   S+DLI
Sbjct  119  VIVFKYREAKIATSTILTRYNIPSIASADLI  149



>emb|CDY07457.1| BnaA07g25360D [Brassica napus]
Length=483

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 123/199 (62%), Gaps = 23/199 (12%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR  E I F HLVSMKKP ET  LKVLR+G+  EF+I + P++PL+ V QFDK
Sbjct  304  GNDETVVFRKTESINFSHLVSMKKPRETTTLKVLRDGKTHEFNINITPVEPLIQVCQFDK  363

Query  548  LPSFFIFAGLVFIPLT-QPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
            LPS++IFAGLVF+P T QP                        +P K GEQ+V LSQVL 
Sbjct  364  LPSYYIFAGLVFLPSTPQP----------------------GTVPKKAGEQIVQLSQVLE  401

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            D+   GY      +V KVNGV+VENLKHLR+L+E    E +R DL+++  I++ Y   K 
Sbjct  402  DETTVGYTFSNNSRVKKVNGVQVENLKHLRQLIEKCCTEDLRIDLENDNTIIIGYKSGKR  461

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT +ILKR+ IP  MS DL
Sbjct  462  ATPKILKRYGIPSTMSKDL  480



>ref|XP_009105158.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=483

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 123/199 (62%), Gaps = 23/199 (12%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V FR  E I F HLVSMKKP ET  LKVLR+G+  EF+I + P++PL+ V QFDK
Sbjct  304  GNDETVVFRKTESINFSHLVSMKKPRETTTLKVLRDGKTHEFNINITPVEPLIQVCQFDK  363

Query  548  LPSFFIFAGLVFIPLT-QPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
            LPS++IFAGLVF+P T QP                        +P K GEQ+V LSQVL 
Sbjct  364  LPSYYIFAGLVFLPSTPQP----------------------GTVPKKAGEQIVQLSQVLE  401

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            D+   GY      +V KVNGV+VENLKHLR+L+E    E +R DL+++  I++ Y   K 
Sbjct  402  DETTVGYTFSNNSRVKKVNGVQVENLKHLRQLIEKCCTEDLRIDLENDNTIIIGYKSGKR  461

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT +ILKR+ IP  MS DL
Sbjct  462  ATPKILKRYGIPSTMSKDL  480



>emb|CDY39277.1| BnaC06g27140D [Brassica napus]
Length=455

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 122/194 (63%), Gaps = 23/194 (12%)
 Frame = -1

Query  713  VHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLPSFF  534
            V FR  E I F HLVSMKKP ET  LKVLR+G+  EF+I + P++PL+ V QFDKLPS++
Sbjct  281  VVFRKTESINFSHLVSMKKPCETTTLKVLRDGKTHEFNINITPVEPLIQVCQFDKLPSYY  340

Query  533  IFAGLVFIPLT-QPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINT  357
            +FAGLVF+P T QP                        +P K GEQ+V+LSQVL D+   
Sbjct  341  VFAGLVFLPSTPQP----------------------GTIPKKAGEQIVLLSQVLEDETTV  378

Query  356  GYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRI  177
            GY  L   +V KVNGV+VENLKHLR+L+E      +R DL+++  I++ Y   K AT +I
Sbjct  379  GYTFLNNSRVKKVNGVQVENLKHLRQLIEKCCTGDLRIDLENDNTIIIGYKSGKRATPKI  438

Query  176  LKRHRIPYAMSSDL  135
            LKR+ IP  MS DL
Sbjct  439  LKRYGIPSTMSKDL  452



>gb|KDO66274.1| hypothetical protein CISIN_1g036586mg [Citrus sinensis]
Length=568

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++AV+KVLRN E  EF+IKL   K L+P H   +
Sbjct  368  ANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGR  427

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  +T PYL  EYG+D+   +P +L ++ L  +     EQ+V++SQVL+
Sbjct  428  PPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLV  487

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  +NG  V+NLK L  +VE +  E ++FDL+ ++++VL    AK 
Sbjct  488  ADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKE  547

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS DL
Sbjct  548  ATSDILATHCIPSAMSGDL  566



>emb|CDP16995.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 129/199 (65%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++A +KVLRN E  +F+IKL   + L+P H   K
Sbjct  380  ANDGTVPFRHGERIGFSYLVSQKYTGDSAAIKVLRNSETIKFNIKLASHRRLIPAHNKGK  439

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L ++P  P EQ+V++SQVL+
Sbjct  440  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEMPKSPDEQIVVVSQVLV  499

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE  + E ++FDL+ ++++VL    AK 
Sbjct  500  ADINIGYEDIVNTQVLAFNGKPVKNLKNLASMVESCNDEFLQFDLEYQQIVVLQTKGAKA  559

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  560  ATLDILTTHCIPSAMSDDL  578



>ref|XP_002866058.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42317.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 127/196 (65%), Gaps = 11/196 (6%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKP-LVPVHQFD  552
             ND    FR +ER+ F+HLVSMKKP ET + KVLR+G + EF I L  ++  LVPV +FD
Sbjct  331  GNDEKFVFRGKERVNFNHLVSMKKPGETGLFKVLRDGREHEFKISLNSVQQRLVPVRKFD  390

Query  551  KLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
               + ++FAG +F+PL++P +          S   +C+  L++ P KP  +++I+SQVL 
Sbjct  391  T--NCYVFAGFIFVPLSKPNIE--------NSSGAICDCTLKRRPQKPVHEIIIISQVLW  440

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            D IN GY     LQV KVNG EVE++ HLR+L++    E +R DL+  +VIVLNY  A+ 
Sbjct  441  DVINVGYSSFKNLQVKKVNGEEVESMNHLRRLIKKCRTEDLRLDLEKGKVIVLNYKSARK  500

Query  191  ATSRILKRHRIPYAMS  144
             TS IL+RHRIP AMS
Sbjct  501  ETSLILERHRIPSAMS  516



>ref|XP_006446449.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
 gb|ESR59689.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
Length=586

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++AV+KVLRN E  EF+IKL   K L+P H   +
Sbjct  386  ANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGR  445

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  +T PYL  EYG+D+   +P +L ++ L  +     EQ+V++SQVL+
Sbjct  446  PPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLV  505

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  +NG  V+NLK L  +VE +  E ++FDL+ ++++VL    AK 
Sbjct  506  ADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKTKTAKE  565

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS DL
Sbjct  566  ATSDILATHCIPSAMSGDL  584



>ref|XP_006470390.1| PREDICTED: protease Do-like 9-like [Citrus sinensis]
Length=587

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++AV+KVLRN E  EF+IKL   K L+P H   +
Sbjct  387  ANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGR  446

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  +T PYL  EYG+D+   +P +L ++ L  +     EQ+V++SQVL+
Sbjct  447  PPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLV  506

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  +NG  V NLK L  +VE +  E ++FDL+ ++++VL    AK 
Sbjct  507  ADINIGYEEIVNTQVLALNGKPVRNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKE  566

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS DL
Sbjct  567  ATSDILATHCIPSAMSGDL  585



>ref|XP_011071819.1| PREDICTED: protease Do-like 9 isoform X2 [Sesamum indicum]
Length=492

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 128/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A ++VLRN E  +F++KL   + L+P H   +
Sbjct  292  ANDGTVPFRHGERIGFSYLVSQKYTGDNAAIEVLRNSETLKFNVKLGTHRRLIPAHNKGR  351

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L ++P  P EQ+V++SQVL+
Sbjct  352  PPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEMPQSPEEQIVVVSQVLV  411

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV+  NG  V+NLK L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  412  ADINIGYEDIVNTQVHAFNGKPVKNLKSLAHMVENCDDEYLKFDLEYQQIVVLRTKNAKA  471

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  472  ATLDILSTHCIPSAMSDDL  490



>gb|EYU42545.1| hypothetical protein MIMGU_mgv1a0052332mg, partial [Erythranthe 
guttata]
Length=386

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A +KVLR+ E  +F+IKL   K L+P H   K
Sbjct  186  ANDGTVPFRHGERIGFSYLVSQKYSGDNAAIKVLRSSETLKFNIKLDTHKRLIPAHNRGK  245

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L ++     EQ+V++SQVL+
Sbjct  246  PPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEMRQSAEEQIVVVSQVLV  305

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE  S E ++FDL+ ++++VL    AK 
Sbjct  306  ADINIGYEEIVNTQVLAFNGQPVKNLKSLASMVESCSDEYLKFDLEYQQIVVLQTKTAKA  365

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  366  ATLDILSTHCIPSAMSDDL  384



>ref|XP_011044336.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + AV+KVLRN +  EF IKL   + L+P H   K
Sbjct  359  ANDGTVPFRHGERIGFSYLISQKYTGDNAVIKVLRNSKTLEFDIKLSTHRRLIPPHVKGK  418

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +P  P EQ+V++SQVL+
Sbjct  419  PPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLLDKLLHSMPQSPDEQIVVVSQVLV  478

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ E+++VL    AK 
Sbjct  479  ADINIGYEDIVNTQVVAFNGKPVKNLKSLANMVENFDDEFLKFDLEYEQIVVLRTKTAKE  538

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  539  ATVDILTTHGIPSAISDDL  557



>ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula]
 gb|AES91147.1| serine endopeptidase degp2 protein, putative [Medicago truncatula]
Length=590

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLR+    +F+IKL   + L+P H   K
Sbjct  390  ANDGTVPFRHGERIGFSYLISQKYTGDDAAIKVLRSSNVLKFNIKLDGHRRLIPAHSKGK  449

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P ++ ++ L  +P  P EQLV++SQVL+
Sbjct  450  PPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKILDKLLYAMPQSPDEQLVVISQVLV  509

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE    E ++FDLD E+++VL    AK 
Sbjct  510  ADINIGYEEIVNTQVVGFNGKPVKNLKSLAAMVESCDDEYLKFDLDYEQIVVLRTKTAKA  569

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  570  ATLDILATHCIPSAMSDDL  588



>ref|XP_011015595.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015596.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015597.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + AV+KVLRN +  EF IKL   + L+P H   K
Sbjct  359  ANDGTVPFRHGERIGFSYLISQKYTGDNAVIKVLRNSKTLEFDIKLSTHRRLIPPHVKGK  418

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +P  P EQ+V++SQVL+
Sbjct  419  PPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLLDKLLHSMPQSPDEQIVVVSQVLV  478

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  479  ADINIGYEDIVNTQVVAFNGKPVKNLKSLANMVENFDDEFLKFDLEYDQIVVLRTKTAKE  538

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  539  ATVDILTTHGIPSAISDDL  557



>ref|XP_006376843.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 ref|XP_002318029.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|ERP54640.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|EEE96249.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
Length=559

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + AV+KVLRN +  EF IKL   + L+P H   K
Sbjct  359  ANDGTVPFRHGERIGFSYLISQKYTGDNAVIKVLRNSKTLEFDIKLSTHRRLIPPHVKGK  418

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +P  P EQ+V++SQVL+
Sbjct  419  PPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLLDKLLHSMPQSPDEQIVVVSQVLV  478

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  479  ADINIGYEDIVNTQVVAFNGKPVKNLKSLANMVENFDDEFLKFDLEYDQIVVLRTKTAKE  538

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  539  ATVDILTTHGIPSAISDDL  557



>gb|KJB40784.1| hypothetical protein B456_007G077100 [Gossypium raimondii]
Length=590

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   +TA++KVLR+ +  EF IKL   K L+P H   K
Sbjct  390  ANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRDSKILEFDIKLATHKRLIPAHTSAK  449

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  +T PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  450  PPSYYIIAGFVFTAVTVPYLRSEYGKDYEFDAPVKLLDKHLHAMAESTDEQLVVISQVLV  509

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +V++ + E +RFDL+ ++++VL+   AK 
Sbjct  510  ADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVDNCNDEYLRFDLEYQQIVVLHAKAAKA  569

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H I  AMS DL
Sbjct  570  ATLDILTTHCISSAMSDDL  588



>gb|KDP31134.1| hypothetical protein JCGZ_11510 [Jatropha curcas]
Length=572

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A + VLRN E   F IKL   + LVP H   +
Sbjct  372  ANDGTVPFRHGERIGFSYLISQKYTGDNAAISVLRNSETLNFDIKLSTHRRLVPPHVKGR  431

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  432  PPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVISQVLV  491

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE  + E ++F+L+ E+++VL    AK 
Sbjct  492  ADINIGYEDIVNTQVLAFNGKPVKNLKSLVTMVESCTDEFLKFELEYEQIVVLRTKTAKA  551

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  +L  H IP AMS DL
Sbjct  552  ATVDVLTTHCIPSAMSDDL  570



>ref|XP_011071818.1| PREDICTED: protease Do-like 9 isoform X1 [Sesamum indicum]
Length=977

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 128/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A ++VLRN E  +F++KL   + L+P H   +
Sbjct  777  ANDGTVPFRHGERIGFSYLVSQKYTGDNAAIEVLRNSETLKFNVKLGTHRRLIPAHNKGR  836

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L ++P  P EQ+V++SQVL+
Sbjct  837  PPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEMPQSPEEQIVVVSQVLV  896

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV+  NG  V+NLK L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  897  ADINIGYEDIVNTQVHAFNGKPVKNLKSLAHMVENCDDEYLKFDLEYQQIVVLRTKNAKA  956

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  957  ATLDILSTHCIPSAMSDDL  975



>ref|XP_010928580.1| PREDICTED: protease Do-like 9 [Elaeis guineensis]
Length=579

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLR  +  EF++KL   K LVP H   K
Sbjct  379  ANDGTVPFRHGERIGFSYLVSQKYTGENAMVKVLREKKVYEFNVKLATHKRLVPAHIKGK  438

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AGLVF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  439  PPSYYIIAGLVFAAISVPYLRSEYGKDYEYDAPVKLLDKHLHAMAQAHDEQLVVISQVLV  498

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+  +E ++FDL+ ++++VL    AK 
Sbjct  499  ADINIGYEDIVNTQVLSFNGKPVKNLKSLASMVENCDEEFLQFDLEYQQIVVLKTRTAKA  558

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  559  ATKDILLTHCIPSAMSGDL  577



>ref|XP_009379979.1| PREDICTED: protease Do-like 9 [Musa acuminata subsp. malaccensis]
Length=578

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 128/201 (64%), Gaps = 1/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLR+ +  EF+IKL   K L+P H   K
Sbjct  378  ANDGTVPFRHGERIAFSYLVSQKYTGENALVKVLRDSKVYEFNIKLATHKRLIPAHIKGK  437

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  438  PPSYYIIAGFVFTAISVPYLRSEYGKDYEYDAPVKLLDKLLHTMAHSHDEQLVVISQVLV  497

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D+N GYE +   QV   NG  V+NL+ L  +VE+ S+E ++FDL+ ++++VL    AK 
Sbjct  498  ADVNIGYEDIVNTQVMAFNGKPVKNLRTLANMVENCSEEFLKFDLEYQQIVVLQTKTAKA  557

Query  191  ATSRILKRHRIPYAMSSDLIN  129
            AT  IL  H IP A+S DL +
Sbjct  558  ATPDILATHCIPSAVSEDLTS  578



>sp|Q9LK70.1|DGP12_ARATH RecName: Full=Putative protease Do-like 12, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01154.1| unnamed protein product [Arabidopsis thaliana]
Length=499

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 127/197 (64%), Gaps = 19/197 (10%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A DG        RI+F+H +SMKKP+E  ++KVLR G++ E++I L P+KP + V Q+  
Sbjct  322  AIDGVPVLSEMRRISFNHFISMKKPDENILVKVLRKGKEHEYNISLKPVKPHIQVQQYYN  381

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IF G VF+PLT+ Y+ +    +Y  +                 EQ VI+SQV+ D
Sbjct  382  LPSYYIFGGFVFVPLTKSYIDD---KYYKITD----------------EQHVIISQVMPD  422

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY    +LQV KVNGV+V+NLKHLR+L+E    + +R DL++++V+VLNY+ AK A
Sbjct  423  DINKGYSNFKDLQVEKVNGVKVKNLKHLRELIEGCFSKDLRLDLENDKVMVLNYESAKKA  482

Query  188  TSRILKRHRIPYAMSSD  138
            T  IL+RH I  A +S+
Sbjct  483  TFEILERHNIKSAWASE  499



>ref|NP_566552.1| DEGP protease 12 [Arabidopsis thaliana]
 gb|AEE75834.1| DEGP protease 12 [Arabidopsis thaliana]
Length=491

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 127/197 (64%), Gaps = 19/197 (10%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A DG        RI+F+H +SMKKP+E  ++KVLR G++ E++I L P+KP + V Q+  
Sbjct  314  AIDGVPVLSEMRRISFNHFISMKKPDENILVKVLRKGKEHEYNISLKPVKPHIQVQQYYN  373

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IF G VF+PLT+ Y+ +    +Y  +                 EQ VI+SQV+ D
Sbjct  374  LPSYYIFGGFVFVPLTKSYIDD---KYYKITD----------------EQHVIISQVMPD  414

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY    +LQV KVNGV+V+NLKHLR+L+E    + +R DL++++V+VLNY+ AK A
Sbjct  415  DINKGYSNFKDLQVEKVNGVKVKNLKHLRELIEGCFSKDLRLDLENDKVMVLNYESAKKA  474

Query  188  TSRILKRHRIPYAMSSD  138
            T  IL+RH I  A +S+
Sbjct  475  TFEILERHNIKSAWASE  491



>ref|XP_002321577.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
 gb|EEF05704.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
Length=556

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN +  EF IKL   + L+P H   K
Sbjct  356  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNSKTLEFVIKLSTHRRLIPPHVKGK  415

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +P  P EQ+V++SQVL+
Sbjct  416  PPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLLDKLLHSMPQSPDEQMVVVSQVLV  475

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  476  ADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVENCDDEFLKFDLEYDQIVVLRMKTAKE  535

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  536  ATVDILTTHCIPSAISDDL  554



>ref|XP_011087156.1| PREDICTED: protease Do-like 9 [Sesamum indicum]
Length=573

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A DG V FR  ERI F +LVS K  +++A ++VLRN E+ +F + L     LVP H   K
Sbjct  373  AEDGTVPFRHGERIGFSYLVSQKYTDDSAEIEVLRNSERLKFKVDLGTHTRLVPAHNNGK  432

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF P++ PYL  EYG+++    P +L ++ L ++P    EQ+V++SQVL+
Sbjct  433  PPSYYIIAGFVFTPVSVPYLRSEYGKEYECEGPVKLLDKVLHEMPQSVDEQIVVISQVLV  492

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE  + + ++FDL+ ++++VL    AK 
Sbjct  493  ADINIGYEDIVNTQVLAFNGQPVKNLKSLVTMVESCTDKYMKFDLEYQQIVVLRTRTAKA  552

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL RH +P AMS DL
Sbjct  553  ATLNILTRHCVPSAMSDDL  571



>ref|NP_568583.1| DegP protease 13 [Arabidopsis thaliana]
 gb|AED94564.1| DegP protease 13 [Arabidopsis thaliana]
Length=410

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 123/201 (61%), Gaps = 23/201 (11%)
 Frame = -1

Query  725  NDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKL  546
            NDG V    RER   D LVS+K+  ET +LK+LR G+  EF+I L P++ LVP  Q D  
Sbjct  223  NDGTVIIPNRERTRLDDLVSLKQLGETILLKILREGKMHEFNITLRPVQRLVPAGQIDNN  282

Query  545  PSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDD  366
            PS++IFAG VF+PL +   H  G +                     GEQ+V++S+VL D 
Sbjct  283  PSYYIFAGFVFVPLRKQ--HFKGSN---------------------GEQIVVISEVLADV  319

Query  365  INTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVAT  186
            IN  Y     L+VN VN V+VENLKHL +L+E    + +R +L D RVI+L+Y  AK +T
Sbjct  320  INVEYYMYKHLKVNSVNKVKVENLKHLCELIEKCCTKDLRLELGDGRVIILDYQFAKSST  379

Query  185  SRILKRHRIPYAMSSDLINDE  123
            S IL+RHR+P+AMS DL+ D+
Sbjct  380  SLILERHRVPWAMSKDLMTDQ  400



>ref|XP_006339987.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=581

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 124/200 (62%), Gaps = 2/200 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLR-NGEKXEFSIKLFPLKPLVPVHQFD  552
            ANDG V FR  ERI F +LVS K   ++A +KVLR N E   F IKL     L+P H   
Sbjct  380  ANDGTVPFRHGERIGFSYLVSQKYSGDSAAVKVLRRNSEILNFIIKLATQMRLIPAHNKG  439

Query  551  KLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVL  375
            + PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L +    P EQ+V++SQVL
Sbjct  440  RPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEFRQSPDEQIVVVSQVL  499

Query  374  LDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAK  195
            + DIN GYE +   QV   NG  V+NLK L  +VE  S E ++FDL+ ++V+VL    AK
Sbjct  500  VADINIGYEEIVNTQVLAFNGERVKNLKSLASMVEKCSDEFLKFDLEYQQVVVLQTKTAK  559

Query  194  VATSRILKRHRIPYAMSSDL  135
             ATS IL  H IP AMS DL
Sbjct  560  SATSDILTTHCIPSAMSEDL  579



>ref|XP_009794183.1| PREDICTED: protease Do-like 9 [Nicotiana sylvestris]
Length=575

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 126/200 (63%), Gaps = 2/200 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLR-NGEKXEFSIKLFPLKPLVPVHQFD  552
            ANDG V FR  ERI F +LVS K   ++A +KVLR N E   F IKL     LVP H   
Sbjct  374  ANDGTVPFRHGERIGFSYLVSQKYSGDSAAVKVLRRNSEILNFKIKLATQMRLVPAHNKG  433

Query  551  KLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVL  375
            + PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L +    P EQ+V++SQVL
Sbjct  434  RPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEFRQSPDEQIVVVSQVL  493

Query  374  LDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAK  195
            + DIN GYE +   QV   NG  V+NLK L ++VE+ + E ++ DL+ ++V+VL  + AK
Sbjct  494  VADINIGYEEIVNTQVLAFNGKPVKNLKSLARMVENCNDEFLKLDLEYQQVVVLQTETAK  553

Query  194  VATSRILKRHRIPYAMSSDL  135
             ATS IL  H IP AMS DL
Sbjct  554  SATSDILTTHCIPSAMSEDL  573



>sp|Q9FM41.1|DGP13_ARATH RecName: Full=Putative protease Do-like 13 [Arabidopsis thaliana]
 dbj|BAB08526.1| unnamed protein product [Arabidopsis thaliana]
Length=486

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 123/201 (61%), Gaps = 23/201 (11%)
 Frame = -1

Query  725  NDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKL  546
            NDG V    RER   D LVS+K+  ET +LK+LR G+  EF+I L P++ LVP  Q D  
Sbjct  299  NDGTVIIPNRERTRLDDLVSLKQLGETILLKILREGKMHEFNITLRPVQRLVPAGQIDNN  358

Query  545  PSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDD  366
            PS++IFAG VF+PL +   H  G +                     GEQ+V++S+VL D 
Sbjct  359  PSYYIFAGFVFVPLRKQ--HFKGSN---------------------GEQIVVISEVLADV  395

Query  365  INTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVAT  186
            IN  Y     L+VN VN V+VENLKHL +L+E    + +R +L D RVI+L+Y  AK +T
Sbjct  396  INVEYYMYKHLKVNSVNKVKVENLKHLCELIEKCCTKDLRLELGDGRVIILDYQFAKSST  455

Query  185  SRILKRHRIPYAMSSDLINDE  123
            S IL+RHR+P+AMS DL+ D+
Sbjct  456  SLILERHRVPWAMSKDLMTDQ  476



>ref|XP_010456846.1| PREDICTED: putative protease Do-like 11, mitochondrial [Camelina 
sativa]
Length=581

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 132/208 (63%), Gaps = 17/208 (8%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F+ + RI F HLVS +K    A++KVLR G++ E++I L P+KP V V QF  
Sbjct  363  GNDEKVPFQNKNRINFSHLVSCEK----ALVKVLRKGKEHEYNITLKPVKPNVKVQQFYN  418

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGE-QLVILSQVLL  372
            LPS++IF   VF+PLT+ Y  EYG           C+ AL     K GE QLVI+SQ+L 
Sbjct  419  LPSYYIFGVFVFVPLTKAYFDEYGLSG--------CKCALYDTYIKAGEHQLVIISQILD  470

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            DDIN  Y+ L +LQV  VN V+++NLKHL +LVE  S + +RF L+D+ V+VLN + A+ 
Sbjct  471  DDINKEYQSLEDLQVKNVNRVKIKNLKHLCELVEKCSTKDLRFVLEDDNVMVLNTESARK  530

Query  191  ATSRILKRHRIPYAMSSDLINDECAPAL  108
            AT +I++RH+I   +S D+    C P L
Sbjct  531  ATLKIMERHKIKSVISKDI----CLPML  554



>ref|XP_010446115.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=529

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 124/197 (63%), Gaps = 10/197 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKP-LVPVHQFD  552
             ND  +  R +ERI F+HLVSMKKP E  + KVLR+G + EF I L  ++P LVPV Q+D
Sbjct  341  GNDATIVLRGKERINFNHLVSMKKPGEKGLFKVLRDGREHEFKISLNSVQPRLVPVRQYD  400

Query  551  KL-PSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVL  375
               P  +IFAG +F  L++P +        + S   +C+ AL++ P K  ++++I+S++L
Sbjct  401  PFDPRCYIFAGFIFASLSKPKI--------DNSSDAICDCALKRRPEKAAQEIIIISEML  452

Query  374  LDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAK  195
             DDIN GY    +LQV KVNG E+ NL HLR+ +E    E +R DL+  +VI+L+Y  A 
Sbjct  453  EDDINVGYYSFKKLQVKKVNGEELLNLDHLRRRIEKCRTEVLRLDLEKGKVIILHYKSAC  512

Query  194  VATSRILKRHRIPYAMS  144
                 ILKRHRIP +MS
Sbjct  513  EENLLILKRHRIPSSMS  529



>ref|XP_009609751.1| PREDICTED: protease Do-like 9 [Nicotiana tomentosiformis]
Length=577

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 124/200 (62%), Gaps = 2/200 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLR-NGEKXEFSIKLFPLKPLVPVHQFD  552
            ANDG V FR  ERI F +LVS K   ++A +KVLR N E   F IKL     LVP H   
Sbjct  376  ANDGTVPFRHGERIGFSYLVSQKYSGDSAAVKVLRRNSEILNFKIKLATQMRLVPAHNKG  435

Query  551  KLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVL  375
            + PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L +    P EQ+V++SQVL
Sbjct  436  RPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHEFRQSPDEQIVVVSQVL  495

Query  374  LDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAK  195
            + DIN GYE +   QV   NG  V+NLK L  +VE+ + E ++ DL+ ++V+VL    AK
Sbjct  496  VADINIGYEEIVNTQVLAFNGKPVKNLKSLASMVENCNDEFLKLDLEYQQVVVLQTKTAK  555

Query  194  VATSRILKRHRIPYAMSSDL  135
             ATS IL  H IP AMS DL
Sbjct  556  SATSDILTTHCIPSAMSEDL  575



>ref|XP_010254385.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=577

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            AND  V FR  ERI F +LVS K   E AV+KVLR+ E  EF+IKL   K L+P H   +
Sbjct  377  ANDETVPFRHGERIGFSYLVSQKYTGENAVVKVLRDSEILEFNIKLATYKRLIPAHIKGR  436

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     E+LV++SQVL+
Sbjct  437  PPSYYIIAGFVFTMVSVPYLRSEYGKDYECDAPVKLLDKHLHAMAQSDDEELVVVSQVLV  496

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++F+L+ ++++VL    AK 
Sbjct  497  ADINIGYENIVNTQVLAFNGKPVKNLKSLCNMVENCDDEFLKFELEYQQLVVLQTKTAKA  556

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  557  ATPDILTTHCIPSAMSGDL  575



>sp|Q9LK71.2|DGP11_ARATH RecName: Full=Putative protease Do-like 11, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
Length=560

 Score =   163 bits (413),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 124/207 (60%), Gaps = 29/207 (14%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F+ + RI F +LVSMKKP E A++KVLRNG++ E++I L P+KP   V QF  
Sbjct  358  GNDEKVPFQNKRRIDFSYLVSMKKPGEKALVKVLRNGKEYEYNISLKPVKPNFTVQQFYN  417

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            +PS++IF G VF+PLT+ YL                               V +S+ L D
Sbjct  418  VPSYYIFGGFVFVPLTKTYLDS-------------------------EHHQVKISERLAD  452

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY+ L   QV KVNGVEV+NLKHL +L+E+ S E +R +  + +V+VLNY+ AK A
Sbjct  453  DINEGYQSLYGAQVEKVNGVEVKNLKHLCELIEECSTEDLRLEFKNHKVLVLNYESAKKA  512

Query  188  TSRILKRHRIPYAMSSDLINDECAPAL  108
            T +IL+RH+I   +S D+    C P L
Sbjct  513  TLQILERHKIKSVISKDI----CLPML  535



>ref|XP_010678720.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=566

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLR+     FSIKL   + LVP H   +
Sbjct  366  ANDGTVPFRHGERIGFSYLISQKYTGDKAEIKVLRDSVIQTFSIKLGTHRRLVPAHSKGR  425

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +P    E+LV++SQVL+
Sbjct  426  PPSYYIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLLDKLLHSMPQSKDEELVVISQVLV  485

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V NLK L  +VE  + E ++F+LD ++++VL  + AK 
Sbjct  486  ADINIGYEEIVNTQVIAFNGNPVTNLKTLASMVESCNDEFMKFNLDYDQIVVLRTETAKA  545

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  546  ATIDILATHCIPSAMSDDL  564



>ref|XP_010424503.1| PREDICTED: putative protease Do-like 11, mitochondrial [Camelina 
sativa]
Length=585

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 139/208 (67%), Gaps = 13/208 (6%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F+ + RI F HLVS+KKP E A++K+LR G++ E++I L P+KP V V QF  
Sbjct  363  GNDEKVPFQNKNRINFSHLVSLKKPGEKALVKILRKGKEHEYNITLKPVKPNVKVQQFYN  422

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGE-QLVILSQVLL  372
            LPS++IF G VF+PLT+ Y      D  + S    C+ AL     K GE QLVI+S++L 
Sbjct  423  LPSYYIFGGFVFVPLTKAY-----SDNLSLSG---CKCALYDTYRKAGEHQLVIISKILE  474

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            DDIN GY+RL +LQV KVN V+V+NLKHL +LVE  S + +R  L+D++V+VLN + AK 
Sbjct  475  DDINKGYQRLDDLQVKKVNRVKVKNLKHLCELVEKCSTKYLRLVLEDDKVMVLNTESAKK  534

Query  191  ATSRILKRHRIPYAMSSDLINDECAPAL  108
            AT +I++RH+I   +S D+    C P L
Sbjct  535  ATLKIMERHKIKSVISKDI----CLPML  558



>ref|XP_007514393.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15830.1| predicted protein [Bathycoccus prasinos]
Length=555

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 126/201 (63%), Gaps = 1/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A+DG V FR  ERI+F HLVS K   E A +++LR+G+  +FS+ +   K LVPVH   K
Sbjct  355  ASDGTVPFRAGERISFSHLVSKKFVGENAEIEILRDGKPMKFSVPMENKKRLVPVHMEGK  414

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             P +FI AGLVF  ++ PYL  E+G+DW   +P +L  R   K  T+P ++LVI SQVL 
Sbjct  415  TPEYFIIAGLVFTTVSCPYLKSEFGKDWEYDAPVQLLSRMYLKDMTEPDQELVICSQVLA  474

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             +IN GYE  + L V K NG  ++NLK L  LVE  S+E + F+LD + ++VL+ + AK 
Sbjct  475  HEINIGYEDFSNLAVEKFNGKPIKNLKQLVDLVESCSEEYLTFELDMKTLVVLDNEKAKQ  534

Query  191  ATSRILKRHRIPYAMSSDLIN  129
            +T  IL  H IP   S +L +
Sbjct  535  STREILDVHAIPSDKSKNLFS  555



>ref|XP_011402326.1| Protease Do-like 9 [Auxenochlorella protothecoides]
 gb|KFM29273.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=542

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 128/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR+ ERI +  L S K   + A L+VLR G++ +  IKL     LVP H F+K
Sbjct  330  ANDGTVGFRSNERIAYSFLTSQKFTGDVASLRVLREGKELDLCIKLMRPDFLVPHHLFNK  389

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+F+ AGLVF  LT+PYL  E+G D+   +P +L +R L     +PG+Q+V+L+QVL 
Sbjct  390  DPSYFVVAGLVFTNLTEPYLASEFGPDYLREAPVKLLDRLLYTHKDRPGQQVVMLNQVLA  449

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             +   GYE ++  QV K N V+V +L+HL +LV++N +  +RF+L+ + V+VL+  LA+ 
Sbjct  450  CEATIGYEDISNSQVAKFNDVKVNSLQHLVELVQENREPFMRFNLESKEVLVLDASLAQA  509

Query  191  ATSRILKRHRIPYAMSSDL  135
             T  +   H IP+A+S DL
Sbjct  510  CTEEMQVFHSIPHALSKDL  528



>dbj|GAM25013.1| hypothetical protein SAMD00019534_081880 [Acytostelium subglobosum 
LB1]
Length=505

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 127/200 (64%), Gaps = 3/200 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR RERI++++L+S     +   + V R G+  + ++ L P   +VP   +DK
Sbjct  309  ANDGTVAFRRRERISYEYLLSSHFIGDKVDVTVFRKGQSLDVTVPLVPQHRVVPYQMYDK  368

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS+F++AG +F+P+T P L E  ED  +T  R++ E+A +   T P  Q+V++SQVL+D
Sbjct  369  RPSYFVYAGFIFVPVTYPLLTEVSEDMASTF-RKVFEKAEKI--TGPDSQVVVISQVLID  425

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
             IN GY      +V KVNGV V NLKHL  L+E+ + + I   ++ + +++L+ D AK A
Sbjct  426  KINYGYSAFGLCEVRKVNGVPVRNLKHLVDLIENTTDQHIVITIEHDYLVILDKDEAKEA  485

Query  188  TSRILKRHRIPYAMSSDLIN  129
            T+RI+ +H IP A S DL+N
Sbjct  486  TARIMTQHAIPSAKSVDLLN  505



>ref|XP_002968921.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
 gb|EFJ30037.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
Length=558

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR+ ERI F +LVS K   + A ++VLR+G+  E ++++   K LVP H   +
Sbjct  358  ANDGTVPFRSGERIGFTYLVSQKYTGQRARVRVLRSGQIIENAVEVTIPKRLVPAHNKGR  417

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG+VF  ++ PYL  EYG+D+   +P +L ++ +        EQLV++SQVL 
Sbjct  418  PPSYYIVAGIVFAAVSVPYLRSEYGKDYDYDAPVKLLDKLMHNFAQTEDEQLVVISQVLA  477

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D N GYE +   Q+   NG  V NLKHL  +V++ +   +RFDL+ +++IVL+  +AK 
Sbjct  478  ADANIGYEDIVNTQIIAFNGTAVRNLKHLAHMVDNCNDGFMRFDLEYQQMIVLDAQVAKS  537

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  538  ATPEILSMHCIPSAMSDDL  556



>ref|XP_004252189.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=584

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 121/200 (61%), Gaps = 2/200 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLR-NGEKXEFSIKLFPLKPLVPVHQFD  552
            ANDG V FR  ERI F +LVS K   + A +KVLR N E   F IKL     L+P H   
Sbjct  383  ANDGTVPFRHGERIGFSYLVSQKYSGDYAAVKVLRRNSEILNFIIKLATQMRLIPAHNKG  442

Query  551  KLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVL  375
            + PS++I AG VF  ++ PYL  EYG+D+   +  +L ++ L +    P EQ+V++SQVL
Sbjct  443  RPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEASVKLLDKLLHEFRQSPDEQIVVVSQVL  502

Query  374  LDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAK  195
            + DIN GYE +   QV   NG  V+NLK L  +VE    E ++FDL+ ++V+VL    AK
Sbjct  503  VADINIGYEEIVNTQVLSFNGEPVKNLKSLASMVEKCKDEFLKFDLEYQQVVVLQTKTAK  562

Query  194  VATSRILKRHRIPYAMSSDL  135
             ATS IL  H IP AMS DL
Sbjct  563  SATSDILTTHCIPSAMSEDL  582



>ref|XP_006289059.1| hypothetical protein CARUB_v10002456mg [Capsella rubella]
 gb|EOA21957.1| hypothetical protein CARUB_v10002456mg [Capsella rubella]
Length=350

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 127/193 (66%), Gaps = 9/193 (5%)
 Frame = -1

Query  722  DGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLP  543
            DG V FR  ERI+F+HL+SMKKP E  ++KVLR G++ E++I L P+KP + V Q+  +P
Sbjct  165  DGKVPFRNEERISFNHLISMKKPYEKILVKVLRKGKEHEYNISLKPVKPHISVQQYYNIP  224

Query  542  SFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDI  363
            S++IF G VF+PLT+ Y+ +            +C   L        EQ VI+SQV+  DI
Sbjct  225  SYYIFGGFVFVPLTKLYIDDL---------SYMCGCVLHDQYEFTDEQHVIISQVMSHDI  275

Query  362  NTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATS  183
            N GY  L +LQV KVNGV+V+NLKHL +L+E   ++ +R DL+D++VIVLNY  AK AT 
Sbjct  276  NQGYSDLEDLQVKKVNGVKVKNLKHLCELIEGCCRKNLRLDLEDDKVIVLNYKSAKKATF  335

Query  182  RILKRHRIPYAMS  144
             IL+RH I  A +
Sbjct  336  EILERHNIKSAWA  348



>ref|XP_006655949.1| PREDICTED: protease Do-like 9-like, partial [Oryza brachyantha]
Length=504

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 129/199 (65%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVLRN +  EF+IKL   K L+P H   K
Sbjct  304  ANDGTVPFRHGERIGFSYLVSQKYTGEKAHVKVLRNSKVLEFNIKLATHKRLIPAHIKGK  363

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ PYL  EYG+++   +P +L ++ L  +   P EQLV++SQVL+
Sbjct  364  PPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDAPVKLLDKHLHAMAQSPDEQLVVVSQVLV  423

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV   NG  ++NLKHL  +VE  S+E ++FD+D E+++VL    AK 
Sbjct  424  ADINIGYEEIVNIQVLAFNGKTIKNLKHLATMVEACSEEFLKFDMDYEQLVVLETKTAKA  483

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  484  ATQDILTTHCIPSAISEDL  502



>ref|NP_001057235.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAD37774.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAD37915.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAF19149.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAG99912.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80287.1| hypothetical protein OsI_22290 [Oryza sativa Indica Group]
 gb|EEE65395.1| hypothetical protein OsJ_20719 [Oryza sativa Japonica Group]
Length=628

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 130/199 (65%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   E A +K+LRN +  EF+IKL   K L+P H   +
Sbjct  428  ANDGTVPFRHGERIGFSYLISQKYTGEKAHVKILRNSKVLEFNIKLATHKRLIPAHIKGR  487

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ PYL  EYG+D+   +P +L ++ L  +   P EQLV++SQVL+
Sbjct  488  PPSYYIVAGFVFMVVSVPYLRSEYGKDYEYDAPVKLLDKHLHAMAQSPDEQLVVVSQVLV  547

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV   NG  V+NLKHL  +VED ++E ++FD+D ++++VL    AK 
Sbjct  548  ADINIGYEEIVNIQVLSFNGKPVKNLKHLATMVEDCNEEYLKFDMDYDQLVVLEAKTAKA  607

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  608  ATQDILTTHCIPSAMSEDL  626



>ref|NP_566551.1| DegP protease 11 [Arabidopsis thaliana]
 gb|AEE75833.1| DegP protease 11 [Arabidopsis thaliana]
Length=555

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 121/207 (58%), Gaps = 34/207 (16%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F+ + RI F +LVSMKKP E A++KVLRNG++ E++I L P+KP   V QF  
Sbjct  358  GNDEKVPFQNKRRIDFSYLVSMKKPGEKALVKVLRNGKEYEYNISLKPVKPNFTVQQFYN  417

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            +PS++IF G VF+PLT+ YL                                   Q L D
Sbjct  418  VPSYYIFGGFVFVPLTKTYLDSEHH------------------------------QRLAD  447

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY+ L   QV KVNGVEV+NLKHL +L+E+ S E +R +  + +V+VLNY+ AK A
Sbjct  448  DINEGYQSLYGAQVEKVNGVEVKNLKHLCELIEECSTEDLRLEFKNHKVLVLNYESAKKA  507

Query  188  TSRILKRHRIPYAMSSDLINDECAPAL  108
            T +IL+RH+I   +S D+    C P L
Sbjct  508  TLQILERHKIKSVISKDI----CLPML  530



>ref|XP_002989968.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
 gb|EFJ08981.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
Length=558

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR+ ERI F +LVS K   + A ++VLR+G+  E ++++   K LVP H   +
Sbjct  358  ANDGTVPFRSGERIGFTYLVSQKYTGQRARVRVLRSGQIIENAVEVTIPKRLVPAHNKGR  417

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG+VF  ++ PYL  EYG+D+   +P +L ++ +        EQLV++SQVL 
Sbjct  418  PPSYYIVAGIVFAAVSVPYLRSEYGKDYDYDAPVKLLDKLMHNFAQTEDEQLVVISQVLA  477

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D N GYE +   Q+   NG  V NLKHL  +V++ +   +RFDL+ +++IVL+  +AK 
Sbjct  478  ADANIGYEDIVNTQIIAFNGTAVRNLKHLAHMVDNCNDGFMRFDLEYQQMIVLDAQVAKS  537

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP  MS DL
Sbjct  538  ATPEILSMHCIPSGMSDDL  556



>gb|KHN48612.1| Protease Do-like 9 [Glycine soja]
Length=386

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN +  +F IKL   + L+P H   K
Sbjct  186  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNSDIFKFDIKLDSHRRLIPAHSKGK  245

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  246  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  305

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE  + E ++FDLD ++++VL    AK 
Sbjct  306  ADINIGYEDIVNTQVLAFNGQPVKNLKSLATMVESCNDEYLKFDLDYDQIVVLRMKTAKA  365

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  366  ATLDILATHCIPSAMSDDL  384



>ref|XP_010111735.1| Protease Do-like 9 [Morus notabilis]
 gb|EXC31597.1| Protease Do-like 9 [Morus notabilis]
Length=590

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   +TA++KVLRN E  E++IKL   K L+P H   +
Sbjct  390  ANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRNSEILEYNIKLSTHKRLIPAHIKGR  449

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +     EQ V++SQVL+
Sbjct  450  PPSYYIIAGFVFSAVSVPYLRSEYGKEYEFDAPVKLLDKHLHAMAQSVDEQAVVVSQVLV  509

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V NLK L  +VE  + E ++F+L+ ++++VL    A+ 
Sbjct  510  ADINIGYEDIVNTQVLAFNGKPVRNLKTLASMVESCNDEYLKFNLEYDQIVVLQTKTARE  569

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  570  ATLDILATHCIPSAMSDDL  588



>gb|KCW49312.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
 gb|KCW49313.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
Length=474

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 125/199 (63%), Gaps = 3/199 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V  R  ERI F +LVS K   +T+V+KVLR+ +   F +KL   K ++P+H   +
Sbjct  276  ANDGTVPSRHGERIGFSYLVSQKYTGDTSVIKVLRDSKIFIFDVKLGMHKRVIPLHSEGR  335

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EY ++  + +P +L ++ L  +P  P EQLV++SQVL 
Sbjct  336  PPSYYIIAGFVFSTISVPYLRSEYKDE--SEAPVKLLDKLLHSMPQSPDEQLVVVSQVLA  393

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +    V   NG  VENLK L  +VE   +E ++FDL+ ++++VL  + A+ 
Sbjct  394  GDINVGYEDIVNTPVLAFNGKPVENLKSLASMVESCEEEFLKFDLEYQQIVVLRTETARA  453

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  ILK H IP AMS DL
Sbjct  454  ATLDILKTHCIPSAMSDDL  472



>ref|XP_006282154.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
 gb|EOA15052.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
Length=508

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 121/197 (61%), Gaps = 11/197 (6%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKP-LVPVHQFD  552
             ND  +  R +ERI F+HLVSMKK  E  V KVLR+G + EF I L  ++  LVPV +FD
Sbjct  321  GNDETILLRGKERIHFNHLVSMKKQGEKGVFKVLRDGREHEFKISLNSMQQRLVPVREFD  380

Query  551  KL-PSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVL  375
               P ++IFAG +F  L++  +        N+S R  C+ AL + P K  E+ +I+SQVL
Sbjct  381  PFYPKWYIFAGFIFASLSKRNIK-------NSSTR--CDCALERRPEKYYEETIIISQVL  431

Query  374  LDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAK  195
            LDDIN GY     LQV KVNG EV ++  LR L++    E +R DL+  +VI+LNY  A+
Sbjct  432  LDDINVGYYSFKNLQVKKVNGEEVRHMNQLRTLIKKCRTEDLRLDLEKGKVIILNYKSAR  491

Query  194  VATSRILKRHRIPYAMS  144
              T  IL+RHRIP  MS
Sbjct  492  KETLLILERHRIPSCMS  508



>ref|XP_010436835.1| PREDICTED: LOW QUALITY PROTEIN: putative protease Do-like 13 
[Camelina sativa]
Length=520

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 12/199 (6%)
 Frame = -1

Query  725  NDGXVHFRTRE-RITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            NDG V    RE RIT D LVSMK+  ET +LKVLR G+  EFSI L P++ LV     D 
Sbjct  321  NDGIVVLPNREKRITLDDLVSMKQSGETILLKVLREGKMHEFSITLKPVQWLV-----DN  375

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
              S++IFAG VF+PL++ ++        +    +L        P K G+Q+VI+S++L D
Sbjct  376  NSSYYIFAGFVFVPLSKQHIKS------SNVMHKLAYNNDNNKPKKAGDQIVIISEILAD  429

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
             IN  +     LQV  VN V+VENLKHL +L+E  S + +R DL   RVIVL+Y  AK +
Sbjct  430  VINVAFYMFKNLQVKSVNEVKVENLKHLYELIEKCSDKDLRLDLGGGRVIVLDYQSAKSS  489

Query  188  TSRILKRHRIPYAMSSDLI  132
            T  IL+RHR+P+AMS+DL+
Sbjct  490  TCLILERHRVPWAMSNDLM  508



>dbj|BAB01153.1| unnamed protein product [Arabidopsis thaliana]
Length=565

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 127/212 (60%), Gaps = 34/212 (16%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F+ + RI F +LVSMKKP E A++KVLRNG++ E++I L P+KP   V QF  
Sbjct  358  GNDEKVPFQNKRRIDFSYLVSMKKPGEKALVKVLRNGKEYEYNISLKPVKPNFTVQQFYN  417

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            +PS++IF G VF+PLT+ YL                               V +S+ L D
Sbjct  418  VPSYYIFGGFVFVPLTKTYL-------------------------DSEHHQVKISERLAD  452

Query  368  DINTGYERL--AEL---QVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYD  204
            DIN GY+ L  A+L   QV KVNGVEV+NLKHL +L+E+ S E +R +  + +V+VLNY+
Sbjct  453  DINEGYQSLYGAQLWWEQVEKVNGVEVKNLKHLCELIEECSTEDLRLEFKNHKVLVLNYE  512

Query  203  LAKVATSRILKRHRIPYAMSSDLINDECAPAL  108
             AK AT +IL+RH+I   +S D+    C P L
Sbjct  513  SAKKATLQILERHKIKSVISKDI----CLPML  540



>gb|KIZ00510.1| hypothetical protein MNEG_7454 [Monoraphidium neglectum]
Length=605

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FRT ERI F +L+S K   + A L+VLR GE    + KL     LVP H  ++
Sbjct  375  ANDGTVPFRTGERIAFSYLISQKYVGDEAALEVLRGGEVLSTTAKLSKPAALVPPHLGNR  434

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+F+ +GLVF+  ++PYL  EYG D+ + +P +L ++     PT+PG+Q+V+LSQVL 
Sbjct  435  DPSYFLVSGLVFVACSEPYLESEYGADYASEAPVKLLDKLYHGQPTEPGQQVVVLSQVLA  494

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             +   GYE +  ++V  +NG  V NL HL +LV    ++ +RFD +    +VL+ + A  
Sbjct  495  AESTLGYEDVLNVEVLAINGAPVRNLAHLAELVAGCREQYLRFDCEYREAVVLDREEAFR  554

Query  191  ATSRILKRHRIPYAMSSDL  135
             T+ +L+ H IP A+S+DL
Sbjct  555  DTAAVLEAHGIPAALSADL  573



>ref|XP_010037587.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=579

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 125/199 (63%), Gaps = 3/199 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V  R  ERI F +LVS K   +T+V+KVLR+ +   F +KL   K ++P+H   +
Sbjct  381  ANDGTVPSRHGERIGFSYLVSQKYTGDTSVIKVLRDSKIFIFDVKLGMHKRVIPLHSEGR  440

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EY ++  + +P +L ++ L  +P  P EQLV++SQVL 
Sbjct  441  PPSYYIIAGFVFSTISVPYLRSEYKDE--SEAPVKLLDKLLHSMPQSPDEQLVVVSQVLA  498

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +    V   NG  VENLK L  +VE   +E ++FDL+ ++++VL  + A+ 
Sbjct  499  GDINVGYEDIVNTPVLAFNGKPVENLKSLASMVESCEEEFLKFDLEYQQIVVLRTETARA  558

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  ILK H IP AMS DL
Sbjct  559  ATLDILKTHCIPSAMSDDL  577



>gb|KHN18478.1| Protease Do-like 9 [Glycine soja]
Length=464

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN +  +F IKL   + L+P H   K
Sbjct  264  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNSDILKFDIKLDSHRRLIPAHSKGK  323

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  324  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  383

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE     QV   NG  V+NLK L  +VE  + E ++FDLD ++++VL    AK 
Sbjct  384  ADINIGYEDFVNTQVLAFNGQPVKNLKSLATMVESCNDEYLKFDLDYDQIVVLRTKTAKA  443

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  444  ATLDILSTHCIPSAMSDDL  462



>ref|XP_008239730.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=587

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 128/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + +V+KVLRN E   F IKL   K L+P H   +
Sbjct  387  ANDGTVPFRHGERIGFSYLISQKYTGDNSVVKVLRNSEILSFDIKLASHKRLIPAHNKGR  446

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  LP  P EQLV++SQVL+
Sbjct  447  PPSYYIIAGFVFTAVSVPYLRSEYGKDYEFEAPVKLLDKMLHSLPQSPDEQLVVVSQVLV  506

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  +NG  V+NLK+L  +VE+   E ++FDL+ ++++VL  + AK 
Sbjct  507  ADINIGYEEIVNTQVLALNGKPVKNLKNLASMVEECEDEFLKFDLEYQQMVVLRTNTAKE  566

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  567  ATLDILATHCIPSAMSDDL  585



>gb|KHF97497.1| Protease Do-like 9 [Gossypium arboreum]
Length=249

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   +++ +KVLR+     F+IKL   + L+P H   +
Sbjct  49   ANDGTVPFRHGERIGFSYLVSQKYAGDSSAIKVLRSSAILNFNIKLTSHRRLIPAHNKGR  108

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  109  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  168

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  +NG  ++NL+ L ++VE+   E ++FDL+ E+++VL    AK 
Sbjct  169  SDINIGYEDIVNTQVLALNGKPMKNLRRLAEMVENCDDEFLKFDLEYEQIVVLRTKTAKA  228

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  229  ATPDILATHCIPSAMSVDL  247



>gb|EMS45662.1| Protease Do-like 9 [Triticum urartu]
Length=510

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVLR+ +  EF+IKL   K L+P H   +
Sbjct  310  ANDGTVPFRHGERIGFSYLVSQKYTGEKARVKVLRSSKIHEFNIKLSIHKKLIPAHIKGR  369

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ PYL  EYG+D+   +P +L ++ L  +   P EQLV++SQVL+
Sbjct  370  PPSYYIVAGFVFMVVSVPYLRSEYGKDYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLV  429

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE L   QV   NG  V NLK L  +VED ++E ++FD+D ++V+VL    A+ 
Sbjct  430  ADINIGYEELVNTQVRAFNGKPVNNLKQLATMVEDCNEEFLKFDMDYDQVVVLETKTARA  489

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  490  ATQDILTTHCIPSAMSDDL  508



>ref|XP_004152460.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 ref|XP_004157795.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 gb|KGN64293.1| hypothetical protein Csa_1G045910 [Cucumis sativus]
Length=586

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++A +KVLRN E   F+ +L   + L+P H   +
Sbjct  386  ANDGTVPFRHGERIGFSYLVSQKYTGDSATIKVLRNSETLSFNYQLATYRRLIPAHNEGR  445

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  446  PPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  505

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE    E ++FDL+ ++++VL    AK 
Sbjct  506  ADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVESCDDEFLKFDLEYQQIVVLRTSTAKA  565

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS+DL
Sbjct  566  ATSDILATHCIPSAMSNDL  584



>ref|XP_008438126.1| PREDICTED: protease Do-like 9 [Cucumis melo]
Length=586

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++A +KVLRN E   F+ +L   + L+P H   +
Sbjct  386  ANDGTVPFRHGERIGFSYLVSQKYTGDSAAIKVLRNSETLSFNYQLATYRRLIPAHNEGR  445

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  446  PPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  505

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE    E ++FDL+ ++++VL    AK 
Sbjct  506  ADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVESCDDEFLKFDLEYQQIVVLRTSTAKA  565

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS+DL
Sbjct  566  ATSDILATHCIPSAMSNDL  584



>ref|XP_003525265.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=584

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN +  +F IKL   + L+P H   K
Sbjct  384  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNSDIFKFDIKLDSHRRLIPAHSKGK  443

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  444  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  503

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE  + E ++FDLD ++++VL    AK 
Sbjct  504  ADINIGYEDIVNTQVLAFNGQPVKNLKSLATMVESCNDEYLKFDLDYDQIVVLRMKTAKA  563

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  564  ATLDILATHCIPSAMSDDL  582



>dbj|BAJ90442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVLR+ +  EF+IKL   K L+P H   +
Sbjct  401  ANDGTVPFRHGERIGFSYLVSQKYTGEKARVKVLRSSKIHEFNIKLSIHKKLIPAHIKGR  460

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ PYL  EYG+D+   +P +L ++ L  +   P EQLV++SQVL+
Sbjct  461  PPSYYIVAGFVFMVVSVPYLRSEYGKDYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLV  520

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V NLK L  +VED +KE ++FD+D ++V+VL    A+ 
Sbjct  521  ADINIGYEEIVNTQVRAFNGKPVNNLKQLATMVEDCNKEFLKFDMDYDQVVVLETKTARA  580

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  581  ATQDILTTHCIPSAMSDDL  599



>ref|XP_003550747.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=576

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN +  +F IKL   + L+P H   K
Sbjct  376  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNSDILKFDIKLDSHRRLIPAHSKGK  435

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  436  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  495

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE     QV   NG  V+NLK L  +VE  + E ++FDLD ++++VL    AK 
Sbjct  496  ADINIGYEDFVNTQVLAFNGQPVKNLKSLATMVESCNDEYLKFDLDYDQIVVLRTKTAKA  555

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  556  ATLDILSTHCIPSAMSDDL  574



>gb|EFA82977.1| hypothetical protein PPL_03755 [Polysphondylium pallidum PN500]
Length=566

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 121/198 (61%), Gaps = 3/198 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG + FR RERIT+++L+S     +   + V R G+  + S+ L P   +VP   +DK
Sbjct  366  ANDGSIAFRRRERITYEYLLSSHFIGDKINVTVFREGQSMDLSVPLVPQHRMVPYQTYDK  425

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS+F +AG VF P+T P+L E  ED   T  RR+ E+  R   T P  Q+V++SQ+L+D
Sbjct  426  RPSYFCYAGFVFTPVTHPFLTEIAEDLALTY-RRVFEKIERI--TSPSSQVVVISQILID  482

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
             IN GY      +V KVNG  + NL HL +L+E+ +K  +   L++E +I+L+ + AK A
Sbjct  483  KINHGYSSFGFSEVKKVNGTPIRNLAHLVQLIEETTKPHVVITLENEYLIILDKEEAKEA  542

Query  188  TSRILKRHRIPYAMSSDL  135
            T RI+K+H IP   S +L
Sbjct  543  TIRIMKQHAIPSDRSEEL  560



>ref|XP_008659079.1| PREDICTED: protease Do-like 9 [Zea mays]
 gb|AFW85217.1| hypothetical protein ZEAMMB73_653756 [Zea mays]
Length=249

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVL N    EF+IKL   K L+P H   +
Sbjct  49   ANDGTVPFRRGERIGFSYLVSQKYTGEKARVKVLPNSNVHEFNIKLAINKRLIPAHIKGR  108

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  109  PPSYYIVAGFVFMVVSVPYLRSEYGKDYEYDAPVKLLDKHLHAMAQSSDEQLVVVSQVLV  168

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV   NG  V NLKHL  +VE+ ++  ++FDLD ++V+VL    AK 
Sbjct  169  ADINIGYEDIVNIQVLAFNGTPVTNLKHLATMVEECNEAFLKFDLDHDQVVVLETKTAKA  228

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  I+  H IP A+S DL
Sbjct  229  ATQDIVTTHCIPSAVSEDL  247



>ref|XP_004508846.1| PREDICTED: protease Do-like 9-like [Cicer arietinum]
Length=582

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN    +F+IKL   + L+P H   K
Sbjct  382  ANDGTVPFRHGERIGFSYLISQKYTGDDAAIKVLRNSNVLKFNIKLDGHRRLIPAHSKGK  441

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P ++ E+ L  +P  P EQLV++SQVL+
Sbjct  442  PPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEAPVKILEKLLYAMPQSPDEQLVVVSQVLV  501

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE    E ++FDLD E+++VL    AK 
Sbjct  502  ADINIGYEDIVNTQVVAFNGKPVKNLKSLAAMVESCDDEYLKFDLDYEQIVVLRTKTAKA  561

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  562  ATLDILTTHCIPSAMSDDL  580



>ref|XP_010678716.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010678717.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 120/199 (60%), Gaps = 3/199 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             NDG V FR  ERI F++L+S K   + A +K+LR+    EF IKL P K L+P    D 
Sbjct  285  GNDGTVPFRHGERIGFNYLISKKYTGDHAKIKLLRDSVMHEFDIKLDPYKKLIPACIKDG  344

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++IFAG VF  ++ PYL  EY ++  +  P  L  +    +     E+L+I+SQVL+
Sbjct  345  PPSYYIFAGFVFTAVSVPYLFSEYSDE--SDVPVELLHKLHHSMADSKDEELLIISQVLV  402

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV  VNG  V+NLK    +VE  S+E ++FDL+  + +VL  + AK 
Sbjct  403  ADINIGYENITNVQVTAVNGKPVKNLKSFTSMVESCSEEYLKFDLEFNKKVVLRTETAKA  462

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT+ IL  H IP AMS DL
Sbjct  463  ATADILATHCIPSAMSDDL  481



>ref|XP_001753311.1| predicted protein [Physcomitrella patens]
 gb|EDQ81940.1| predicted protein [Physcomitrella patens]
Length=851

 Score =   157 bits (397),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 124/206 (60%), Gaps = 1/206 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            AN+G V FR  ERI+F  L+S K   +TA  K+LR+GE  E    L     LVPVH   K
Sbjct  632  ANEGTVPFRAGERISFGFLISQKFSGDTAKCKMLRDGEVIEIETTLKAPVHLVPVHIEGK  691

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
            LPS+ I AGLVF P+  PYL  EYG+D+   +P ++ E++   +     EQLV++SQVL 
Sbjct  692  LPSYLIVAGLVFTPVCNPYLESEYGQDFEYDAPVKILEKSRHGMAEFDDEQLVVVSQVLA  751

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
            +D+N GYE +A   V   NGV++ NL+HL  L++  + + +RF+LD   ++VL   +A+ 
Sbjct  752  NDVNIGYEEIANTLVKTFNGVKIRNLRHLADLIDTCTDDFMRFELDYCSLVVLETKVARS  811

Query  191  ATSRILKRHRIPYAMSSDLINDECAP  114
             T +IL+ + +P   S DLI     P
Sbjct  812  VTPKILEDNCVPTDRSQDLITSAALP  837



>ref|XP_005704064.1| serine-type endopeptidase isoform 1 [Galdieria sulphuraria]
 gb|EME27544.1| serine-type endopeptidase isoform 1 [Galdieria sulphuraria]
Length=569

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 118/192 (61%), Gaps = 1/192 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V +R  ERI F +L+++K   E+  ++++RNG   E S  LF L  LVP+H+   
Sbjct  369  ANDGTVSYRGGERINFHYLITLKFVGESCTVRIVRNGNIMEVSYPLFELPLLVPIHEKRP  428

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
            +P +   AGLVF+ L++PYL  EYGE W   +P +L ++ L        EQ+VILSQVL 
Sbjct  429  VPEYLTVAGLVFVALSEPYLRSEYGEKWDFEAPVKLLDKLLYGYKRTANEQVVILSQVLN  488

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
              IN GYE L   ++   NG  VENL HL  L+++ S+E +RFDL+ + VIV+    A  
Sbjct  489  ARINVGYECLTNTELLHFNGTRVENLCHLANLIDETSEEFLRFDLEFDEVIVIEKQAALE  548

Query  191  ATSRILKRHRIP  156
             +S+IL +H IP
Sbjct  549  QSSQILVQHGIP  560



>ref|XP_005704063.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
 gb|EME27543.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
Length=584

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 118/192 (61%), Gaps = 1/192 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V +R  ERI F +L+++K   E+  ++++RNG   E S  LF L  LVP+H+   
Sbjct  384  ANDGTVSYRGGERINFHYLITLKFVGESCTVRIVRNGNIMEVSYPLFELPLLVPIHEKRP  443

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
            +P +   AGLVF+ L++PYL  EYGE W   +P +L ++ L        EQ+VILSQVL 
Sbjct  444  VPEYLTVAGLVFVALSEPYLRSEYGEKWDFEAPVKLLDKLLYGYKRTANEQVVILSQVLN  503

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
              IN GYE L   ++   NG  VENL HL  L+++ S+E +RFDL+ + VIV+    A  
Sbjct  504  ARINVGYECLTNTELLHFNGTRVENLCHLANLIDETSEEFLRFDLEFDEVIVIEKQAALE  563

Query  191  ATSRILKRHRIP  156
             +S+IL +H IP
Sbjct  564  QSSQILVQHGIP  575



>ref|XP_010029214.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=589

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A ++VLRN +  EF IKL   K L+P H   K
Sbjct  389  ANDGTVPFRHGERIGFGYLVSQKYTGDKAHVQVLRNSKILEFDIKLATHKRLIPAHISGK  448

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  449  SPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKLLDKLLHSMAGSVNEQLVVVSQVLV  508

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E +RFDL+ ++V+VL    AKV
Sbjct  509  ADINIGYEDIVNTQVLAFNGEPVKNLKSLANMVENCEDEYLRFDLEYQQVVVLRTKTAKV  568

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS+DL
Sbjct  569  ATSDILTTHCIPSAMSNDL  587



>gb|EYU29924.1| hypothetical protein MIMGU_mgv1a005009mg [Erythranthe guttata]
Length=501

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 121/194 (62%), Gaps = 1/194 (1%)
 Frame = -1

Query  713  VHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLPSFF  534
            V FR  ERI F +LVS K   ++A +KVLRN +  +  I L     LVP H   + PS++
Sbjct  306  VPFRHGERIGFSYLVSQKYTGDSAEMKVLRNSKSLKLKILLGTHSRLVPAHNEGRPPSYY  365

Query  533  IFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINT  357
            I AGLVF  ++ PYL  EYG+D+   +P +L ++ L ++P    EQ+V++SQVL+ +IN 
Sbjct  366  IVAGLVFTTVSVPYLRSEYGKDYGFEAPVKLLDKLLYEMPQSVDEQIVVVSQVLVAEINI  425

Query  356  GYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRI  177
            GYE +A  QV   NG  V+NLK L  +VE  + E ++FDL+ ++++VL    AK AT  I
Sbjct  426  GYEEIANTQVLAFNGQPVKNLKSLASMVESCNDEYLKFDLEFQQILVLQTKAAKEATLDI  485

Query  176  LKRHRIPYAMSSDL  135
            L  H IP AMS DL
Sbjct  486  LATHCIPSAMSDDL  499



>ref|XP_007036141.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036142.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036143.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036144.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036145.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036146.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20642.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20643.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20644.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20645.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20646.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20647.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
Length=589

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   +++ +KVLRN E   F+IKL   + L+P H   +
Sbjct  389  ANDGTVPFRHGERIGFSYLVSQKYAGDSSAIKVLRNSEILNFNIKLASHRRLIPAHNKGR  448

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  449  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  508

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D N GYE +   QV   NG  V+NLK L ++VE+   E ++FDL+ E+++VL    AK 
Sbjct  509  ADTNIGYEDIVNTQVLAFNGKPVKNLKSLAEMVENCEDEFLKFDLEYEQMVVLRTKTAKA  568

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  569  ATPDILAMHCIPSAMSEDL  587



>ref|XP_007155398.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
 gb|ESW27392.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
Length=588

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN +  +F IKL   + L+P H   K
Sbjct  388  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNPDILKFDIKLDSHRRLIPSHSKGK  447

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  LP  P EQLV++SQVL+
Sbjct  448  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSLPQSPDEQLVVVSQVLV  507

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV   NG  V+NLK L  +VE  + E ++FDLD ++++VL    AK 
Sbjct  508  ADINIGYEDIVNIQVLAFNGKPVKNLKSLATMVESCNDEYLKFDLDYDQIVVLRSKTAKA  567

Query  191  ATSRILKRHRIPYAMSSDL  135
             T  IL  H IP AMS DL
Sbjct  568  TTLDILATHCIPSAMSDDL  586



>ref|XP_010424502.1| PREDICTED: putative protease Do-like 12, mitochondrial [Camelina 
sativa]
Length=511

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 126/195 (65%), Gaps = 9/195 (5%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  V F+  ERI+F+HLVSMKKP E  ++KVLR G++ E++I L P++P + V Q+  
Sbjct  324  GNDAKVPFQNEERISFNHLVSMKKPYEKILIKVLRKGKEHEYNISLKPVRPHITVQQYYN  383

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LPS++IF G VF+PLT+ Y+ +            +C   L        EQ VI+SQV+ D
Sbjct  384  LPSYYIFGGFVFVPLTKSYIDDL---------SYMCACILHDEYKITDEQHVIISQVMSD  434

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GY    +L+V KVNGV+V+N KHL +L+E    E +R DL++++V+VLNY+ AK A
Sbjct  435  DINQGYGDFKDLRVKKVNGVKVKNFKHLCELIEGCCSENLRMDLENDKVMVLNYESAKKA  494

Query  188  TSRILKRHRIPYAMS  144
            T  IL+RH I  A +
Sbjct  495  TFEILERHNIKSAWA  509



>ref|XP_001633828.1| predicted protein [Nematostella vectensis]
 gb|EDO41765.1| predicted protein [Nematostella vectensis]
Length=569

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A++G VHFR  ERI FD+ +S K  N+   L+++R G + E  + L  +K LVP   +DK
Sbjct  244  ADNGTVHFRGNERILFDYALSHKYVNDVCKLRIMRQGLEMEVDVCLDKVKHLVPTQLYDK  303

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+ ++AGLVF+ L+QPY+ H+YG+DW   +P RLC+RAL  +   P +++++LSQVL 
Sbjct  304  RPSYLVYAGLVFVALSQPYMQHQYGKDWARKAPIRLCDRALYGILENPDQEVILLSQVLA  363

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLV  273
             ++ TGYE +A LQ+ KVNG  V NLKHL K++
Sbjct  364  SELTTGYENIANLQLFKVNGTPVLNLKHLAKVL  396



>ref|XP_010272002.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=551

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 119/198 (60%), Gaps = 1/198 (1%)
 Frame = -1

Query  725  NDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKL  546
            ND  V FR  E I F +LVS K   E AV+KVLRN E  EF+I L   K L+P H   + 
Sbjct  352  NDETVSFRNGEHIGFSYLVSQKFMGENAVIKVLRNSETFEFNIMLASHKRLIPAHIKGRP  411

Query  545  PSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            P ++I AG VF  ++  YL  EYG+D+   +P +L ++ L  +     E+LV++SQVL+ 
Sbjct  412  PPYYIIAGFVFTTVSVLYLRSEYGKDYECDAPVKLLDKHLHAMAQSEDEELVVVSQVLVA  471

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYE +   QV   NG  V+NLK L  +VE+   + ++F+L+ ++++VL    AK A
Sbjct  472  DINIGYENIVNTQVLACNGNPVKNLKSLASMVENCDDQFLKFELEYQQLVVLQTKTAKAA  531

Query  188  TSRILKRHRIPYAMSSDL  135
            T  IL  H IP AMS DL
Sbjct  532  TLDILTTHCIPSAMSDDL  549



>emb|CDY46469.1| BnaA08g06390D [Brassica napus]
Length=505

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 127/198 (64%), Gaps = 26/198 (13%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            AND  V F   ERI+F++L+SMKKP ET+++KVLR G++ E++I L P+KP V V Q+ K
Sbjct  329  ANDATVPFWESERISFNYLISMKKPGETSMIKVLRRGKEHEYNINLKPVKPHVRVQQYYK  388

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IF G VF+P                    L E           EQ VI+S++L D
Sbjct  389  RPSYYIFGGFVFVP-----------------NHNLSESE---------EQHVIISEILED  422

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYE   +LQV KVN V+V+NL+HL +L+E+N  + +  DL+D++V+VLNY+ AK A
Sbjct  423  DINQGYESFKDLQVEKVNKVKVKNLRHLFELIEENGTQNLSIDLEDDKVLVLNYESAKKA  482

Query  188  TSRILKRHRIPYAMSSDL  135
             S ILKRH I  A+S+DL
Sbjct  483  DSIILKRHNITSAISNDL  500



>ref|XP_009107927.1| PREDICTED: putative protease Do-like 12, mitochondrial [Brassica 
rapa]
Length=505

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 127/198 (64%), Gaps = 26/198 (13%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            AND  V F   ERI+F++L+SMKKP ET+++KVLR G++ E++I L P+KP V V Q+ K
Sbjct  329  ANDATVPFWENERISFNYLISMKKPGETSMIKVLRRGKEHEYNINLKPVKPHVRVQQYYK  388

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS++IF G VF+P                    L E           EQ VI+S++L D
Sbjct  389  RPSYYIFGGFVFVP-----------------NHNLSESE---------EQHVIISEILED  422

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
            DIN GYE   +LQV KVN V+V+NL+HL +L+E+N  + +  DL+D++V+VLNY+ AK A
Sbjct  423  DINQGYESFKDLQVEKVNKVKVKNLRHLFELIEENGTQNLSIDLEDDKVLVLNYESAKKA  482

Query  188  TSRILKRHRIPYAMSSDL  135
             S ILKRH I  A+S+DL
Sbjct  483  DSIILKRHNITSAISNDL  500



>ref|XP_003564034.1| PREDICTED: protease Do-like 9 [Brachypodium distachyon]
Length=599

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVLR+ +  EF IKL   K L+P H   +
Sbjct  399  ANDGTVPFRHGERIGFSYLVSQKYTGEKAHVKVLRSSKIHEFKIKLAIHKKLIPAHIKGR  458

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ P+L  EYG+D+   +P +L ++ L  +   P EQLV++SQVL+
Sbjct  459  PPSYYIVAGFVFMVVSVPFLRSEYGKDYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLV  518

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE L   QV   NG  V NLK L  +VED  +E ++FD+D ++V+VL    AK 
Sbjct  519  ADINIGYEELVNTQVLAFNGKPVNNLKQLATMVEDCKEEFLKFDMDYDQVVVLETKTAKA  578

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  579  ATQDILATHCIPSAMSDDL  597



>ref|XP_004965071.1| PREDICTED: protease Do-like 9-like [Setaria italica]
Length=604

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +K+LRN +  EF+IKL   K L+P H   +
Sbjct  404  ANDGTVPFRHGERIGFSYLVSQKYTGEKARVKLLRNSKIHEFNIKLATHKRLIPAHIKGR  463

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++    +   P EQLV++SQVL+
Sbjct  464  PPSYYIVAGFVFTVVSVPYLRSEYGKDYEYDAPVKLLDKHSHAMAQSPDEQLVVVSQVLV  523

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV   NG  V+NLKHL  +VE+ ++  ++FDLD ++++VL    AK 
Sbjct  524  SDINIGYEDIVNIQVLAFNGTPVKNLKHLATMVEECNEAFLKFDLDYDQLVVLETKTAKA  583

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  584  ATQDILTTHCIPSAMSEDL  602



>gb|KFG58629.1| trypsin domain-containing protein [Toxoplasma gondii RUB]
Length=252

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 118/199 (59%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A+DG V FR  ERI F  ++S     +   +K+LR   +   S  +  L  LVP +   +
Sbjct  54   ASDGTVAFRNGERILFTWILSQMFVGDRCSVKLLRQNRERRESFSVGKLNLLVPANSDLR  113

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             P + I  GLVF+PL++P+L  EYGED+ + +P RL ++      + PGEQ V+LS VL 
Sbjct  114  RPQYLIVGGLVFVPLSEPFLKSEYGEDFESRAPVRLLDKWQHGFQSFPGEQFVLLSHVLA  173

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D+  GYE L  +QV + NG  V+ LKHL +LVE++++E  RFDLD + V+VL  D A+ 
Sbjct  174  HDVTVGYEHLHNVQVQQFNGTSVKTLKHLAELVENSTEEYWRFDLDHDEVVVLEADAARR  233

Query  191  ATSRILKRHRIPYAMSSDL  135
            A   IL+R+ I    S D+
Sbjct  234  ALPHILQRNMIRSCKSEDV  252



>ref|NP_568577.1| DegP protease 9 [Arabidopsis thaliana]
 sp|Q9FL12.1|DEGP9_ARATH RecName: Full=Protease Do-like 9 [Arabidopsis thaliana]
 dbj|BAB10901.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAK76697.1| putative DegP protease [Arabidopsis thaliana]
 gb|AAN13177.1| putative DegP protease [Arabidopsis thaliana]
 gb|AED94519.1| DegP protease 9 [Arabidopsis thaliana]
Length=592

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 129/203 (64%), Gaps = 1/203 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  388  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKEILEFNIKLAIHKRLIPAHISGK  447

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  448  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLEKHLHAMAQSVDEQLVVVSQVLV  507

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++F+LD ++++VL+   AK 
Sbjct  508  SDINIGYEEIVNTQVVAFNGKPVKNLKGLAGMVENCEDEYMKFNLDYDQIVVLDTKTAKE  567

Query  191  ATSRILKRHRIPYAMSSDLINDE  123
            AT  IL  H IP AMS DL  +E
Sbjct  568  ATLDILTTHCIPSAMSDDLKTEE  590



>ref|XP_010913540.1| PREDICTED: protease Do-like 9 isoform X2 [Elaeis guineensis]
Length=403

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E AV+KVLR  +  EF+IKL   K L+P H   K
Sbjct  203  ANDGTVPFRHGERIGFSYLVSQKYTGENAVVKVLREKKVYEFNIKLATHKRLIPAHIRGK  262

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  263  PPSYYIIAGFVFAAISVPYLRSEYGKDYEYDAPVKLLDKHLHSMAQSHDEQLVVVSQVLV  322

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+  +E +RFDL+ ++++VL    AK 
Sbjct  323  ADINIGYEDIVNTQVLAFNGKPVKNLKSLATMVENCDEEFLRFDLEYQQIVVLQTKTAKA  382

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  383  ATKDILLTHCIPSAVSDDL  401



>ref|XP_002885148.1| hypothetical protein ARALYDRAFT_479117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61407.1| hypothetical protein ARALYDRAFT_479117 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 120/217 (55%), Gaps = 44/217 (20%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFS----------IKLFPLK  579
             ND  V F+ + RI F +LVSMKKP E A++KVLRNG++ E S           K+  +K
Sbjct  287  GNDEKVPFQNKRRIDFSYLVSMKKPGEKALVKVLRNGKEYETSNINATISRMISKINSVK  346

Query  578  PLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQ  399
            P   V QF  LPS++IF G VF+PLT+ YL                              
Sbjct  347  PNFTVQQFYNLPSYYIFGGFVFVPLTKTYLDSEHH-------------------------  381

Query  398  LVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVI  219
                 Q+L DDIN GY+ L   QV KVNGVEV+NLKHL +L+E+ S E +R D  + +V+
Sbjct  382  -----QILADDINEGYQSLDGAQVEKVNGVEVKNLKHLCELIEECSTEDLRLDFKNHKVL  436

Query  218  VLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  108
            VLNY+ AK AT +IL+RH+I   +S D+    C P L
Sbjct  437  VLNYETAKKATLQILERHKIKSFISKDI----CLPML  469



>ref|XP_002981859.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
 gb|EFJ16952.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
Length=466

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI+F +LVS K   E A +K+LR+G   E++++L   K LVP H    
Sbjct  264  ANDGTVPFRLGERISFSYLVSQKYTGELAKVKILRDGNVNEYNLELRYHKRLVPAHIKGI  323

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG+VF  +T PYL  EYG+D+   +P +L  + L  +     EQLV++SQVL+
Sbjct  324  TPSYYIVAGVVFAAITVPYLRSEYGKDYDYDAPVKLLNKLLHSMAKTQDEQLVVVSQVLV  383

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D+N GYE +   QV   NG  V NLKHL  +VE    E ++FDLD ++V+VL    AK 
Sbjct  384  ADVNIGYEDIVNTQVLAFNGTSVTNLKHLANMVESCKDEFLKFDLDHQQVLVLETQRAKA  443

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP  MSSDL
Sbjct  444  ATPAILATHCIPSPMSSDL  462



>gb|EEE57793.1| hypothetical protein OsJ_08344 [Oryza sativa Japonica Group]
Length=440

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLRN +  EF IKL   K LV  H   +
Sbjct  240  ANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNSKVHEFKIKLATHKRLVAAHVKGR  299

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  300  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHAMAQSPDEQLVVVSQVLV  359

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  360  ADINIGYEEIVNTQVLAFNGQPVKNLKNLVSMVENCKDEFLKFDLEYDQIVVLETKTAKA  419

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  420  ATQDILTTHCIPSAMSDDL  438



>ref|XP_002982828.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
 gb|EFJ16073.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
Length=494

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI+F +LVS K   E+A +K+LR+G   E++++L   K LVP H    
Sbjct  291  ANDGTVPFRLGERISFSYLVSQKYTGESAKVKILRDGSVNEYNLELRYHKRLVPAHIKGI  350

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG+VF  +T PYL  EYG+D+   +P +L  + L  +     EQLV++SQVL+
Sbjct  351  PPSYYIVAGVVFAAITVPYLRSEYGKDYDYDAPVKLLNKLLHSMAKTEDEQLVVVSQVLV  410

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D+N GYE +   QV   NG  V NLKHL  +VE    E ++FDLD ++V+VL    AK 
Sbjct  411  ADVNIGYEDIVNTQVLAFNGTSVTNLKHLANMVESCKDEFLKFDLDHQQVLVLETQRAKA  470

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP  MSSDL
Sbjct  471  ATPAILATHCIPSPMSSDL  489



>gb|KDP45394.1| hypothetical protein JCGZ_09643 [Jatropha curcas]
Length=585

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG + FR  ERI+F +LVS K   + AV+KVLRN E  EF+IKL   K L+P H   K
Sbjct  385  ANDGTIPFRHGERISFSYLVSQKYTGDKAVVKVLRNSEILEFNIKLAAHKRLIPAHIKGK  444

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+D+   +P ++ ++ L  +     EQ+V++SQVL+
Sbjct  445  PPSYFIIAGFVFTSVSVPYLRSEYGKDYEFDAPVKILDKHLHAMAQSVDEQVVVVSQVLV  504

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  505  ADINIGYEEIVNTQVLSFNGKPVKNLKNLADMVENCDDEYLKFDLEYQQIVVLQTSNAKA  564

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  565  ATLGILATHCIPSAMSDDL  583



>ref|XP_010678718.1| PREDICTED: protease Do-like 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 120/199 (60%), Gaps = 4/199 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             NDG V FR  ERI F++L+S K   + A +K+LR+    EF IKL P K L+P    D 
Sbjct  285  GNDGTVPFRHGERIGFNYLISKKYTGDHAKIKLLRDSVMHEFDIKLDPYKKLIPACIKDG  344

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++IFAG VF  ++ PYL  EY ++  +  P  L  +    +     E+L+I+SQVL+
Sbjct  345  PPSYYIFAGFVFTAVSVPYLFSEYSDE--SDVPVELLHKLHHSMADSKDEELLIISQVLV  402

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV  VNG  V+NLK    +VE  S+E ++FDL+  +V VL  + AK 
Sbjct  403  ADINIGYENITNVQVTAVNGKPVKNLKSFTSMVESCSEEYLKFDLEFNKV-VLRTETAKA  461

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT+ IL  H IP AMS DL
Sbjct  462  ATADILATHCIPSAMSDDL  480



>ref|XP_001774430.1| predicted protein [Physcomitrella patens]
 gb|EDQ60793.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 121/199 (61%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +K+LR+G+  EF I L   K LVP H   K
Sbjct  265  ANDGTVPFRHGERIGFSYLVSKKYSGECAKVKILRDGKSKEFDIDLVNHKRLVPAHIKGK  324

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG+VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  325  PPSYYILAGIVFAAISVPYLRSEYGKDYDYDAPVKLLDKLLHSMSQSEDEQLVVVSQVLV  384

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   N   V NLKHL  LVE  +   +RF LD +++++L    AK 
Sbjct  385  ADINIGYEDIVNTQVVAFNDTPVRNLKHLANLVEKCTDPFLRFGLDYQQIVILETQTAKA  444

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  445  ATPEILATHCIPSAMSHDL  463



>ref|XP_006836679.1| hypothetical protein AMTR_s00088p00077590 [Amborella trichopoda]
 gb|ERM99532.1| hypothetical protein AMTR_s00088p00077590 [Amborella trichopoda]
Length=594

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ETA +K+LRN +  E+ ++L   K LVP H   K
Sbjct  394  ANDGTVPFRHGERIGFSYLVSQKYTGETAKIKILRNAKILEYKVELATHKRLVPAHIKGK  453

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   SP +L ++ L  +     EQLV++SQVL+
Sbjct  454  PPSYYIIAGFVFSAISVPYLRSEYGKDYDYDSPVKLLDKLLHSMSQTEDEQLVVVSQVLV  513

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  ++NLKHL  LVE+   E ++F+LD ++++VL    A+ 
Sbjct  514  ADINIGYEDIVNTQVLAFNGQPIKNLKHLANLVENYEGEFLQFNLDYQQIVVLETKTARA  573

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  574  ATVDILTTHCIPAAMSDDL  592



>ref|XP_010227815.1| PREDICTED: protease Do-like 9, partial [Brachypodium distachyon]
Length=473

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 123/198 (62%), Gaps = 1/198 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVLR+ +  EF IKL   K L+P H   +
Sbjct  273  ANDGTVPFRHGERIGFSYLVSQKYTGEKAHVKVLRSSKIHEFKIKLAIHKKLIPAHIKGR  332

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ P+L  EYG+D+   +P +L ++ L  +   P EQLV++SQVL+
Sbjct  333  PPSYYIVAGFVFMVVSVPFLRAEYGKDYEFDAPVKLLDKHLHAMAQSPDEQLVVVSQVLV  392

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE L   QV   NG  V NLK L  +VED  +E ++FD+D ++V+VL    AK 
Sbjct  393  ADINIGYEELVNTQVLAFNGKPVNNLKQLATMVEDCKEELLKFDMDYDQVVVLETKTAKA  452

Query  191  ATSRILKRHRIPYAMSSD  138
            AT  IL  H IP  MS D
Sbjct  453  ATQDILATHCIPSVMSDD  470



>ref|XP_007217173.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
 gb|EMJ18372.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
Length=579

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A++KVLRN E  E+SIKL   K L+P H   K
Sbjct  379  ANDGTVPFRHGERIGFSYLVSQKYTGDNALVKVLRNSEILEYSIKLSTHKRLIPAHINGK  438

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  439  PPSYYIIAGFVFAAVSVPYLRSEYGKDYEFDAPVKLLDKHLHSMAQSIDEQLVVVSQVLV  498

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  499  ADINIGYEDIVNTQVLAFNGKPVNNLKNLASMVENCDDEYLKFDLEYDQMVVLQTKTAKA  558

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  559  ATLDILLTHCIPSAMSDDL  577



>ref|XP_002502087.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63345.1| predicted protein [Micromonas sp. RCC299]
Length=463

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 120/199 (60%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A+DG V FR  E ITF++LVS K   E+A ++ LR+G+  E SI    +K LVP H    
Sbjct  264  ASDGTVPFRAGEPITFNYLVSEKYVGESAQVRYLRDGKMQECSITFNAMKRLVPWHIEGT  323

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI  GLVF  +  P+L +EYG+D+   +P +L E+       + G+Q+VI +QVL 
Sbjct  324  PPSYFIAGGLVFTTVCVPFLKNEYGKDYDFDAPVKLLEKFCHGRVEEEGQQVVICAQVLA  383

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             ++N GYE L    V   NGV++ NLK L + VE +  E +RF+LD E  +V++   A  
Sbjct  384  AEVNRGYEDLHNTIVQSFNGVKIFNLKQLAQAVESSKDEFMRFELDHEISVVMDTKAANS  443

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  ILK H IP A S+DL
Sbjct  444  ATKAILKTHAIPSAKSADL  462



>ref|XP_006281902.1| hypothetical protein CARUB_v10028106mg, partial [Capsella rubella]
 gb|EOA14800.1| hypothetical protein CARUB_v10028106mg, partial [Capsella rubella]
Length=466

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 122/202 (60%), Gaps = 32/202 (16%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             ND  + FR +ERI F+HLV++KK  ET +LKVLR G++ EF+I +   + LVP    D+
Sbjct  284  GNDETILFRKKERINFEHLVTLKKSGETVLLKVLRKGKEHEFNIIVRHEQQLVP----DR  339

Query  548  -LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             LPS++I AG VF+PL++PY         N+S   +C  +L +   K GEQ+V++SQV  
Sbjct  340  YLPSYYILAGFVFVPLSKPYA--------NSS--NICNCSLDRKAKKAGEQIVMISQV--  387

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
                            KVNGVEV NL+HL  L+E  S+E +R DL+ ERVI +NY  AK 
Sbjct  388  ---------------KKVNGVEVLNLRHLSDLIEKCSEEDLRLDLEKERVITVNYKSAKE  432

Query  191  ATSRILKRHRIPYAMSSDLIND  126
            AT  IL+ H IP AMS DL  D
Sbjct  433  ATPWILEHHGIPSAMSKDLKED  454



>ref|XP_010254399.1| PREDICTED: protease Do-like 9 isoform X1 [Nelumbo nucifera]
 ref|XP_010254407.1| PREDICTED: protease Do-like 9 isoform X1 [Nelumbo nucifera]
Length=585

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E +V+KVLRN E  EF+IKL   K L+P H   +
Sbjct  386  ANDGTVPFRHGERIGFSYLVSQKYTGENSVVKVLRNSEIFEFNIKLATYKRLIPAHIKGR  445

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  446  PPSYYIIAGFVFTTVSVPYLRSEYGKDYEYDAPVKLLDKHLHAMAQSEDEQLVVVSQVLV  505

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++F+L+ ++++VL   +AK 
Sbjct  506  ADINIGYEDIVNTQVLAFNGKPVKNLKSLASMVENCDDEFLKFELEYQQLVVLQTKIAKA  565

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  I+  H IP AMS DL
Sbjct  566  ATLDIVTTHCIPSAMSEDL  584



>ref|XP_006283387.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
 gb|EOA16285.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
Length=590

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 129/203 (64%), Gaps = 1/203 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  386  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKEILEFNIKLAIHKRLIPAHISGK  445

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  446  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLEKHLHAMAQSVDEQLVVVSQVLV  505

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E ++F+LD  +++VL+   AK 
Sbjct  506  SDINIGYEEIVNTQVLAFNGKPVKNLKGLVEMVENCEDEYMKFNLDYNQIVVLDTKTAKE  565

Query  191  ATSRILKRHRIPYAMSSDLINDE  123
            AT  IL  H IP AMS DL  +E
Sbjct  566  ATLDILTTHCIPSAMSDDLKAEE  588



>ref|XP_010450719.1| PREDICTED: protease Do-like 9 [Camelina sativa]
Length=588

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 128/203 (63%), Gaps = 1/203 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  384  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKEILEFNIKLAIHKRLIPAHISGK  443

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  444  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLEKHLHAMAQSVDEQLVVVSQVLV  503

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE    E ++F+LD  +++VL+   AK 
Sbjct  504  SDINIGYEEIVNTQVVAFNGKPVKNLKGLAEMVEKCEDEYMKFNLDYNQIVVLSTKTAKE  563

Query  191  ATSRILKRHRIPYAMSSDLINDE  123
            AT  IL  H IP AMS DL  +E
Sbjct  564  ATLDILTTHCIPSAMSDDLKAEE  586



>dbj|BAD15737.1| putative DegP2 protease [Oryza sativa Japonica Group]
Length=567

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLRN +  EF IKL   K LV  H   +
Sbjct  367  ANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNSKVHEFKIKLATHKRLVAAHVKGR  426

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  427  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHAMAQSPDEQLVVVSQVLV  486

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  487  ADINIGYEEIVNTQVLAFNGQPVKNLKNLVSMVENCKDEFLKFDLEYDQIVVLETKTAKA  546

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  547  ATQDILTTHCIPSAMSDDL  565



>ref|XP_008647464.1| PREDICTED: uncharacterized protein LOC100217136 isoform X1 [Zea 
mays]
 gb|AFW76815.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=608

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVLRN +  EF+IKL   K L+P H   +
Sbjct  408  ANDGTVPFRHGERIGFTYLVSQKYTGEKARVKVLRNSKIHEFNIKLATHKRLIPAHIKGR  467

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ PYL  EYG+++   +P +L ++ L  +     EQLV++SQVL+
Sbjct  468  PPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDAPVKLLDKHLHAMAQSSDEQLVVVSQVLV  527

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV   NG  V+NLKHL  +VE+ ++  ++FDLD ++V+VL    AK 
Sbjct  528  ADINIGYEDIVNIQVLAFNGTPVKNLKHLATMVEECNEAFLKFDLDFDQVVVLETKTAKA  587

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A S +L
Sbjct  588  ATQDILTTHCIPSAASEEL  606



>emb|CDX99642.1| BnaC04g33990D [Brassica napus]
Length=560

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++K+LRN E  EF++KL   K L+P H   K
Sbjct  360  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNKEILEFNVKLAIHKKLIPAHISGK  419

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  420  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLLEKHLHAMTQSVDEQLVVVSQVLV  479

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E + F+LD  +++VL    AK+
Sbjct  480  SDINIGYEEIVNTQVVAFNGKPVKNLKCLAEMVENCEDEYMEFNLDYHQIVVLQTKTAKM  539

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  540  ATLDILTTHCIPSAMSDDL  558



>gb|EAY87490.1| hypothetical protein OsI_08898 [Oryza sativa Indica Group]
Length=567

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLRN +  EF IKL   K LV  H   +
Sbjct  367  ANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNSKVHEFKIKLATHKRLVAAHVKGR  426

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  427  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHAMAQSPDEQLVVVSQVLV  486

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  487  ADINIGYEEIVNTQVLAFNGQPVKNLKNLVSMVENCKDEFLKFDLEYDQIVVLETKTAKA  546

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  547  ATQDILTTHCIPSAMSDDL  565



>gb|AFW76813.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=596

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A +KVLRN +  EF+IKL   K L+P H   +
Sbjct  396  ANDGTVPFRHGERIGFTYLVSQKYTGEKARVKVLRNSKIHEFNIKLATHKRLIPAHIKGR  455

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF+ ++ PYL  EYG+++   +P +L ++ L  +     EQLV++SQVL+
Sbjct  456  PPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDAPVKLLDKHLHAMAQSSDEQLVVVSQVLV  515

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +  +QV   NG  V+NLKHL  +VE+ ++  ++FDLD ++V+VL    AK 
Sbjct  516  ADINIGYEDIVNIQVLAFNGTPVKNLKHLATMVEECNEAFLKFDLDFDQVVVLETKTAKA  575

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A S +L
Sbjct  576  ATQDILTTHCIPSAASEEL  594



>ref|XP_010913539.1| PREDICTED: protease Do-like 9 isoform X1 [Elaeis guineensis]
Length=582

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E AV+KVLR  +  EF+IKL   K L+P H   K
Sbjct  382  ANDGTVPFRHGERIGFSYLVSQKYTGENAVVKVLREKKVYEFNIKLATHKRLIPAHIRGK  441

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  442  PPSYYIIAGFVFAAISVPYLRSEYGKDYEYDAPVKLLDKHLHSMAQSHDEQLVVVSQVLV  501

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+  +E +RFDL+ ++++VL    AK 
Sbjct  502  ADINIGYEDIVNTQVLAFNGKPVKNLKSLATMVENCDEEFLRFDLEYQQIVVLQTKTAKA  561

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  562  ATKDILLTHCIPSAVSDDL  580



>ref|XP_002511438.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF52040.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=569

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KVLRN     F IKL   + L+P H   +
Sbjct  369  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNSAALNFDIKLSTHRKLIPSHVKGR  428

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AGLVF  ++ PYL  EYG+++   +P +L ++ +  +P  P EQLV++SQVL+
Sbjct  429  PPSYYIIAGLVFSTVSVPYLRSEYGKEYEFEAPVKLLDKLMHAMPQSPDEQLVVVSQVLV  488

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE  + E ++F+L+ E+++VL    AK 
Sbjct  489  ADINIGYEDIVNTQVLAFNGKPVKNLKSLANMVESCNDEFLKFELEYEQIVVLRTKTAKA  548

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  549  ATVDILTTHCIPSAMSEDL  567



>ref|XP_006476740.1| PREDICTED: protease Do-like 9-like isoform X2 [Citrus sinensis]
Length=430

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 126/201 (63%), Gaps = 1/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++A +KVLR+ +   F+I L   + L+P H   +
Sbjct  230  ANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRRLIPSHNKGR  289

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  290  PPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLLDKLLYSMPQLPDEQLVVVSQVLV  349

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ ++V+VL    +K 
Sbjct  350  ADINIGYEEIVNTQVLAFNGNPVKNLKSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKA  409

Query  191  ATSRILKRHRIPYAMSSDLIN  129
            AT  IL  H IP AMS DL N
Sbjct  410  ATLDILATHCIPSAMSDDLKN  430



>ref|XP_008230646.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=579

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A++KVLRN E  E++IKL   K L+P H   K
Sbjct  379  ANDGTVQFRHGERIGFSYLVSQKYTGDNALVKVLRNSEILEYNIKLSTHKRLIPAHINGK  438

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  439  PPSYYIIAGFVFAAVSVPYLRSEYGKDYEFDAPVKLLDKHLHSMAQSIDEQLVVVSQVLV  498

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V NLK L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  499  ADINIGYEDIVNTQVLAFNGKPVNNLKKLASMVENCDDEYLKFDLEYDQMVVLQTKTAKA  558

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  559  ATLDILLTHCIPSAMSDDL  577



>ref|XP_009348028.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=563

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 122/203 (60%), Gaps = 3/203 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V F+  ERI F +LVS K   + A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  337  ANDGTVPFKHGERIGFSYLVSQKYLGDNALIKVLRNFETLEFNIKLAKHKELIPSHIEGK  396

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PSF+I AG VF  ++ PYL  E+G  +    P +L ++ L  +     EQL+++SQVL+
Sbjct  397  PPSFYIIAGFVFTAVSVPYLRSEFGNIF--DVPIKLLDKHLHAMARSIDEQLIVVSQVLV  454

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG+ V+NLK+L  +VE+   E ++F L+  +++VL    AK 
Sbjct  455  ADINIGYEDIVNNQVLTFNGMPVKNLKNLVSMVENCDDEYLKFGLECNQMVVLQTKTAKA  514

Query  191  ATSRILKRHRIPYAMSSDLINDE  123
            AT  IL  H I  +MS DL   E
Sbjct  515  ATLDILTTHCISSSMSDDLKTKE  537



>ref|XP_006649039.1| PREDICTED: protease Do-like 9-like, partial [Oryza brachyantha]
Length=477

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLRN +  EF IKL   K LV  H   +
Sbjct  277  ANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNSKIHEFKIKLATHKRLVAAHVKGR  336

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  337  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHAMAQSPDEQLVVVSQVLV  396

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             +IN GYE +   QV   NG  V+NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  397  ANINIGYEEIVNTQVLAFNGQPVKNLKNLASMVENCKDEFLKFDLEYDQIVVLETKTAKA  456

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  457  ATRDILTTHCIPSAMSDDL  475



>gb|EMS48865.1| Protease Do-like 9 [Triticum urartu]
Length=429

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A++KVLRN +  EF IKL   K L+  H   +
Sbjct  229  ANDGTVPFRHGERIGFSYLVSQKYTGDKALIKVLRNSKVHEFKIKLATHKRLIAAHVKGR  288

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  289  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHSMAESPDEQLVVVSQVLV  348

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  VNG  V+NLK L   VE+   E ++FDL+ ++++VL    AK 
Sbjct  349  ADINIGYEDIVNTQVLAVNGHPVKNLKDLVTTVENCKDEFLKFDLEYDQIVVLETKTAKA  408

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  409  ATEDILTTHCIPSAMSDDL  427



>ref|XP_008793849.1| PREDICTED: protease Do-like 9 [Phoenix dactylifera]
Length=586

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E AV+KVLR     EF+IKL   K LVP H   K
Sbjct  386  ANDGTVPFRHGERIGFSYLVSQKYTGENAVVKVLREKRVYEFNIKLATHKRLVPAHIRGK  445

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  446  PPSYYIIAGFVFTTISVPYLRSEYGKDYEYDAPVKLLDKHLHAMAQSHDEQLVVVSQVLV  505

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+  +E ++FDL+ ++++VL  + AK 
Sbjct  506  ADINIGYEDIVNNQVLSFNGQPVKNLKTLASMVENCDEEFLQFDLEYQQIVVLKTETAKA  565

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  566  ATKDILLTHCIPSAMSDDL  584



>ref|XP_004252664.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=582

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 122/199 (61%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A +KVLR  +  EF IKL   K L+P H   K
Sbjct  382  ANDGTVPFRHGERIGFSYLVSQKYTGDDAQVKVLRKSKTLEFKIKLNAHKRLIPAHIKGK  441

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I  G VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  442  PPSYYIVGGFVFSAVSVPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSMDEQLVVVSQVLV  501

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE L   QV   NG  V+NLK L K+VE   +E ++FDLD  +++VL    AK 
Sbjct  502  ADINIGYEELVNTQVIAFNGKPVKNLKSLAKMVEACKEEYMKFDLDYNQIVVLQTTNAKA  561

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS DL
Sbjct  562  ATSDILAMHCIPSAMSDDL  580



>ref|XP_004953885.1| PREDICTED: protease Do-like 9-like [Setaria italica]
Length=565

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLRN +  EF I+L   K LV  H   +
Sbjct  365  ANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRNSKVHEFKIRLATHKRLVAAHVKGR  424

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  425  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHAMAESPDEQLVVVSQVLV  484

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  485  ADINIGYEEIVNTQVLAFNGQPVKNLKNLVTMVENCKDEFLKFDLEYDQIVVLETKTAKA  544

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  545  ATQDILTTHCIPSAMSDDL  563



>ref|XP_009349862.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=562

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 121/203 (60%), Gaps = 3/203 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V F+  ERI F +LVS K   + A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  336  ANDGTVPFKHGERIGFSYLVSQKYLGDNALIKVLRNFETLEFNIKLAKHKELIPSHIEGK  395

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PSF+I AG +F  ++ PYL  E+G  +    P +L ++ L  +     EQL+++SQVL+
Sbjct  396  PPSFYIIAGFIFTAVSVPYLRSEFGNIF--DVPIKLLDKHLHAMARSIDEQLIVVSQVLV  453

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE+   E ++F L+  +++VL    AK 
Sbjct  454  ADINIGYEDIVNNQVLTFNGTPVKNLKNLVSMVENCDDEYLKFGLECNQMVVLQTKTAKA  513

Query  191  ATSRILKRHRIPYAMSSDLINDE  123
            AT  IL  H I  +MS DL   E
Sbjct  514  ATLDILTTHCISSSMSDDLKTKE  536



>ref|XP_008341479.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=564

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 122/203 (60%), Gaps = 3/203 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A+DG V FR  ERI F +LV+ K   + A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  337  ASDGTVPFRNGERIGFSYLVTQKYIRDNALIKVLRNFETLEFNIKLAKHKELIPSHIEGK  396

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PSF+I AG VF  ++ PYL  E+G  +    P +L ++ L  +     EQL+++SQVL+
Sbjct  397  PPSFYIIAGFVFTAVSVPYLRSEFGNIF--DVPIKLLDKHLHAMAQSIDEQLIVVSQVLV  454

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG+ V+NLK+L  ++E+   E ++F L+  +++VL    AK 
Sbjct  455  ADINIGYEDIVNNQVLTFNGMPVKNLKNLASMIENCDDEYLKFGLEYNQMVVLQTKTAKA  514

Query  191  ATSRILKRHRIPYAMSSDLINDE  123
            AT  IL  H I  +MS DL   E
Sbjct  515  ATLDILTTHCISSSMSDDLKTKE  537



>ref|XP_003288812.1| hypothetical protein DICPUDRAFT_153086 [Dictyostelium purpureum]
 gb|EGC34675.1| hypothetical protein DICPUDRAFT_153086 [Dictyostelium purpureum]
Length=607

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 122/198 (62%), Gaps = 3/198 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            A+DG + FR RERI+F++L S     +   + VLR+GE+    + L     +VP   +D 
Sbjct  393  ADDGSIAFRRRERISFEYLFSSHFIGDKIDITVLRDGERLNLQVPLVNQHRVVPFQMYDS  452

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS+F+++GLVF+P+T P+L E  ED   T  RR+ ER + K+ T    Q+VILSQVL D
Sbjct  453  RPSYFVYSGLVFVPITYPFLLELSEDLAVTY-RRIYER-IEKI-TSEDFQVVILSQVLFD  509

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
              N GY  L+  +V KVNGV V NLKHL +L+E N  + +   L+ E +I+L+ D A+ A
Sbjct  510  KTNHGYSNLSLCEVKKVNGVPVRNLKHLVQLIESNENKYLVITLEHENLIILDKDEAQEA  569

Query  188  TSRILKRHRIPYAMSSDL  135
              R++ +H IP+  S DL
Sbjct  570  NVRVMSQHAIPHLKSLDL  587



>ref|XP_010528270.1| PREDICTED: protease Do-like 9 [Tarenaya hassleriana]
Length=604

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 128/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++KVLRN +  EF+IKL   K L+P H   K
Sbjct  404  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKQILEFNIKLSSHKRLIPAHINGK  463

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L ++ L  +     EQLV++SQVL+
Sbjct  464  PPSYFIIAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLDKHLHSMAQSVDEQLVVVSQVLV  523

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+ + E ++F+L+ E+++VL    AK 
Sbjct  524  SDINIGYEEIVNTQVLAFNGKPVKNLKSLAEMVENCNDEYMKFELEYEQIVVLQTKTAKD  583

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  +L  H IP AMS DL
Sbjct  584  ATLDVLTTHCIPSAMSDDL  602



>ref|XP_005831529.1| hypothetical protein GUITHDRAFT_72154 [Guillardia theta CCMP2712]
 gb|EKX44549.1| hypothetical protein GUITHDRAFT_72154 [Guillardia theta CCMP2712]
Length=393

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 91/134 (68%), Gaps = 6/134 (4%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             NDG V FR RERI+FD+++S K   ++ +  V        +S++  PLK LVP+ Q+D 
Sbjct  263  GNDGTVVFRNRERISFDYVLSRKFAGQSRLQDV------QLYSVEAQPLKHLVPIQQYDL  316

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
            LP +FI+AGLVF PL+QPYLHEYG+DWYNTSPRRLC+RAL        ++ VILSQVL D
Sbjct  317  LPRYFIYAGLVFTPLSQPYLHEYGDDWYNTSPRRLCDRALMGEQQIEDQEAVILSQVLQD  376

Query  368  DINTGYERLAELQV  327
              N GYE L  +Q 
Sbjct  377  STNAGYEALCNMQA  390



>ref|XP_011028602.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=556

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + A +KV RN +  EF IKL   + L+P H   K
Sbjct  356  ANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVFRNSKTLEFVIKLSTHRRLIPPHVKGK  415

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  416  PPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEAPVKLLDKLLHSMPQSPDEQLVVVSQVLV  475

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  476  ADINIGYEDIVNTQVLAFNGKPVKNLKSLASMVENCDDEFLKFDLEYDQIVVLRMKTAKE  535

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S DL
Sbjct  536  ATVDILTTHCIPSAISDDL  554



>ref|XP_009139975.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=581

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 126/201 (63%), Gaps = 1/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++K+LRN E  EF+IKL   K L+P H   K
Sbjct  381  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNKEILEFNIKLAIHKKLIPGHIGGK  440

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L ++ L  +     EQLV++SQVL+
Sbjct  441  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLDKHLHAMAQSVDEQLVVVSQVLV  500

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E + F LD ++++VL    AK 
Sbjct  501  SDINIGYEEIVNTQVLAFNGKPVKNLKCLAEMVENCDDEYMEFSLDYDQIVVLQTKTAKE  560

Query  191  ATSRILKRHRIPYAMSSDLIN  129
            AT  IL  H IP AMS DL N
Sbjct  561  ATLDILTTHCIPSAMSDDLKN  581



>ref|XP_011399889.1| Protease Do-like 9 [Auxenochlorella protothecoides]
 gb|KFM26933.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=465

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 114/199 (57%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
              DG V FR+ ERI F +L+S K   + A L+VL  G   + ++ L     L+PVH  ++
Sbjct  262  GTDGTVPFRSGERIGFSYLISQKYTGDMATLRVLHEGAARQVTVPLTTPFKLIPVHIHNR  321

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI  GLVF P+T P L  EYG+++   +P +L ++ +  +   PG+Q+V+L+QVL 
Sbjct  322  PPSYFILGGLVFTPVTVPLLRSEYGKEFDYDAPVKLLDKMMHAMADAPGQQIVVLAQVLA  381

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             D+N GYE +   QV+ VNG  V  L  L    E  + E IR DL+  +V++L  + A  
Sbjct  382  ADVNVGYEDIVNTQVHAVNGQRVTCLAELVAAAEGGAGEYIRLDLEYNQVVILGKEEAAA  441

Query  191  ATSRILKRHRIPYAMSSDL  135
            A   IL++H I    S DL
Sbjct  442  AMPAILEQHCIAADRSEDL  460



>ref|XP_002452567.1| hypothetical protein SORBIDRAFT_04g028270 [Sorghum bicolor]
 gb|EES05543.1| hypothetical protein SORBIDRAFT_04g028270 [Sorghum bicolor]
Length=565

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E A++KVLR+ +  EF I+L   K LV  H   +
Sbjct  365  ANDGTVPFRHGERIGFSYLVSQKYTGEKALVKVLRDSKVHEFKIRLATHKRLVAAHVKGR  424

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  425  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHAMAESPDEQLVVVSQVLV  484

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE+   E ++FDL+ ++++VL    AK 
Sbjct  485  SDINIGYEEIVNTQVLAFNGQPVKNLKNLATMVENCKDEFLKFDLEYDQIVVLETKTAKA  544

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  545  ATQDILTTHCIPSAMSDDL  563



>emb|CDY44585.1| BnaA04g10050D [Brassica napus]
Length=581

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 126/201 (63%), Gaps = 1/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++K+LRN E  EF+IKL   K L+P H   K
Sbjct  381  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNKEILEFNIKLAIHKKLIPGHIGGK  440

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L ++ L  +     EQLV++SQVL+
Sbjct  441  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLDKHLHAMAQSVDEQLVVVSQVLV  500

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E + F LD ++++VL    AK 
Sbjct  501  SDINIGYEEIVNTQVLAFNGKPVKNLKCLAEMVENCDDEYMEFSLDYDQIVVLQTKTAKE  560

Query  191  ATSRILKRHRIPYAMSSDLIN  129
            AT  IL  H IP AMS DL N
Sbjct  561  ATLDILTTHCIPSAMSDDLKN  581



>gb|KFK33145.1| hypothetical protein AALP_AA6G336800 [Arabis alpina]
Length=581

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 125/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  381  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKEILEFNIKLAIHKRLIPAHISGK  440

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  441  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLEKHLHAMAQSMDEQLVVVSQVLV  500

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE    E + F+LD E+++VL+   AK 
Sbjct  501  SDINIGYEEIVNTQVLAFNGKPVKNLKGLAEMVEKCDDEYMEFNLDYEQLVVLHTKTAKE  560

Query  191  ATSRILKRHRIPYAMSSDL  135
             T  IL  H IP AMS DL
Sbjct  561  TTLDILTTHCIPSAMSDDL  579



>emb|CDY53116.1| BnaCnng24440D [Brassica napus]
Length=581

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 126/201 (63%), Gaps = 1/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++K+LRN E  EF+IKL   K L+P H   K
Sbjct  381  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNKEILEFNIKLAIHKKLIPGHIGGK  440

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L ++ L  +     EQLV++SQVL+
Sbjct  441  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLDKHLHAMAQSVDEQLVVVSQVLV  500

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E + F LD ++++VL    AK 
Sbjct  501  SDINIGYEEIVNTQVLAFNGKPVKNLKCLAEMVENCDDEYMEFSLDYDQIVVLQTKTAKE  560

Query  191  ATSRILKRHRIPYAMSSDLIN  129
            AT  IL  H IP AMS DL N
Sbjct  561  ATLDILTTHCIPSAMSDDLKN  581



>emb|CDX91770.1| BnaC08g06890D [Brassica napus]
Length=280

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 122/188 (65%), Gaps = 26/188 (14%)
 Frame = -1

Query  698  RERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLPSFFIFAGL  519
            R+RI+F +L+SMKKP ET+++KVLR G++ E++I L P+KP V V Q+ K PS++IF G 
Sbjct  114  RQRISFYYLISMKKPGETSMIKVLRRGKEHEYNINLKPVKPHVRVQQYYKRPSYYIFGGF  173

Query  518  VFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLA  339
            VF+P      H   E                       EQ VI+S++L DDIN GYE   
Sbjct  174  VFVPN-----HNLSES---------------------EEQHVIISEILEDDINQGYESFK  207

Query  338  ELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRI  159
            +LQV KVN V+V+NL+HL +L+E+N  + +  DL+D++V+VLNY+ AK A S ILKRH I
Sbjct  208  DLQVEKVNKVKVKNLRHLFELIEENGTQNLSIDLEDDKVLVLNYESAKKADSIILKRHNI  267

Query  158  PYAMSSDL  135
              A+S+DL
Sbjct  268  TSAISNDL  275



>ref|XP_002868670.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44929.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 127/203 (63%), Gaps = 1/203 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  388  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNTEILEFNIKLAIHKRLIPAHISGK  447

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  448  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLEKHLHAMAQSVDEQLVVVSQVLV  507

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE    E ++F+LD ++++ L    AK 
Sbjct  508  SDINIGYEEIVNTQVLAFNGKPVKNLKGLAEMVEKCEDEYMKFNLDYDQLVTLETKRAKE  567

Query  191  ATSRILKRHRIPYAMSSDLINDE  123
            AT  IL  H IP AMS DL  +E
Sbjct  568  ATLDILTTHCIPSAMSDDLKAEE  590



>ref|XP_006476739.1| PREDICTED: protease Do-like 9-like isoform X1 [Citrus sinensis]
Length=585

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 126/201 (63%), Gaps = 1/201 (0%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   ++A +KVLR+ +   F+I L   + L+P H   +
Sbjct  385  ANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRRLIPSHNKGR  444

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P  P EQLV++SQVL+
Sbjct  445  PPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLLDKLLYSMPQLPDEQLVVVSQVLV  504

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ ++V+VL    +K 
Sbjct  505  ADINIGYEEIVNTQVLAFNGNPVKNLKSLANMVENCDDEFLKFDLEYDQVVVLRTKTSKA  564

Query  191  ATSRILKRHRIPYAMSSDLIN  129
            AT  IL  H IP AMS DL N
Sbjct  565  ATLDILATHCIPSAMSDDLKN  585



>gb|EMT18472.1| Protease Do-like protein 9 [Aegilops tauschii]
Length=496

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A++KVLRN +  EF IKL   K L+  H   +
Sbjct  296  ANDGTVPFRHGERIGFSYLVSQKYTGDKALIKVLRNSKVHEFKIKLATHKRLIAAHVKGR  355

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  356  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHSMAESPDEQLVVVSQVLV  415

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  VNG  V+NL+ L   VE+   E ++FDL+ ++++VL    AK 
Sbjct  416  ADINIGYEDIVNTQVLAVNGHPVKNLRDLVTTVENCKDEFLKFDLEYDQIVVLERKTAKA  475

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  476  ATEDILTTHCIPSAMSDDL  494



>ref|XP_010233342.1| PREDICTED: protease Do-like 2, chloroplastic [Brachypodium distachyon]
Length=616

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 115/196 (59%), Gaps = 3/196 (2%)
 Frame = -1

Query  722  DGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLP  543
            +G V FR+ ERI F +L S K   + A L ++R G   +    L P K LVP H     P
Sbjct  388  EGTVPFRSTERIAFRYLTSQKYAGDVAELGIIREGNFMKVQTTLHPRKHLVPFHVEGGQP  447

Query  542  SFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDI  363
            S+ I AGLVF PLT+P++ E  ED   T   +L  +A   L T  GEQ+VI+SQVL +D+
Sbjct  448  SYLIVAGLVFTPLTEPFIEEECED---TLGLKLLAKARYSLSTFEGEQIVIVSQVLANDV  504

Query  362  NTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATS  183
            N GYE +   QV K+NG  V+N+ HL  LV+    + + F+ +D+ ++VL+ + A  A+S
Sbjct  505  NIGYEHMGNQQVIKLNGTMVKNIHHLAHLVDTCQDKFLTFEFEDDFLVVLDREEAMAASS  564

Query  182  RILKRHRIPYAMSSDL  135
             I K H IP   SSDL
Sbjct  565  DIQKEHAIPSVRSSDL  580



>ref|XP_007140930.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
 gb|ESW12924.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
Length=568

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A +KVLR+ +  EF+IKL   K LVP H   +
Sbjct  368  ANDGTVPFRHGERIGFSYLVSQKYTGDRAQVKVLRDSQILEFNIKLATHKRLVPAHIKGR  427

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +     EQLV++SQVL+
Sbjct  428  PPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKLLNKHLHSMAQSVDEQLVVVSQVLV  487

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE    E ++FDL+ ++++VL    AK 
Sbjct  488  SDINIGYEEIVNTQVLAFNGKPVKNLKNLASMVESCDDEYLKFDLEYQQIVVLKASTAKA  547

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  548  ATLDILTTHCIPSAMSEDL  566



>ref|XP_004298924.1| PREDICTED: protease Do-like 9 [Fragaria vesca subsp. vesca]
Length=567

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 122/199 (61%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   + + +KVLRN E   F IKL   K L+P H   +
Sbjct  367  ANDGTVPFRHGERIGFSYLISQKYTGDNSKVKVLRNSEILSFDIKLASHKRLIPSHIKGR  426

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  L   P EQLV++SQVL+
Sbjct  427  PPSYYIVAGFVFTAVSVPYLRSEYGKDYEFEAPVKLLDKMLHSLRQSPDEQLVVVSQVLV  486

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+   E ++FDL+ ++V VL    AK 
Sbjct  487  ADINIGYEDIVNTQVLAFNGKPVKNLKSLASMVENCDDEFLKFDLEYQQVAVLQTKTAKA  546

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  547  ATLDILATHCIPSAMSDDL  565



>ref|XP_006405537.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
 gb|ESQ46990.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
Length=589

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  389  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKEILEFNIKLAIHKKLIPAHISGK  448

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L ++ L  +     EQLV++SQVL+
Sbjct  449  PPSYYIVAGFVFTTVSVPYLRSEYGKEYEFDAPVKLLDKHLHAMAQSVDEQLVVVSQVLV  508

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E + F+LD ++++VL    AK 
Sbjct  509  SDINIGYEDIVNTQVLAFNGKPVKNLKSLAEMVENCDDEYMEFNLDYDQLVVLQTKTAKE  568

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  569  ATLDILTTHCIPSAMSDDL  587



>ref|XP_004357429.1| hypothetical protein DFA_02707 [Dictyostelium fasciculatum]
 gb|EGG18967.1| hypothetical protein DFA_02707 [Dictyostelium fasciculatum]
Length=631

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 120/200 (60%), Gaps = 3/200 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG + FR RERI++++L+S +   +T  + V R GE  + +I L P   +VP   +D+
Sbjct  434  ANDGSIAFRRRERISYEYLLSSRFIGDTIDVTVFRKGESLQLTIPLVPQIRVVPYQLYDR  493

Query  548  LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLD  369
             PS+F  AG VF+P+T P L E  ED   T  RR+ E+      T P  Q+V+++QVL+D
Sbjct  494  RPSYFFHAGFVFLPVTYPLLTEISEDLAPTY-RRVYEKVDNI--TSPDYQIVVIAQVLID  550

Query  368  DINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVA  189
             IN GY      +V KVN + ++NLKHL +L+E N+ + +   L+ + +I+L+ D    A
Sbjct  551  KINYGYSSFGLCEVKKVNNIPIKNLKHLVELIESNTNQYLVITLEHDYLIILDRDEVMEA  610

Query  188  TSRILKRHRIPYAMSSDLIN  129
              RI+ +H IP A S DL N
Sbjct  611  NKRIMAQHAIPSAKSDDLKN  630



>ref|XP_002885149.1| DEGP12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61408.1| DEGP12 [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 114/185 (62%), Gaps = 13/185 (7%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQ--F  555
             ND    FR  ERI+F+H +SMKKP+E  ++KVLR G++ E++I L P+           
Sbjct  321  GNDETCPFRNEERISFNHFISMKKPDEKILVKVLRKGKEHEYNISLKPVSETTHASATIL  380

Query  554  DKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVL  375
              LPS++IF G VF+PLT+ Y+ +   +       ++ +           EQ VI+SQV+
Sbjct  381  YNLPSYYIFGGFVFVPLTKSYIDDLSLECVLNDEYKITD-----------EQQVIISQVM  429

Query  374  LDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAK  195
             DDIN GY    +LQV KVNGV+V+NLKHLR+L+E    + +R DL++++V+VLNY+ AK
Sbjct  430  PDDINKGYSNFKDLQVEKVNGVKVKNLKHLRELIEGCCGKDLRLDLENDKVMVLNYESAK  489

Query  194  VATSR  180
             A  R
Sbjct  490  KANLR  494



>ref|XP_009609244.1| PREDICTED: protease Do-like 9 [Nicotiana tomentosiformis]
Length=574

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 121/199 (61%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A +KVLR  +  EF IKL   K L+P H   K
Sbjct  374  ANDGTVPFRHGERIGFSYLVSQKYTGDDARVKVLRKSKTLEFKIKLNAHKRLIPAHIKGK  433

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I  G VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  434  PPSYYIVGGFVFTAVSVPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSIDEQLVVVSQVLV  493

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE L   QV   NG  ++NLK L  + E   +E ++FDLD ++++VL    AK 
Sbjct  494  ADINIGYEELVNTQVLAFNGKPIKNLKSLANMAEACKEEYMKFDLDYDQIVVLQTKNAKA  553

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS DL
Sbjct  554  ATSDILAMHCIPSAMSDDL  572



>ref|XP_008780936.1| PREDICTED: protease Do-like 9 [Phoenix dactylifera]
Length=582

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 126/199 (63%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   E AV+KVLR  +  EF+IKL   K L+P H   K
Sbjct  382  ANDGTVPFRHGERIGFSYLVSQKYTGEHAVVKVLREKKVYEFNIKLATHKRLIPAHIKGK  441

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  442  PPSYYIIAGFVFSAISVPYLRSEYGKEYEYDAPVKLLEKHLHAMAQSHDEQLVVVSQVLV  501

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L  +VE+  +E ++FDL+ ++++VL    AK 
Sbjct  502  ADINIGYEDIVNTQVLAFNGKPVKNLKSLATMVENCDEEFLQFDLEYQQIVVLQTKTAKA  561

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP A+S+DL
Sbjct  562  ATKDILLTHCIPSAVSNDL  580



>ref|XP_010678715.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 116/200 (58%), Gaps = 3/200 (2%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
             NDG V FR  ERI F++L+S K   +   +K+LR+ E  EF IK  P K L+P    D+
Sbjct  285  GNDGTVVFRHGERIGFNYLISQKYTGDNTKIKLLRDSEMHEFDIKFDPHKKLIPTCTDDR  344

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++  YL  EY     +  P  L  +    +     E+L+I+SQVL+
Sbjct  345  PPSYYILAGFVFTAVSVSYLFSEYSS--MSDFPVELLYKLHYSMAKSNDEELIIISQVLV  402

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE L  +QV  VNG  V+NLK  + +VE  + E ++FDL+   ++VL  + AK 
Sbjct  403  ADINIGYEDLTNVQVIAVNGNPVKNLKSFKNMVESCNSEFLKFDLEFNMMVVLRTETAKA  462

Query  191  ATSRILKRHRIPYAMSSDLI  132
             T+ IL  H IP AMS DL+
Sbjct  463  TTAEILATHCIPSAMSDDLL  482



>ref|XP_004306333.2| PREDICTED: protease Do-like 9 [Fragaria vesca subsp. vesca]
Length=560

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   +TA++KVLRN +  EF IKL   K L+P H   K
Sbjct  360  ANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRNSKILEFKIKLGTHKRLIPAHINGK  419

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I  G VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  420  PPSYYIIGGFVFSAVSVPYLRSEYGKDYDFDAPVKLLDKHLHAMAESSDEQLVVVSQVLV  479

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +VE   +E ++FDL+  +++ L    AK 
Sbjct  480  ADINIGYEDIVNTQVLAFNGKPVKNLKNLATMVESCDEEYLKFDLEYNQMVALQTKTAKA  539

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  540  ATLDILLTHCIPSAMSDDL  558



>ref|XP_006363999.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=582

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 121/199 (61%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A +KVLR  +  EF IKL   K L+P H   K
Sbjct  382  ANDGTVPFRHGERIGFSYLVSQKYTGDDAQVKVLRKSKILEFKIKLNAHKRLIPAHIKGK  441

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I  G VF  ++ PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  442  PPSYYIVGGFVFSAVSVPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSIDEQLVVVSQVLV  501

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE L   QV   NG  V+NLK L  +VE   +E ++FDLD  +++VL    AK 
Sbjct  502  ADINIGYEELVNTQVIAFNGKPVKNLKSLANMVEACKEEYLKFDLDYNQIVVLQTKNAKA  561

Query  191  ATSRILKRHRIPYAMSSDL  135
            ATS IL  H IP AMS DL
Sbjct  562  ATSDILAMHCIPSAMSDDL  580



>emb|CDY15934.1| BnaA04g11770D [Brassica napus]
Length=583

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++K+LRN E  EF++KL   K L+P H   K
Sbjct  383  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNREILEFNVKLAIHKKLIPAHISGK  442

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  443  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLLEKHLHAMTQSVDEQLVVVSQVLV  502

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E + F LD  +++VL    AK 
Sbjct  503  SDINIGYEEIVNTQVVAFNGKPVKNLKCLAEMVENCVDEYMEFYLDYHQIVVLQTKTAKE  562

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  563  ATLDILTTHCIPSAMSDDL  581



>emb|CBI15070.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A + VLR+ +  +F+IKL   + ++P H   K
Sbjct  264  ANDGTVPFRHGERIGFSYLVSQKYTGDNATITVLRDSKMLKFNIKLATHRRIIPAHNKGK  323

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L ++ L  +P    EQLV++SQVL+
Sbjct  324  PPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEAPVKLLDKLLHSMPQSEDEQLVVVSQVLV  383

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  +NG  V+NLK L  +VE    E ++FDL+ ++++VL    AK 
Sbjct  384  ADINIGYEDIVNTQVLALNGKPVKNLKSLANMVESCDDEFLKFDLEYQQIVVLRTKTAKA  443

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP  MS DL
Sbjct  444  ATLDILTTHCIPSKMSDDL  462



>ref|XP_004960292.1| PREDICTED: protease Do-like 2, chloroplastic-like [Setaria italica]
Length=599

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 115/196 (59%), Gaps = 3/196 (2%)
 Frame = -1

Query  722  DGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDKLP  543
            +  V FR+ ERI F +L S K   + A L ++R+G   +    L P K LVP H     P
Sbjct  371  EATVPFRSTERIAFRYLTSQKYAGDIAQLGIIRDGNSMKVQTILQPRKHLVPFHVEGGQP  430

Query  542  SFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDI  363
            S+ I AGLVF PLT+P++ E  ED   T   +L  +A   L T  GEQ+VI+SQVL  ++
Sbjct  431  SYLIVAGLVFTPLTEPFIEEECED---TLGLKLLAKARYSLATFEGEQIVIVSQVLAHEV  487

Query  362  NTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATS  183
            N GYE +   Q+ K+NG  V+N+ HL  LV+    + + F+ +D+ ++VLN + A  A+S
Sbjct  488  NIGYEHMGNQQLIKLNGTAVKNIHHLAHLVDTCKDKFLTFEFEDDFLVVLNREEATAASS  547

Query  182  RILKRHRIPYAMSSDL  135
             ILK H IP   SSDL
Sbjct  548  DILKEHAIPSVRSSDL  563



>dbj|BAK07966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   + A++KVLR+ +  EF IKL   K L+  H   +
Sbjct  363  ANDGTVPFRHGERIGFSYLVSQKYTGDKALIKVLRDSKVHEFKIKLATHKRLIAAHVKGR  422

Query  548  LPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P +L  + L  +   P EQLV++SQVL+
Sbjct  423  PPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDAPVKLLVKHLHSMVESPDEQLVVVSQVLV  482

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV  VNG  V+NLK L   VE+   E ++FDL+ ++++VL    AK 
Sbjct  483  ADINIGYEEIVNTQVLAVNGHPVKNLKDLVTTVENCKDEFLKFDLEYDQIVVLETKTAKA  542

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  543  ATQDILTTHCIPSAMSDDL  561



>ref|XP_009140230.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=584

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +L+S K   ++A++K+LRN E  EF++KL   K L+P H   K
Sbjct  384  ANDGTVPFRHGERIGFSYLISQKYTGDSALVKILRNREILEFNVKLAIHKKLIPAHISGK  443

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS+FI AG VF  ++ PYL  EYG+++   +P +L E+ L  +     EQLV++SQVL+
Sbjct  444  PPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDAPVKLLEKHLHAMTQSVDEQLVVVSQVLV  503

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK L ++VE+   E + F LD  +++VL    AK 
Sbjct  504  SDINIGYEEIVNTQVVAFNGKPVKNLKCLAEMVENCVDEYMEFYLDYHQIVVLQTKTAKE  563

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  564  ATLDILTTHCIPSAMSDDL  582



>ref|XP_007031392.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY02318.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
Length=587

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 123/199 (62%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG V FR  ERI F +LVS K   +TA++KVLR+ E     IKL   K L+P H   K
Sbjct  387  ANDGTVPFRHGERIGFSYLVSQKYTGDTALVKVLRDSEIVAHDIKLATHKRLIPAHTNGK  446

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  +T PYL  EYG+D+   +P +L ++ L  +     EQLV++SQVL+
Sbjct  447  PPSYYIIAGFVFTAVTVPYLRSEYGKDYEFDAPVKLLDKHLHAMAESTDEQLVVVSQVLV  506

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NL+ L  +VE+ + E +RF+L+ ++++VL    AK 
Sbjct  507  ADINIGYEEIVNTQVLAFNGKLVKNLRSLAHMVENCNDEYLRFELEYQQIVVLQTKAAKA  566

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H I  AMS DL
Sbjct  567  ATLDILTTHCISSAMSDDL  585



>ref|XP_002517376.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF44918.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=582

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = -1

Query  728  ANDGXVHFRTRERITFDHLVSMKKPNETAVLKVLRNGEKXEFSIKLFPLKPLVPVHQFDK  549
            ANDG + FR  ERI+F +LVS K   + A++KVLRN E  EF+IKL   K L+P H   K
Sbjct  382  ANDGTIPFRHGERISFSYLVSQKYTGDKAMVKVLRNSEILEFNIKLAIHKRLIPAHIRGK  441

Query  548  LPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLL  372
             PS++I AG VF  ++ PYL  EYG+D+   +P ++ ++ L  +     EQ+V++SQVL+
Sbjct  442  PPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDAPVKILDKHLHAMAQSVDEQVVVVSQVLV  501

Query  371  DDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKV  192
             DIN GYE +   QV   NG  V+NLK+L  +V+  S E + FDL+ ++++VL+   AK 
Sbjct  502  ADINIGYEDIVNTQVLAFNGKPVKNLKNLAYMVDSCSDEFLMFDLEYQQIVVLHAKNAKA  561

Query  191  ATSRILKRHRIPYAMSSDL  135
            AT  IL  H IP AMS DL
Sbjct  562  ATLDILATHCIPSAMSDDL  580



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890